Psyllid ID: psy1206
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 531 | ||||||
| 157169412 | 380 | flap endonuclease-1 [Aedes aegypti] gi|1 | 0.254 | 0.355 | 0.781 | 4e-63 | |
| 110766831 | 379 | PREDICTED: flap endonuclease 1 [Apis mel | 0.254 | 0.356 | 0.781 | 6e-62 | |
| 58390636 | 383 | AGAP011448-PA [Anopheles gambiae str. PE | 0.254 | 0.352 | 0.788 | 1e-61 | |
| 380015033 | 383 | PREDICTED: flap endonuclease 1-like [Api | 0.254 | 0.352 | 0.774 | 1e-61 | |
| 193659550 | 380 | PREDICTED: flap endonuclease 1 [Acyrthos | 0.256 | 0.357 | 0.762 | 3e-61 | |
| 312385968 | 385 | hypothetical protein AND_00127 [Anophele | 0.254 | 0.350 | 0.781 | 4e-61 | |
| 350416440 | 381 | PREDICTED: flap endonuclease 1-like [Bom | 0.254 | 0.354 | 0.753 | 1e-59 | |
| 156398094 | 377 | predicted protein [Nematostella vectensi | 0.254 | 0.358 | 0.732 | 2e-59 | |
| 242014497 | 380 | Flap endonuclease 1-B, putative [Pedicul | 0.254 | 0.355 | 0.746 | 2e-59 | |
| 340717150 | 381 | PREDICTED: LOW QUALITY PROTEIN: flap end | 0.254 | 0.354 | 0.760 | 2e-59 |
| >gi|157169412|ref|XP_001651504.1| flap endonuclease-1 [Aedes aegypti] gi|122094730|sp|Q178M1.1|FEN1_AEDAE RecName: Full=Flap endonuclease 1; Short=FEN-1; AltName: Full=Flap structure-specific endonuclease 1 gi|108878396|gb|EAT42621.1| AAEL005870-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
Score = 249 bits (635), Expect = 4e-63, Method: Compositional matrix adjust.
Identities = 111/142 (78%), Positives = 131/142 (92%)
Query: 61 APCEAEAQCAAMVKAGKVYATATEDMDALTFGSNILLRHMTFSEARKLPVQEFHLEKVLE 120
APCEAEAQCAA+VK GKVYATATEDMDALTFGSNILLRH+TFSEARK+PVQEF+ +K+L+
Sbjct: 155 APCEAEAQCAALVKGGKVYATATEDMDALTFGSNILLRHLTFSEARKMPVQEFNYDKILQ 214
Query: 121 GMELSHEEFIDLCILLGCDYCDSIRGIGPKRAIELIKEHRSIEKILENIDTKKYTVPEGW 180
G+EL+ +EFIDLCILLGCDYCDSIRGIGPK+A+ELI +HR+IEKILEN+DTKKY VPE W
Sbjct: 215 GLELTRDEFIDLCILLGCDYCDSIRGIGPKKAVELINKHRTIEKILENLDTKKYVVPENW 274
Query: 181 LYKEARELFRHPEVADPETIEF 202
Y++AR LF+ PEVA+PE +E
Sbjct: 275 NYQQARVLFKEPEVANPEEVEL 296
|
Source: Aedes aegypti Species: Aedes aegypti Genus: Aedes Family: Culicidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|110766831|ref|XP_395769.3| PREDICTED: flap endonuclease 1 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|58390636|ref|XP_317855.2| AGAP011448-PA [Anopheles gambiae str. PEST] gi|74802123|sp|Q7Q323.2|FEN1_ANOGA RecName: Full=Flap endonuclease 1; Short=FEN-1; AltName: Full=Flap structure-specific endonuclease 1 gi|55237026|gb|EAA13029.2| AGAP011448-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|380015033|ref|XP_003691516.1| PREDICTED: flap endonuclease 1-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|193659550|ref|XP_001944971.1| PREDICTED: flap endonuclease 1 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|312385968|gb|EFR30352.1| hypothetical protein AND_00127 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|350416440|ref|XP_003490949.1| PREDICTED: flap endonuclease 1-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|156398094|ref|XP_001638024.1| predicted protein [Nematostella vectensis] gi|317374916|sp|A7RRJ0.1|FEN1_NEMVE RecName: Full=Flap endonuclease 1; Short=FEN-1; AltName: Full=Flap structure-specific endonuclease 1 gi|156225141|gb|EDO45961.1| predicted protein [Nematostella vectensis] | Back alignment and taxonomy information |
|---|
| >gi|242014497|ref|XP_002427926.1| Flap endonuclease 1-B, putative [Pediculus humanus corporis] gi|212512410|gb|EEB15188.1| Flap endonuclease 1-B, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|340717150|ref|XP_003397050.1| PREDICTED: LOW QUALITY PROTEIN: flap endonuclease 1-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 531 | ||||||
| ZFIN|ZDB-GENE-031112-11 | 380 | fen1 "flap structure-specific | 0.331 | 0.463 | 0.587 | 2.5e-73 | |
| FB|FBgn0025832 | 385 | Fen1 "Flap endonuclease 1" [Dr | 0.265 | 0.366 | 0.730 | 6e-72 | |
| UNIPROTKB|P70054 | 382 | fen1-b "Flap endonuclease 1-B" | 0.265 | 0.369 | 0.680 | 1.6e-71 | |
| UNIPROTKB|P70040 | 382 | fen1-a "Flap endonuclease 1-A" | 0.329 | 0.458 | 0.568 | 5.3e-71 | |
| UNIPROTKB|Q5ZLN4 | 381 | FEN1 "Flap endonuclease 1" [Ga | 0.331 | 0.461 | 0.570 | 6.8e-69 | |
| RGD|621821 | 380 | Fen1 "flap structure-specific | 0.333 | 0.465 | 0.556 | 1.1e-68 | |
| UNIPROTKB|J9PB88 | 380 | FEN1 "Flap endonuclease 1" [Ca | 0.333 | 0.465 | 0.556 | 1.8e-68 | |
| UNIPROTKB|P39748 | 380 | FEN1 "Flap endonuclease 1" [Ho | 0.333 | 0.465 | 0.556 | 2.3e-68 | |
| UNIPROTKB|Q58DH8 | 380 | FEN1 "Flap endonuclease 1" [Bo | 0.265 | 0.371 | 0.666 | 6e-68 | |
| UNIPROTKB|F1RKS3 | 380 | FEN1 "Flap endonuclease 1" [Su | 0.265 | 0.371 | 0.673 | 6e-68 |
| ZFIN|ZDB-GENE-031112-11 fen1 "flap structure-specific endonuclease 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 559 (201.8 bits), Expect = 2.5e-73, Sum P(2) = 2.5e-73
Identities = 104/177 (58%), Positives = 134/177 (75%)
Query: 25 EDRIRNGAKKLLKARSSTTQGRLDSFFTIRREEKRKAPCEAEAQCAAMVKAGKVYATATE 84
++ I +K+L+K + ++ +APCEAEA CAA+VKAGKVYATATE
Sbjct: 120 QENIDKFSKRLVKVTKQHNE-ECKKLLSLMGVPYIEAPCEAEASCAALVKAGKVYATATE 178
Query: 85 DMDALTFGSNILLRHMTFSEARKLPVQEFHLEKVLEGMELSHEEFIDLCILLGCDYCDSI 144
DMD LTFG+ +LLRH+T SEA+KLP+QEFH ++L+ MEL+H++FIDLCILLGCDYC +I
Sbjct: 179 DMDGLTFGTTVLLRHLTASEAKKLPIQEFHFSRILQDMELTHQQFIDLCILLGCDYCGTI 238
Query: 145 RGIGPKRAIELIKEHRSIEKILENIDTKKYTVPEGWLYKEARELFRHPEVADPETIE 201
+GIGPKRAI+LIK+H SIE+ILENID K+ PE WLYKEAR LF PEV D +++
Sbjct: 239 KGIGPKRAIDLIKQHGSIEEILENIDPNKHPAPEDWLYKEARGLFLEPEVVDGTSVD 295
|
|
| FB|FBgn0025832 Fen1 "Flap endonuclease 1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P70054 fen1-b "Flap endonuclease 1-B" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P70040 fen1-a "Flap endonuclease 1-A" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZLN4 FEN1 "Flap endonuclease 1" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| RGD|621821 Fen1 "flap structure-specific endonuclease 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9PB88 FEN1 "Flap endonuclease 1" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P39748 FEN1 "Flap endonuclease 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q58DH8 FEN1 "Flap endonuclease 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RKS3 FEN1 "Flap endonuclease 1" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 531 | |||
| PTZ00217 | 393 | PTZ00217, PTZ00217, flap endonuclease-1; Provision | 8e-83 | |
| cd09867 | 261 | cd09867, PIN_FEN1, PIN domain of Flap Endonuclease | 4e-48 | |
| PTZ00217 | 393 | PTZ00217, PTZ00217, flap endonuclease-1; Provision | 1e-43 | |
| cd09907 | 70 | cd09907, H3TH_FEN1-Euk, H3TH domain of Flap Endonu | 4e-42 | |
| cd09907 | 70 | cd09907, H3TH_FEN1-Euk, H3TH domain of Flap Endonu | 2e-40 | |
| PRK03980 | 292 | PRK03980, PRK03980, flap endonuclease-1; Provision | 7e-40 | |
| TIGR03674 | 338 | TIGR03674, fen_arch, flap structure-specific endon | 5e-37 | |
| PTZ00217 | 393 | PTZ00217, PTZ00217, flap endonuclease-1; Provision | 5e-36 | |
| cd09901 | 73 | cd09901, H3TH_FEN1-like, H3TH domains of Flap endo | 7e-33 | |
| cd09867 | 261 | cd09867, PIN_FEN1, PIN domain of Flap Endonuclease | 1e-32 | |
| cd09901 | 73 | cd09901, H3TH_FEN1-like, H3TH domains of Flap endo | 4e-31 | |
| TIGR03674 | 338 | TIGR03674, fen_arch, flap structure-specific endon | 7e-31 | |
| pfam00752 | 100 | pfam00752, XPG_N, XPG N-terminal domain | 3e-26 | |
| COG0258 | 310 | COG0258, Exo, 5'-3' exonuclease (including N-termi | 4e-26 | |
| smart00485 | 99 | smart00485, XPGN, Xeroderma pigmentosum G N-region | 4e-26 | |
| cd09897 | 68 | cd09897, H3TH_FEN1-XPG-like, H3TH domains of Flap | 2e-25 | |
| cd09897 | 68 | cd09897, H3TH_FEN1-XPG-like, H3TH domains of Flap | 1e-24 | |
| PRK03980 | 292 | PRK03980, PRK03980, flap endonuclease-1; Provision | 3e-23 | |
| cd00128 | 209 | cd00128, PIN_FEN1_EXO1-like, PIN domains of Flap E | 2e-22 | |
| smart00484 | 73 | smart00484, XPGI, Xeroderma pigmentosum G I-region | 2e-22 | |
| cd09867 | 261 | cd09867, PIN_FEN1, PIN domain of Flap Endonuclease | 2e-19 | |
| cd09867 | 261 | cd09867, PIN_FEN1, PIN domain of Flap Endonuclease | 3e-19 | |
| cd00128 | 209 | cd00128, PIN_FEN1_EXO1-like, PIN domains of Flap E | 4e-19 | |
| PTZ00217 | 393 | PTZ00217, PTZ00217, flap endonuclease-1; Provision | 1e-18 | |
| PTZ00217 | 393 | PTZ00217, PTZ00217, flap endonuclease-1; Provision | 9e-18 | |
| cd09853 | 163 | cd09853, PIN_StructSpec-5'-nucleases, PIN domains | 1e-16 | |
| cd09868 | 249 | cd09868, PIN_XPG, PIN domain of Xeroderma pigmento | 4e-16 | |
| cd09903 | 65 | cd09903, H3TH_FEN1-Arc, H3TH domain of Flap Endonu | 1e-15 | |
| cd00080 | 71 | cd00080, H3TH_StructSpec-5'-nucleases, H3TH domain | 2e-15 | |
| cd00080 | 71 | cd00080, H3TH_StructSpec-5'-nucleases, H3TH domain | 6e-15 | |
| PRK03980 | 292 | PRK03980, PRK03980, flap endonuclease-1; Provision | 1e-14 | |
| COG0258 | 310 | COG0258, Exo, 5'-3' exonuclease (including N-termi | 2e-14 | |
| cd09903 | 65 | cd09903, H3TH_FEN1-Arc, H3TH domain of Flap Endonu | 3e-14 | |
| COG0258 | 310 | COG0258, Exo, 5'-3' exonuclease (including N-termi | 8e-14 | |
| cd09908 | 73 | cd09908, H3TH_EXO1, H3TH domain of Exonuclease-1, | 1e-13 | |
| TIGR00600 | 1034 | TIGR00600, rad2, DNA excision repair protein (rad2 | 3e-13 | |
| pfam00867 | 46 | pfam00867, XPG_I, XPG I-region | 6e-13 | |
| TIGR03674 | 338 | TIGR03674, fen_arch, flap structure-specific endon | 7e-13 | |
| cd09908 | 73 | cd09908, H3TH_EXO1, H3TH domain of Exonuclease-1, | 8e-13 | |
| PRK03980 | 292 | PRK03980, PRK03980, flap endonuclease-1; Provision | 1e-11 | |
| PRK03980 | 292 | PRK03980, PRK03980, flap endonuclease-1; Provision | 1e-11 | |
| cd09900 | 52 | cd09900, H3TH_XPG-like, H3TH domains of Flap endon | 1e-11 | |
| cd09856 | 207 | cd09856, PIN_FEN1-like, PIN domain of Flap Endonuc | 2e-11 | |
| cd09900 | 52 | cd09900, H3TH_XPG-like, H3TH domains of Flap endon | 7e-11 | |
| TIGR03674 | 338 | TIGR03674, fen_arch, flap structure-specific endon | 1e-10 | |
| TIGR03674 | 338 | TIGR03674, fen_arch, flap structure-specific endon | 3e-10 | |
| TIGR00600 | 1034 | TIGR00600, rad2, DNA excision repair protein (rad2 | 5e-09 | |
| smart00475 | 259 | smart00475, 53EXOc, 5'-3' exonuclease | 8e-09 | |
| cd09900 | 52 | cd09900, H3TH_XPG-like, H3TH domains of Flap endon | 2e-08 | |
| smart00279 | 36 | smart00279, HhH2, Helix-hairpin-helix class 2 (Pol | 2e-08 | |
| cd09898 | 73 | cd09898, H3TH_53EXO, H3TH domain of the 5'-3' exon | 2e-08 | |
| pfam01367 | 100 | pfam01367, 5_3_exonuc, 5'-3' exonuclease, C-termin | 2e-08 | |
| cd09898 | 73 | cd09898, H3TH_53EXO, H3TH domain of the 5'-3' exon | 4e-08 | |
| pfam01367 | 100 | pfam01367, 5_3_exonuc, 5'-3' exonuclease, C-termin | 4e-08 | |
| smart00279 | 36 | smart00279, HhH2, Helix-hairpin-helix class 2 (Pol | 8e-08 | |
| cd09904 | 97 | cd09904, H3TH_XPG, H3TH domain of Xeroderma pigmen | 8e-08 | |
| cd09904 | 97 | cd09904, H3TH_XPG, H3TH domain of Xeroderma pigmen | 1e-07 | |
| cd09868 | 249 | cd09868, PIN_XPG, PIN domain of Xeroderma pigmento | 3e-07 | |
| TIGR00593 | 887 | TIGR00593, pola, DNA polymerase I | 3e-07 | |
| smart00475 | 259 | smart00475, 53EXOc, 5'-3' exonuclease | 4e-07 | |
| cd09870 | 239 | cd09870, PIN_YEN1, PIN domain of Yeast Endonucleas | 1e-06 | |
| smart00279 | 36 | smart00279, HhH2, Helix-hairpin-helix class 2 (Pol | 3e-06 | |
| PRK05755 | 880 | PRK05755, PRK05755, DNA polymerase I; Provisional | 3e-06 | |
| TIGR00593 | 887 | TIGR00593, pola, DNA polymerase I | 1e-05 | |
| cd09853 | 163 | cd09853, PIN_StructSpec-5'-nucleases, PIN domains | 2e-05 | |
| PRK05755 | 880 | PRK05755, PRK05755, DNA polymerase I; Provisional | 3e-05 | |
| PRK14976 | 281 | PRK14976, PRK14976, 5'-3' exonuclease; Provisional | 3e-05 | |
| cd09856 | 207 | cd09856, PIN_FEN1-like, PIN domain of Flap Endonuc | 4e-05 | |
| cd09869 | 233 | cd09869, PIN_GEN1, PIN domain of Gap Endonuclease | 5e-05 | |
| cd09857 | 210 | cd09857, PIN_EXO1, PIN domain of Exonuclease-1, a | 7e-05 | |
| PRK14976 | 281 | PRK14976, PRK14976, 5'-3' exonuclease; Provisional | 1e-04 | |
| cd09869 | 233 | cd09869, PIN_GEN1, PIN domain of Gap Endonuclease | 1e-04 | |
| cd09852 | 120 | cd09852, PIN_SF, PIN (PilT N terminus) domain: Sup | 6e-04 | |
| PRK09482 | 256 | PRK09482, PRK09482, flap endonuclease-like protein | 0.002 | |
| PRK09482 | 256 | PRK09482, PRK09482, flap endonuclease-like protein | 0.004 |
| >gnl|CDD|240317 PTZ00217, PTZ00217, flap endonuclease-1; Provisional | Back alignment and domain information |
|---|
Score = 262 bits (672), Expect = 8e-83
Identities = 93/143 (65%), Positives = 117/143 (81%)
Query: 60 KAPCEAEAQCAAMVKAGKVYATATEDMDALTFGSNILLRHMTFSEARKLPVQEFHLEKVL 119
+APCEAEAQCA +VK GKVYA ATEDMDALTFG+ +LLR++ FSEA+K P+QE +L VL
Sbjct: 156 EAPCEAEAQCAELVKKGKVYAVATEDMDALTFGTPVLLRNLNFSEAKKRPIQEINLSTVL 215
Query: 120 EGMELSHEEFIDLCILLGCDYCDSIRGIGPKRAIELIKEHRSIEKILENIDTKKYTVPEG 179
E + LS ++FIDLCIL GCDYCD+I+GIGPK A +LIK+++SIE+ILE++D KY VPE
Sbjct: 216 EELGLSMDQFIDLCILCGCDYCDTIKGIGPKTAYKLIKKYKSIEEILEHLDKTKYPVPEN 275
Query: 180 WLYKEARELFRHPEVADPETIEF 202
+ YKEARELF +PEV E I+
Sbjct: 276 FDYKEARELFLNPEVTPAEEIDL 298
|
Length = 393 |
| >gnl|CDD|189037 cd09867, PIN_FEN1, PIN domain of Flap Endonuclease-1, a structure-specific, divalent-metal-ion dependent, 5' nuclease and homologs | Back alignment and domain information |
|---|
| >gnl|CDD|240317 PTZ00217, PTZ00217, flap endonuclease-1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|188627 cd09907, H3TH_FEN1-Euk, H3TH domain of Flap Endonuclease-1, a structure-specific, divalent-metal-ion dependent, 5' nuclease: Eukaryotic homologs | Back alignment and domain information |
|---|
| >gnl|CDD|188627 cd09907, H3TH_FEN1-Euk, H3TH domain of Flap Endonuclease-1, a structure-specific, divalent-metal-ion dependent, 5' nuclease: Eukaryotic homologs | Back alignment and domain information |
|---|
| >gnl|CDD|235185 PRK03980, PRK03980, flap endonuclease-1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234306 TIGR03674, fen_arch, flap structure-specific endonuclease | Back alignment and domain information |
|---|
| >gnl|CDD|240317 PTZ00217, PTZ00217, flap endonuclease-1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|188621 cd09901, H3TH_FEN1-like, H3TH domains of Flap endonuclease-1 (FEN1)-like structure specific 5' nucleases: FEN1 (eukaryotic) and EXO1 | Back alignment and domain information |
|---|
| >gnl|CDD|189037 cd09867, PIN_FEN1, PIN domain of Flap Endonuclease-1, a structure-specific, divalent-metal-ion dependent, 5' nuclease and homologs | Back alignment and domain information |
|---|
| >gnl|CDD|188621 cd09901, H3TH_FEN1-like, H3TH domains of Flap endonuclease-1 (FEN1)-like structure specific 5' nucleases: FEN1 (eukaryotic) and EXO1 | Back alignment and domain information |
|---|
| >gnl|CDD|234306 TIGR03674, fen_arch, flap structure-specific endonuclease | Back alignment and domain information |
|---|
| >gnl|CDD|216098 pfam00752, XPG_N, XPG N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|223336 COG0258, Exo, 5'-3' exonuclease (including N-terminal domain of PolI) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|214690 smart00485, XPGN, Xeroderma pigmentosum G N-region | Back alignment and domain information |
|---|
| >gnl|CDD|188617 cd09897, H3TH_FEN1-XPG-like, H3TH domains of Flap endonuclease-1 (FEN1)-like structure specific 5' nucleases | Back alignment and domain information |
|---|
| >gnl|CDD|188617 cd09897, H3TH_FEN1-XPG-like, H3TH domains of Flap endonuclease-1 (FEN1)-like structure specific 5' nucleases | Back alignment and domain information |
|---|
| >gnl|CDD|235185 PRK03980, PRK03980, flap endonuclease-1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|189020 cd00128, PIN_FEN1_EXO1-like, PIN domains of Flap Endonuclease-1 (FEN1)-like and Exonuclease-1 (EXO1)-like nucleases, structure-specific, divalent-metal-ion dependent, 5' nucleases | Back alignment and domain information |
|---|
| >gnl|CDD|214689 smart00484, XPGI, Xeroderma pigmentosum G I-region | Back alignment and domain information |
|---|
| >gnl|CDD|189037 cd09867, PIN_FEN1, PIN domain of Flap Endonuclease-1, a structure-specific, divalent-metal-ion dependent, 5' nuclease and homologs | Back alignment and domain information |
|---|
| >gnl|CDD|189037 cd09867, PIN_FEN1, PIN domain of Flap Endonuclease-1, a structure-specific, divalent-metal-ion dependent, 5' nuclease and homologs | Back alignment and domain information |
|---|
| >gnl|CDD|189020 cd00128, PIN_FEN1_EXO1-like, PIN domains of Flap Endonuclease-1 (FEN1)-like and Exonuclease-1 (EXO1)-like nucleases, structure-specific, divalent-metal-ion dependent, 5' nucleases | Back alignment and domain information |
|---|
| >gnl|CDD|240317 PTZ00217, PTZ00217, flap endonuclease-1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240317 PTZ00217, PTZ00217, flap endonuclease-1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|189023 cd09853, PIN_StructSpec-5'-nucleases, PIN domains of structure-specific 5' nucleases (or flap endonuclease-1-like) involved in DNA replication, repair, and recombination | Back alignment and domain information |
|---|
| >gnl|CDD|189038 cd09868, PIN_XPG, PIN domain of Xeroderma pigmentosum complementation group G (XPG) nuclease, a structure-specific, divalent-metal-ion dependent, 5' nuclease and homologs | Back alignment and domain information |
|---|
| >gnl|CDD|188623 cd09903, H3TH_FEN1-Arc, H3TH domain of Flap Endonuclease-1, a structure-specific, divalent-metal-ion dependent, 5' nuclease: Archaeal homologs | Back alignment and domain information |
|---|
| >gnl|CDD|188616 cd00080, H3TH_StructSpec-5'-nucleases, H3TH domains of structure-specific 5' nucleases (or flap endonuclease-1-like) involved in DNA replication, repair, and recombination | Back alignment and domain information |
|---|
| >gnl|CDD|188616 cd00080, H3TH_StructSpec-5'-nucleases, H3TH domains of structure-specific 5' nucleases (or flap endonuclease-1-like) involved in DNA replication, repair, and recombination | Back alignment and domain information |
|---|
| >gnl|CDD|235185 PRK03980, PRK03980, flap endonuclease-1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223336 COG0258, Exo, 5'-3' exonuclease (including N-terminal domain of PolI) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|188623 cd09903, H3TH_FEN1-Arc, H3TH domain of Flap Endonuclease-1, a structure-specific, divalent-metal-ion dependent, 5' nuclease: Archaeal homologs | Back alignment and domain information |
|---|
| >gnl|CDD|223336 COG0258, Exo, 5'-3' exonuclease (including N-terminal domain of PolI) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|188628 cd09908, H3TH_EXO1, H3TH domain of Exonuclease-1, a structure-specific, divalent-metal-ion dependent, 5' nuclease | Back alignment and domain information |
|---|
| >gnl|CDD|233044 TIGR00600, rad2, DNA excision repair protein (rad2) | Back alignment and domain information |
|---|
| >gnl|CDD|216163 pfam00867, XPG_I, XPG I-region | Back alignment and domain information |
|---|
| >gnl|CDD|234306 TIGR03674, fen_arch, flap structure-specific endonuclease | Back alignment and domain information |
|---|
| >gnl|CDD|188628 cd09908, H3TH_EXO1, H3TH domain of Exonuclease-1, a structure-specific, divalent-metal-ion dependent, 5' nuclease | Back alignment and domain information |
|---|
| >gnl|CDD|235185 PRK03980, PRK03980, flap endonuclease-1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235185 PRK03980, PRK03980, flap endonuclease-1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|188620 cd09900, H3TH_XPG-like, H3TH domains of Flap endonuclease-1 (FEN1)-like structure specific 5' nucleases: FEN1 (archaeal), GEN1, YEN1, and XPG | Back alignment and domain information |
|---|
| >gnl|CDD|189026 cd09856, PIN_FEN1-like, PIN domain of Flap Endonuclease-1 (FEN1)-like, structure-specific, divalent-metal-ion dependent, 5' nucleases | Back alignment and domain information |
|---|
| >gnl|CDD|188620 cd09900, H3TH_XPG-like, H3TH domains of Flap endonuclease-1 (FEN1)-like structure specific 5' nucleases: FEN1 (archaeal), GEN1, YEN1, and XPG | Back alignment and domain information |
|---|
| >gnl|CDD|234306 TIGR03674, fen_arch, flap structure-specific endonuclease | Back alignment and domain information |
|---|
| >gnl|CDD|234306 TIGR03674, fen_arch, flap structure-specific endonuclease | Back alignment and domain information |
|---|
| >gnl|CDD|233044 TIGR00600, rad2, DNA excision repair protein (rad2) | Back alignment and domain information |
|---|
| >gnl|CDD|214682 smart00475, 53EXOc, 5'-3' exonuclease | Back alignment and domain information |
|---|
| >gnl|CDD|188620 cd09900, H3TH_XPG-like, H3TH domains of Flap endonuclease-1 (FEN1)-like structure specific 5' nucleases: FEN1 (archaeal), GEN1, YEN1, and XPG | Back alignment and domain information |
|---|
| >gnl|CDD|197623 smart00279, HhH2, Helix-hairpin-helix class 2 (Pol1 family) motifs | Back alignment and domain information |
|---|
| >gnl|CDD|188618 cd09898, H3TH_53EXO, H3TH domain of the 5'-3' exonuclease of Taq DNA polymerase I and homologs | Back alignment and domain information |
|---|
| >gnl|CDD|216458 pfam01367, 5_3_exonuc, 5'-3' exonuclease, C-terminal SAM fold | Back alignment and domain information |
|---|
| >gnl|CDD|188618 cd09898, H3TH_53EXO, H3TH domain of the 5'-3' exonuclease of Taq DNA polymerase I and homologs | Back alignment and domain information |
|---|
| >gnl|CDD|216458 pfam01367, 5_3_exonuc, 5'-3' exonuclease, C-terminal SAM fold | Back alignment and domain information |
|---|
| >gnl|CDD|197623 smart00279, HhH2, Helix-hairpin-helix class 2 (Pol1 family) motifs | Back alignment and domain information |
|---|
| >gnl|CDD|188624 cd09904, H3TH_XPG, H3TH domain of Xeroderma pigmentosum complementation group G (XPG) nuclease, a structure-specific, divalent-metal-ion dependent, 5' nuclease | Back alignment and domain information |
|---|
| >gnl|CDD|188624 cd09904, H3TH_XPG, H3TH domain of Xeroderma pigmentosum complementation group G (XPG) nuclease, a structure-specific, divalent-metal-ion dependent, 5' nuclease | Back alignment and domain information |
|---|
| >gnl|CDD|189038 cd09868, PIN_XPG, PIN domain of Xeroderma pigmentosum complementation group G (XPG) nuclease, a structure-specific, divalent-metal-ion dependent, 5' nuclease and homologs | Back alignment and domain information |
|---|
| >gnl|CDD|233038 TIGR00593, pola, DNA polymerase I | Back alignment and domain information |
|---|
| >gnl|CDD|214682 smart00475, 53EXOc, 5'-3' exonuclease | Back alignment and domain information |
|---|
| >gnl|CDD|189040 cd09870, PIN_YEN1, PIN domain of Yeast Endonuclease 1, a structure-specific, divalent-metal-ion dependent, 5' nuclease and fungal homologs | Back alignment and domain information |
|---|
| >gnl|CDD|197623 smart00279, HhH2, Helix-hairpin-helix class 2 (Pol1 family) motifs | Back alignment and domain information |
|---|
| >gnl|CDD|235591 PRK05755, PRK05755, DNA polymerase I; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233038 TIGR00593, pola, DNA polymerase I | Back alignment and domain information |
|---|
| >gnl|CDD|189023 cd09853, PIN_StructSpec-5'-nucleases, PIN domains of structure-specific 5' nucleases (or flap endonuclease-1-like) involved in DNA replication, repair, and recombination | Back alignment and domain information |
|---|
| >gnl|CDD|235591 PRK05755, PRK05755, DNA polymerase I; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237877 PRK14976, PRK14976, 5'-3' exonuclease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|189026 cd09856, PIN_FEN1-like, PIN domain of Flap Endonuclease-1 (FEN1)-like, structure-specific, divalent-metal-ion dependent, 5' nucleases | Back alignment and domain information |
|---|
| >gnl|CDD|189039 cd09869, PIN_GEN1, PIN domain of Gap Endonuclease 1, a structure-specific, divalent-metal-ion dependent, 5' nuclease and homologs | Back alignment and domain information |
|---|
| >gnl|CDD|189027 cd09857, PIN_EXO1, PIN domain of Exonuclease-1, a structure-specific, divalent-metal-ion dependent, 5' nuclease and homologs | Back alignment and domain information |
|---|
| >gnl|CDD|237877 PRK14976, PRK14976, 5'-3' exonuclease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|189039 cd09869, PIN_GEN1, PIN domain of Gap Endonuclease 1, a structure-specific, divalent-metal-ion dependent, 5' nuclease and homologs | Back alignment and domain information |
|---|
| >gnl|CDD|189022 cd09852, PIN_SF, PIN (PilT N terminus) domain: Superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|181896 PRK09482, PRK09482, flap endonuclease-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181896 PRK09482, PRK09482, flap endonuclease-like protein; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 531 | |||
| PTZ00217 | 393 | flap endonuclease-1; Provisional | 100.0 | |
| PRK03980 | 292 | flap endonuclease-1; Provisional | 100.0 | |
| TIGR03674 | 338 | fen_arch flap structure-specific endonuclease. End | 100.0 | |
| cd00128 | 316 | XPG Xeroderma pigmentosum G N- and I-regions (XPGN | 100.0 | |
| TIGR00600 | 1034 | rad2 DNA excision repair protein (rad2). All prote | 100.0 | |
| KOG2519|consensus | 449 | 100.0 | ||
| KOG2518|consensus | 556 | 100.0 | ||
| smart00475 | 259 | 53EXOc 5'-3' exonuclease. | 99.96 | |
| PTZ00217 | 393 | flap endonuclease-1; Provisional | 99.95 | |
| PRK14976 | 281 | 5'-3' exonuclease; Provisional | 99.95 | |
| KOG2519|consensus | 449 | 99.95 | ||
| cd00008 | 240 | 53EXOc 5'-3' exonuclease; T5 type 5'-3' exonucleas | 99.95 | |
| PRK09482 | 256 | flap endonuclease-like protein; Provisional | 99.94 | |
| TIGR03674 | 338 | fen_arch flap structure-specific endonuclease. End | 99.94 | |
| KOG2520|consensus | 815 | 99.93 | ||
| TIGR00593 | 887 | pola DNA polymerase I. This family is based on the | 99.93 | |
| PRK05755 | 880 | DNA polymerase I; Provisional | 99.91 | |
| COG0258 | 310 | Exo 5'-3' exonuclease (including N-terminal domain | 99.91 | |
| PF00867 | 94 | XPG_I: XPG I-region; InterPro: IPR006086 This entr | 99.89 | |
| PRK03980 | 292 | flap endonuclease-1; Provisional | 99.85 | |
| cd00128 | 316 | XPG Xeroderma pigmentosum G N- and I-regions (XPGN | 99.85 | |
| TIGR00600 | 1034 | rad2 DNA excision repair protein (rad2). All prote | 99.82 | |
| PF00752 | 101 | XPG_N: XPG N-terminal domain; InterPro: IPR006085 | 99.81 | |
| smart00485 | 99 | XPGN Xeroderma pigmentosum G N-region. domain in n | 99.8 | |
| PHA00439 | 286 | exonuclease | 99.8 | |
| smart00484 | 73 | XPGI Xeroderma pigmentosum G I-region. domain in n | 99.76 | |
| KOG2518|consensus | 556 | 99.7 | ||
| PHA02567 | 304 | rnh RnaseH; Provisional | 99.53 | |
| cd00080 | 75 | HhH2_motif Helix-hairpin-helix class 2 (Pol1 famil | 99.46 | |
| COG0258 | 310 | Exo 5'-3' exonuclease (including N-terminal domain | 99.24 | |
| PF02739 | 169 | 5_3_exonuc_N: 5'-3' exonuclease, N-terminal resolv | 99.17 | |
| PF01367 | 101 | 5_3_exonuc: 5'-3' exonuclease, C-terminal SAM fold | 99.13 | |
| cd00080 | 75 | HhH2_motif Helix-hairpin-helix class 2 (Pol1 famil | 99.1 | |
| smart00279 | 36 | HhH2 Helix-hairpin-helix class 2 (Pol1 family) mot | 98.96 | |
| smart00279 | 36 | HhH2 Helix-hairpin-helix class 2 (Pol1 family) mot | 98.6 | |
| cd00008 | 240 | 53EXOc 5'-3' exonuclease; T5 type 5'-3' exonucleas | 98.31 | |
| PF12813 | 246 | XPG_I_2: XPG domain containing | 98.22 | |
| PRK14976 | 281 | 5'-3' exonuclease; Provisional | 98.16 | |
| smart00475 | 259 | 53EXOc 5'-3' exonuclease. | 98.15 | |
| KOG2520|consensus | 815 | 97.87 | ||
| PRK09482 | 256 | flap endonuclease-like protein; Provisional | 97.76 | |
| PRK05755 | 880 | DNA polymerase I; Provisional | 97.64 | |
| TIGR00593 | 887 | pola DNA polymerase I. This family is based on the | 97.61 | |
| PF01367 | 101 | 5_3_exonuc: 5'-3' exonuclease, C-terminal SAM fold | 96.97 | |
| PF12826 | 64 | HHH_2: Helix-hairpin-helix motif; PDB: 1X2I_B 1DGS | 96.61 | |
| PRK14602 | 203 | ruvA Holliday junction DNA helicase RuvA; Provisio | 96.16 | |
| PRK13901 | 196 | ruvA Holliday junction DNA helicase RuvA; Provisio | 95.86 | |
| PRK14601 | 183 | ruvA Holliday junction DNA helicase RuvA; Provisio | 95.79 | |
| PRK14600 | 186 | ruvA Holliday junction DNA helicase RuvA; Provisio | 95.78 | |
| PRK14603 | 197 | ruvA Holliday junction DNA helicase RuvA; Provisio | 95.73 | |
| PRK14606 | 188 | ruvA Holliday junction DNA helicase RuvA; Provisio | 95.69 | |
| PRK14604 | 195 | ruvA Holliday junction DNA helicase RuvA; Provisio | 95.69 | |
| COG0632 | 201 | RuvA Holliday junction resolvasome, DNA-binding su | 95.59 | |
| COG5366 | 531 | Protein involved in propagation of M2 dsRNA satell | 95.33 | |
| PRK14605 | 194 | ruvA Holliday junction DNA helicase RuvA; Provisio | 95.09 | |
| TIGR00084 | 191 | ruvA Holliday junction DNA helicase, RuvA subunit. | 95.0 | |
| PRK00116 | 192 | ruvA Holliday junction DNA helicase RuvA; Reviewed | 94.09 | |
| PF02739 | 169 | 5_3_exonuc_N: 5'-3' exonuclease, N-terminal resolv | 93.94 | |
| PRK07956 | 665 | ligA NAD-dependent DNA ligase LigA; Validated | 91.05 | |
| TIGR00575 | 652 | dnlj DNA ligase, NAD-dependent. The member of this | 89.74 | |
| PF10391 | 52 | DNA_pol_lambd_f: Fingers domain of DNA polymerase | 88.96 | |
| TIGR01448 | 720 | recD_rel helicase, putative, RecD/TraA family. Thi | 87.74 | |
| PF12826 | 64 | HHH_2: Helix-hairpin-helix motif; PDB: 1X2I_B 1DGS | 87.11 | |
| PF14520 | 60 | HHH_5: Helix-hairpin-helix domain; PDB: 3AUO_B 3AU | 85.63 | |
| PF00633 | 30 | HHH: Helix-hairpin-helix motif; InterPro: IPR00044 | 84.38 | |
| PF04599 | 425 | Pox_G5: Poxvirus G5 protein; InterPro: IPR007678 P | 84.06 | |
| PRK14667 | 567 | uvrC excinuclease ABC subunit C; Provisional | 83.82 | |
| PHA00439 | 286 | exonuclease | 83.55 | |
| PRK14669 | 624 | uvrC excinuclease ABC subunit C; Provisional | 83.2 | |
| PHA03065 | 438 | Hypothetical protein; Provisional | 82.38 | |
| TIGR00194 | 574 | uvrC excinuclease ABC, C subunit. This family cons | 81.57 | |
| PRK14670 | 574 | uvrC excinuclease ABC subunit C; Provisional | 81.48 | |
| PF00633 | 30 | HHH: Helix-hairpin-helix motif; InterPro: IPR00044 | 81.02 | |
| PF14520 | 60 | HHH_5: Helix-hairpin-helix domain; PDB: 3AUO_B 3AU | 80.3 | |
| COG0272 | 667 | Lig NAD-dependent DNA ligase (contains BRCT domain | 80.26 |
| >PTZ00217 flap endonuclease-1; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.1e-44 Score=383.25 Aligned_cols=245 Identities=51% Similarity=0.831 Sum_probs=212.7
Q ss_pred ceeecccCCCCCcchhH------HhHH----------------HHHHhhccCCCH---HHHHHHHhhcCCccccCCCchh
Q psy1206 12 GLVKYLCGDKNFAEDRI------RNGA----------------KKLLKARSSTTQ---GRLDSFFTIRREEKRKAPCEAE 66 (531)
Q Consensus 12 ~~~a~~~~~~~f~~~~~------R~~~----------------~~~~k~~~~~t~---~~i~~lL~~~gIp~vvAPyEAD 66 (531)
-++.||.+.++++..++ |..+ ..++++...+|+ +.++++|+++||||++||||||
T Consensus 83 Pv~VFDG~~p~~K~~~~~~Rk~~R~~a~~~l~~a~~~g~~~~a~k~~~r~~~vt~~~~~~~~~lL~~~Gip~i~AP~EAd 162 (393)
T PTZ00217 83 PVYVFDGKPPELKSGELEKRRERREEAEEELEKAIEEGDDEEIKKQSKRTVRVTKEQNEDAKKLLRLMGIPVIEAPCEAE 162 (393)
T ss_pred EEEEEcCCCchhhHHHHHHHHHHHHHhHHHHHHHHhcCCHHHHHHHHhhcccCCHHHHHHHHHHHHHcCCceEECCcCHH
Confidence 46899998888876542 2222 123444455666 4578899999999999999999
Q ss_pred HHHHHHHHcCCEEEEEcCCCccccccCCeEEEeccccCcccCCcEEecHHHHHHhCCCCHHHHHHHHhHcCCCCCCCCCC
Q psy1206 67 AQCAAMVKAGKVYATATEDMDALTFGSNILLRHMTFSEARKLPVQEFHLEKVLEGMELSHEEFIDLCILLGCDYCDSIRG 146 (531)
Q Consensus 67 Aq~A~L~r~G~vd~ViSeDsDlL~fg~~~Vi~~l~~~~~~~~~v~~~~~~~i~~~lglt~eqfid~~iL~G~DY~pGIpG 146 (531)
||||+|++.|++|+|+|+|+|+|+||++.|+++++.++..+.+++.++++.+++.+|++++||+|+|+|+||||+|||||
T Consensus 163 aq~A~L~~~g~v~~ViS~D~D~l~fg~~~vi~~l~~~~~~~~~~~~~~~~~v~~~~gl~~~q~id~~iL~G~Dy~pgi~G 242 (393)
T PTZ00217 163 AQCAELVKKGKVYAVATEDMDALTFGTPVLLRNLNFSEAKKRPIQEINLSTVLEELGLSMDQFIDLCILCGCDYCDTIKG 242 (393)
T ss_pred HHHHHHHHCCCeEEEeCCCcCeeecCCcEEEEcccccccCCCCeEEEEHHHHHHHhCCCHHHHHHHHHHhCCCCCCCCCC
Confidence 99999999999999999999999999999999987654444467899999999999999999999999999999999999
Q ss_pred ccHHHHHHHHHHcCCHHHHHHHhhhcCCCCCCCCcHHHHHHHhcCCCcCCCCCcccccccccccccccccccCCChhhhH
Q psy1206 147 IGPKRAIELIKEHRSIEKILENIDTKKYTVPEGWLYKEARELFRHPEVADPETIEFIDLCILLGCDYCDSIRGIGPKRAI 226 (531)
Q Consensus 147 IG~ktA~kLI~~~~sle~il~~l~~~~~~ip~~f~~~~A~~~f~~p~V~d~~~~~~v~Ls~~~~~d~cesl~~~Gp~~~~ 226 (531)
||+|||++||++|+|+|+|+++++.
T Consensus 243 IG~ktA~~Li~~~gsle~il~~~~~------------------------------------------------------- 267 (393)
T PTZ00217 243 IGPKTAYKLIKKYKSIEEILEHLDK------------------------------------------------------- 267 (393)
T ss_pred ccHHHHHHHHHHcCCHHHHHHHHHh-------------------------------------------------------
Confidence 9999999999999999999987632
Q ss_pred hHHhhhhhhhhhccCccccCCCCCchHHHHHHHHhhccHHHHHHHHhhCCCCCCCcchHHHHHHHhcCCcccCccccccc
Q psy1206 227 ELLYSFIDLCILLGCDYCDSIRGIGPKRAIELIKEHRSIEKILENIDTKKYTVPEGWLYKEARELFRHPEIADPETIELV 306 (531)
Q Consensus 227 el~e~F~~~CiLsGCDY~~~i~giG~k~A~kli~k~~s~~~vi~~l~~~~~~vP~~y~~~~A~~~F~~~~V~dP~~~~Lv 306 (531)
.++.+|++|+|.+|+.+|+||.|+||.+
T Consensus 268 ------------------------------------------------~k~~~p~~~~~~~~~~~f~~p~V~~~~~---- 295 (393)
T PTZ00217 268 ------------------------------------------------TKYPVPENFDYKEARELFLNPEVTPAEE---- 295 (393)
T ss_pred ------------------------------------------------cCCCCCCCCChHHHHHHhcCCCcCCCCC----
Confidence 1245799999999999999999999831
Q ss_pred cccCCCcccccceeeecccchHHHHHHHHhhcCccccCCCCCCcchhhhHHHHHHHHHHcCCeeEEeecCCCCCcchHHH
Q psy1206 307 ADVAPSSIRESRKICIDASMSLYQFLIAVRSEGNQLMSVDGEPTSHLMGTFYRTIRLVEHGLKPIYVFDGKPPTLKSGEL 386 (531)
Q Consensus 307 ~~~aP~~i~~gk~iAIDa~~~lyqfl~~ir~~g~~l~~~~g~~tshl~g~~~R~~~ll~~gIkPVfVFDG~pp~lK~~~~ 386 (531)
T Consensus 296 -------------------------------------------------------------------------------- 295 (393)
T PTZ00217 296 -------------------------------------------------------------------------------- 295 (393)
T ss_pred --------------------------------------------------------------------------------
Confidence
Q ss_pred HHHHHHHHHHHHHHHHHHHcccccCCCCChhHHHHHHhhccccchHHHHHHHHHHHHHhccCCcCccccccccchhh
Q psy1206 387 NKRMEKREDAQKALAKAQEQGKLKWSDPDEDGLVKYLCGDKNFAEDRIRNGAKKLLKARSTTTQGRLDSFFTIRREE 463 (531)
Q Consensus 387 ~kR~~~r~~a~~~~~~a~~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ll~~~~~~~~~rld~ff~~~~~~ 463 (531)
-+++|+.||.+++++|++.+..|..++|.+.+.+|.+++++.+|+|||+||++.++.
T Consensus 296 --------------------~~l~w~~pD~~~l~~fl~~e~~f~~~rv~~~i~rl~~~~~~~~Q~~l~~ff~~~~~~ 352 (393)
T PTZ00217 296 --------------------IDLKWNEPDEEGLKKFLVKEKNFNEERVEKYIERLKKAKTKKTQTRLDSFFTATKKP 352 (393)
T ss_pred --------------------CCCCCCCCCHHHHHHHHHhccCCCHHHHHHHHHHHHHHhccCccCCHHHhcCCCCCc
Confidence 136799999999999999999999999999999999999999999999999998664
|
|
| >PRK03980 flap endonuclease-1; Provisional | Back alignment and domain information |
|---|
| >TIGR03674 fen_arch flap structure-specific endonuclease | Back alignment and domain information |
|---|
| >cd00128 XPG Xeroderma pigmentosum G N- and I-regions (XPGN, XPGI); contains the HhH2 motif; domain in nucleases | Back alignment and domain information |
|---|
| >TIGR00600 rad2 DNA excision repair protein (rad2) | Back alignment and domain information |
|---|
| >KOG2519|consensus | Back alignment and domain information |
|---|
| >KOG2518|consensus | Back alignment and domain information |
|---|
| >smart00475 53EXOc 5'-3' exonuclease | Back alignment and domain information |
|---|
| >PTZ00217 flap endonuclease-1; Provisional | Back alignment and domain information |
|---|
| >PRK14976 5'-3' exonuclease; Provisional | Back alignment and domain information |
|---|
| >KOG2519|consensus | Back alignment and domain information |
|---|
| >cd00008 53EXOc 5'-3' exonuclease; T5 type 5'-3' exonuclease domains may co-occur with DNA polymerase I (Pol I) domains, or be part of Pol I containing complexes | Back alignment and domain information |
|---|
| >PRK09482 flap endonuclease-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03674 fen_arch flap structure-specific endonuclease | Back alignment and domain information |
|---|
| >KOG2520|consensus | Back alignment and domain information |
|---|
| >TIGR00593 pola DNA polymerase I | Back alignment and domain information |
|---|
| >PRK05755 DNA polymerase I; Provisional | Back alignment and domain information |
|---|
| >COG0258 Exo 5'-3' exonuclease (including N-terminal domain of PolI) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF00867 XPG_I: XPG I-region; InterPro: IPR006086 This entry represents endonucleases that cleave the 5'-overhanging flap structure that is generated by displacement synthesis when DNA polymerase encounters the 5'-end of a downstream Okazaki fragment | Back alignment and domain information |
|---|
| >PRK03980 flap endonuclease-1; Provisional | Back alignment and domain information |
|---|
| >cd00128 XPG Xeroderma pigmentosum G N- and I-regions (XPGN, XPGI); contains the HhH2 motif; domain in nucleases | Back alignment and domain information |
|---|
| >TIGR00600 rad2 DNA excision repair protein (rad2) | Back alignment and domain information |
|---|
| >PF00752 XPG_N: XPG N-terminal domain; InterPro: IPR006085 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer | Back alignment and domain information |
|---|
| >smart00485 XPGN Xeroderma pigmentosum G N-region | Back alignment and domain information |
|---|
| >PHA00439 exonuclease | Back alignment and domain information |
|---|
| >smart00484 XPGI Xeroderma pigmentosum G I-region | Back alignment and domain information |
|---|
| >KOG2518|consensus | Back alignment and domain information |
|---|
| >PHA02567 rnh RnaseH; Provisional | Back alignment and domain information |
|---|
| >cd00080 HhH2_motif Helix-hairpin-helix class 2 (Pol1 family) motif | Back alignment and domain information |
|---|
| >COG0258 Exo 5'-3' exonuclease (including N-terminal domain of PolI) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF02739 5_3_exonuc_N: 5'-3' exonuclease, N-terminal resolvase-like domain; InterPro: IPR020046 The N-terminal and internal 5'3'-exonuclease domains are commonly found together, and are most often associated with 5' to 3' nuclease activities | Back alignment and domain information |
|---|
| >PF01367 5_3_exonuc: 5'-3' exonuclease, C-terminal SAM fold; InterPro: IPR020045 This entry represents the C-terminal domain of 5' to 3' exonucleases | Back alignment and domain information |
|---|
| >cd00080 HhH2_motif Helix-hairpin-helix class 2 (Pol1 family) motif | Back alignment and domain information |
|---|
| >smart00279 HhH2 Helix-hairpin-helix class 2 (Pol1 family) motifs | Back alignment and domain information |
|---|
| >smart00279 HhH2 Helix-hairpin-helix class 2 (Pol1 family) motifs | Back alignment and domain information |
|---|
| >cd00008 53EXOc 5'-3' exonuclease; T5 type 5'-3' exonuclease domains may co-occur with DNA polymerase I (Pol I) domains, or be part of Pol I containing complexes | Back alignment and domain information |
|---|
| >PF12813 XPG_I_2: XPG domain containing | Back alignment and domain information |
|---|
| >PRK14976 5'-3' exonuclease; Provisional | Back alignment and domain information |
|---|
| >smart00475 53EXOc 5'-3' exonuclease | Back alignment and domain information |
|---|
| >KOG2520|consensus | Back alignment and domain information |
|---|
| >PRK09482 flap endonuclease-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK05755 DNA polymerase I; Provisional | Back alignment and domain information |
|---|
| >TIGR00593 pola DNA polymerase I | Back alignment and domain information |
|---|
| >PF01367 5_3_exonuc: 5'-3' exonuclease, C-terminal SAM fold; InterPro: IPR020045 This entry represents the C-terminal domain of 5' to 3' exonucleases | Back alignment and domain information |
|---|
| >PF12826 HHH_2: Helix-hairpin-helix motif; PDB: 1X2I_B 1DGS_A 1V9P_B | Back alignment and domain information |
|---|
| >PRK14602 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >PRK13901 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >PRK14601 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >PRK14600 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >PRK14603 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >PRK14606 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >PRK14604 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >COG0632 RuvA Holliday junction resolvasome, DNA-binding subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG5366 Protein involved in propagation of M2 dsRNA satellite of L-A virus [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14605 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >TIGR00084 ruvA Holliday junction DNA helicase, RuvA subunit | Back alignment and domain information |
|---|
| >PRK00116 ruvA Holliday junction DNA helicase RuvA; Reviewed | Back alignment and domain information |
|---|
| >PF02739 5_3_exonuc_N: 5'-3' exonuclease, N-terminal resolvase-like domain; InterPro: IPR020046 The N-terminal and internal 5'3'-exonuclease domains are commonly found together, and are most often associated with 5' to 3' nuclease activities | Back alignment and domain information |
|---|
| >PRK07956 ligA NAD-dependent DNA ligase LigA; Validated | Back alignment and domain information |
|---|
| >TIGR00575 dnlj DNA ligase, NAD-dependent | Back alignment and domain information |
|---|
| >PF10391 DNA_pol_lambd_f: Fingers domain of DNA polymerase lambda; InterPro: IPR018944 DNA polymerases catalyse the addition of dNMPs onto the 3-prime ends of DNA chains | Back alignment and domain information |
|---|
| >TIGR01448 recD_rel helicase, putative, RecD/TraA family | Back alignment and domain information |
|---|
| >PF12826 HHH_2: Helix-hairpin-helix motif; PDB: 1X2I_B 1DGS_A 1V9P_B | Back alignment and domain information |
|---|
| >PF14520 HHH_5: Helix-hairpin-helix domain; PDB: 3AUO_B 3AU6_A 3AU2_A 3B0X_A 3B0Y_A 1SZP_C 3LDA_A 1WCN_A 2JZB_B 2ZTC_A | Back alignment and domain information |
|---|
| >PF00633 HHH: Helix-hairpin-helix motif; InterPro: IPR000445 The HhH motif is an around 20 amino acids domain present in prokaryotic and eukaryotic non-sequence-specific DNA binding proteins [, , ] | Back alignment and domain information |
|---|
| >PF04599 Pox_G5: Poxvirus G5 protein; InterPro: IPR007678 Protein G5 is found in a number of Poxviruses | Back alignment and domain information |
|---|
| >PRK14667 uvrC excinuclease ABC subunit C; Provisional | Back alignment and domain information |
|---|
| >PHA00439 exonuclease | Back alignment and domain information |
|---|
| >PRK14669 uvrC excinuclease ABC subunit C; Provisional | Back alignment and domain information |
|---|
| >PHA03065 Hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00194 uvrC excinuclease ABC, C subunit | Back alignment and domain information |
|---|
| >PRK14670 uvrC excinuclease ABC subunit C; Provisional | Back alignment and domain information |
|---|
| >PF00633 HHH: Helix-hairpin-helix motif; InterPro: IPR000445 The HhH motif is an around 20 amino acids domain present in prokaryotic and eukaryotic non-sequence-specific DNA binding proteins [, , ] | Back alignment and domain information |
|---|
| >PF14520 HHH_5: Helix-hairpin-helix domain; PDB: 3AUO_B 3AU6_A 3AU2_A 3B0X_A 3B0Y_A 1SZP_C 3LDA_A 1WCN_A 2JZB_B 2ZTC_A | Back alignment and domain information |
|---|
| >COG0272 Lig NAD-dependent DNA ligase (contains BRCT domain type II) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 531 | ||||
| 1ul1_X | 379 | Crystal Structure Of The Human Fen1-Pcna Complex Le | 2e-55 | ||
| 1ul1_X | 379 | Crystal Structure Of The Human Fen1-Pcna Complex Le | 2e-31 | ||
| 1ul1_X | 379 | Crystal Structure Of The Human Fen1-Pcna Complex Le | 1e-13 | ||
| 3q8k_A | 341 | Crystal Structure Of Human Flap Endonuclease Fen1 ( | 4e-55 | ||
| 3q8k_A | 341 | Crystal Structure Of Human Flap Endonuclease Fen1 ( | 3e-31 | ||
| 3q8k_A | 341 | Crystal Structure Of Human Flap Endonuclease Fen1 ( | 9e-09 | ||
| 3q8m_A | 341 | Crystal Structure Of Human Flap Endonuclease Fen1 ( | 2e-54 | ||
| 3q8m_A | 341 | Crystal Structure Of Human Flap Endonuclease Fen1 ( | 3e-31 | ||
| 3q8m_A | 341 | Crystal Structure Of Human Flap Endonuclease Fen1 ( | 8e-09 | ||
| 2izo_A | 346 | Structure Of An Archaeal Pcna1-Pcna2-Fen1 Complex L | 9e-22 | ||
| 2izo_A | 346 | Structure Of An Archaeal Pcna1-Pcna2-Fen1 Complex L | 2e-20 | ||
| 3ory_A | 363 | Crystal Structure Of Flap Endonuclease 1 From Hyper | 1e-20 | ||
| 3ory_A | 363 | Crystal Structure Of Flap Endonuclease 1 From Hyper | 2e-20 | ||
| 1mc8_A | 343 | Crystal Structure Of Flap Endonuclease-1 R42e Mutan | 6e-20 | ||
| 1mc8_A | 343 | Crystal Structure Of Flap Endonuclease-1 R42e Mutan | 3e-08 | ||
| 1b43_A | 340 | Fen-1 From P. Furiosus Length = 340 | 1e-18 | ||
| 1b43_A | 340 | Fen-1 From P. Furiosus Length = 340 | 6e-16 | ||
| 1b43_A | 340 | Fen-1 From P. Furiosus Length = 340 | 3e-08 | ||
| 1rxv_A | 336 | Crystal Structure Of A. Fulgidus Fen-1 Bound To Dna | 1e-17 | ||
| 1rxv_A | 336 | Crystal Structure Of A. Fulgidus Fen-1 Bound To Dna | 2e-14 | ||
| 1a76_A | 326 | Flap Endonuclease-1 From Methanococcus Jannaschii L | 3e-15 | ||
| 1a76_A | 326 | Flap Endonuclease-1 From Methanococcus Jannaschii L | 5e-13 | ||
| 3qea_Z | 352 | Crystal Structure Of Human Exonuclease 1 Exo1 (Wt) | 4e-12 | ||
| 3qe9_Y | 352 | Crystal Structure Of Human Exonuclease 1 Exo1 (D173 | 3e-11 |
| >pdb|1UL1|X Chain X, Crystal Structure Of The Human Fen1-Pcna Complex Length = 379 | Back alignment and structure |
|
| >pdb|1UL1|X Chain X, Crystal Structure Of The Human Fen1-Pcna Complex Length = 379 | Back alignment and structure |
| >pdb|1UL1|X Chain X, Crystal Structure Of The Human Fen1-Pcna Complex Length = 379 | Back alignment and structure |
| >pdb|3Q8K|A Chain A, Crystal Structure Of Human Flap Endonuclease Fen1 (Wt) In Complex With Product 5'-Flap Dna, Sm3+, And K+ Length = 341 | Back alignment and structure |
| >pdb|3Q8K|A Chain A, Crystal Structure Of Human Flap Endonuclease Fen1 (Wt) In Complex With Product 5'-Flap Dna, Sm3+, And K+ Length = 341 | Back alignment and structure |
| >pdb|3Q8K|A Chain A, Crystal Structure Of Human Flap Endonuclease Fen1 (Wt) In Complex With Product 5'-Flap Dna, Sm3+, And K+ Length = 341 | Back alignment and structure |
| >pdb|3Q8M|A Chain A, Crystal Structure Of Human Flap Endonuclease Fen1 (D181a) In Complex With Substrate 5'-Flap Dna And K+ Length = 341 | Back alignment and structure |
| >pdb|3Q8M|A Chain A, Crystal Structure Of Human Flap Endonuclease Fen1 (D181a) In Complex With Substrate 5'-Flap Dna And K+ Length = 341 | Back alignment and structure |
| >pdb|3Q8M|A Chain A, Crystal Structure Of Human Flap Endonuclease Fen1 (D181a) In Complex With Substrate 5'-Flap Dna And K+ Length = 341 | Back alignment and structure |
| >pdb|2IZO|A Chain A, Structure Of An Archaeal Pcna1-Pcna2-Fen1 Complex Length = 346 | Back alignment and structure |
| >pdb|2IZO|A Chain A, Structure Of An Archaeal Pcna1-Pcna2-Fen1 Complex Length = 346 | Back alignment and structure |
| >pdb|3ORY|A Chain A, Crystal Structure Of Flap Endonuclease 1 From Hyperthermophilic Archaeon Desulfurococcus Amylolyticus Length = 363 | Back alignment and structure |
| >pdb|3ORY|A Chain A, Crystal Structure Of Flap Endonuclease 1 From Hyperthermophilic Archaeon Desulfurococcus Amylolyticus Length = 363 | Back alignment and structure |
| >pdb|1MC8|A Chain A, Crystal Structure Of Flap Endonuclease-1 R42e Mutant From Pyrococcus Horikoshii Length = 343 | Back alignment and structure |
| >pdb|1MC8|A Chain A, Crystal Structure Of Flap Endonuclease-1 R42e Mutant From Pyrococcus Horikoshii Length = 343 | Back alignment and structure |
| >pdb|1B43|A Chain A, Fen-1 From P. Furiosus Length = 340 | Back alignment and structure |
| >pdb|1B43|A Chain A, Fen-1 From P. Furiosus Length = 340 | Back alignment and structure |
| >pdb|1B43|A Chain A, Fen-1 From P. Furiosus Length = 340 | Back alignment and structure |
| >pdb|1RXV|A Chain A, Crystal Structure Of A. Fulgidus Fen-1 Bound To Dna Length = 336 | Back alignment and structure |
| >pdb|1RXV|A Chain A, Crystal Structure Of A. Fulgidus Fen-1 Bound To Dna Length = 336 | Back alignment and structure |
| >pdb|1A76|A Chain A, Flap Endonuclease-1 From Methanococcus Jannaschii Length = 326 | Back alignment and structure |
| >pdb|1A76|A Chain A, Flap Endonuclease-1 From Methanococcus Jannaschii Length = 326 | Back alignment and structure |
| >pdb|3QEA|Z Chain Z, Crystal Structure Of Human Exonuclease 1 Exo1 (Wt) In Complex With Dna (Complex Ii) Length = 352 | Back alignment and structure |
| >pdb|3QE9|Y Chain Y, Crystal Structure Of Human Exonuclease 1 Exo1 (D173a) In Complex With Dna (Complex I) Length = 352 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 531 | |||
| 3q8k_A | 341 | Flap endonuclease 1; helix-3 turn-helix, hydrophob | 8e-63 | |
| 3q8k_A | 341 | Flap endonuclease 1; helix-3 turn-helix, hydrophob | 3e-29 | |
| 3q8k_A | 341 | Flap endonuclease 1; helix-3 turn-helix, hydrophob | 6e-29 | |
| 3q8k_A | 341 | Flap endonuclease 1; helix-3 turn-helix, hydrophob | 2e-13 | |
| 3q8k_A | 341 | Flap endonuclease 1; helix-3 turn-helix, hydrophob | 5e-13 | |
| 1ul1_X | 379 | Flap endonuclease-1; protein complex, DNA-binding | 2e-62 | |
| 1ul1_X | 379 | Flap endonuclease-1; protein complex, DNA-binding | 5e-29 | |
| 1ul1_X | 379 | Flap endonuclease-1; protein complex, DNA-binding | 2e-28 | |
| 1ul1_X | 379 | Flap endonuclease-1; protein complex, DNA-binding | 4e-16 | |
| 1ul1_X | 379 | Flap endonuclease-1; protein complex, DNA-binding | 9e-16 | |
| 1rxw_A | 336 | Flap structure-specific endonuclease; helical clam | 7e-54 | |
| 1rxw_A | 336 | Flap structure-specific endonuclease; helical clam | 6e-26 | |
| 1rxw_A | 336 | Flap structure-specific endonuclease; helical clam | 9e-23 | |
| 1rxw_A | 336 | Flap structure-specific endonuclease; helical clam | 6e-13 | |
| 1rxw_A | 336 | Flap structure-specific endonuclease; helical clam | 1e-12 | |
| 3ory_A | 363 | Flap endonuclease 1; hydrolase; 2.00A {Desulfuroco | 6e-52 | |
| 3ory_A | 363 | Flap endonuclease 1; hydrolase; 2.00A {Desulfuroco | 2e-27 | |
| 3ory_A | 363 | Flap endonuclease 1; hydrolase; 2.00A {Desulfuroco | 5e-22 | |
| 3ory_A | 363 | Flap endonuclease 1; hydrolase; 2.00A {Desulfuroco | 2e-12 | |
| 3ory_A | 363 | Flap endonuclease 1; hydrolase; 2.00A {Desulfuroco | 5e-12 | |
| 1a76_A | 326 | Flap endonuclease-1 protein; 5'-3' EXO/endo nuclea | 9e-50 | |
| 1a76_A | 326 | Flap endonuclease-1 protein; 5'-3' EXO/endo nuclea | 2e-27 | |
| 1a76_A | 326 | Flap endonuclease-1 protein; 5'-3' EXO/endo nuclea | 6e-19 | |
| 1a76_A | 326 | Flap endonuclease-1 protein; 5'-3' EXO/endo nuclea | 1e-12 | |
| 1a76_A | 326 | Flap endonuclease-1 protein; 5'-3' EXO/endo nuclea | 3e-12 | |
| 2izo_A | 346 | FEN1, flap structure-specific endonuclease; hydrol | 7e-49 | |
| 2izo_A | 346 | FEN1, flap structure-specific endonuclease; hydrol | 3e-27 | |
| 2izo_A | 346 | FEN1, flap structure-specific endonuclease; hydrol | 3e-20 | |
| 2izo_A | 346 | FEN1, flap structure-specific endonuclease; hydrol | 3e-13 | |
| 2izo_A | 346 | FEN1, flap structure-specific endonuclease; hydrol | 6e-13 | |
| 1b43_A | 340 | Protein (FEN-1); nuclease, DNA repair, DNA replica | 2e-46 | |
| 1b43_A | 340 | Protein (FEN-1); nuclease, DNA repair, DNA replica | 5e-27 | |
| 1b43_A | 340 | Protein (FEN-1); nuclease, DNA repair, DNA replica | 4e-18 | |
| 1b43_A | 340 | Protein (FEN-1); nuclease, DNA repair, DNA replica | 2e-14 | |
| 1b43_A | 340 | Protein (FEN-1); nuclease, DNA repair, DNA replica | 4e-14 | |
| 3qe9_Y | 352 | Exonuclease 1; exonuclease, hydrolase-DNA complex; | 2e-41 | |
| 3qe9_Y | 352 | Exonuclease 1; exonuclease, hydrolase-DNA complex; | 1e-21 | |
| 3qe9_Y | 352 | Exonuclease 1; exonuclease, hydrolase-DNA complex; | 5e-19 | |
| 3qe9_Y | 352 | Exonuclease 1; exonuclease, hydrolase-DNA complex; | 3e-04 | |
| 3qe9_Y | 352 | Exonuclease 1; exonuclease, hydrolase-DNA complex; | 3e-04 | |
| 1exn_A | 290 | 5'-exonuclease, 5'-nuclease; hydrolase; 2.50A {Ent | 5e-07 | |
| 1exn_A | 290 | 5'-exonuclease, 5'-nuclease; hydrolase; 2.50A {Ent | 5e-06 | |
| 1bgx_T | 832 | TAQ DNA polymerase; DNA polymerase, FAB, PCR, inhi | 1e-06 | |
| 1bgx_T | 832 | TAQ DNA polymerase; DNA polymerase, FAB, PCR, inhi | 1e-05 | |
| 1igr_A | 478 | Insulin-like growth factor receptor 1; hormone rec | 1e-04 | |
| 2ahx_A | 617 | P180ERBB4, receptor tyrosine-protein kinase ERBB-4 | 2e-04 | |
| 1mox_A | 501 | Epidermal growth factor receptor; EGFR, receptor, | 3e-04 | |
| 2hr7_A | 486 | Insulin receptor; hormone receptor, leucine rich r | 4e-04 |
| >3q8k_A Flap endonuclease 1; helix-3 turn-helix, hydrophobic wedge, 3' flap binding site, hydrolase-DNA complex, DNA repair, replication; HET: DNA; 2.20A {Homo sapiens} PDB: 3q8l_A* 3q8m_A* Length = 341 | Back alignment and structure |
|---|
Score = 208 bits (530), Expect = 8e-63
Identities = 94/142 (66%), Positives = 120/142 (84%)
Query: 61 APCEAEAQCAAMVKAGKVYATATEDMDALTFGSNILLRHMTFSEARKLPVQEFHLEKVLE 120
AP EAEA CAA+VKAGKVYA ATEDMD LTFGS +L+RH+T SEA+KLP+QEFHL ++L+
Sbjct: 154 APSEAEASCAALVKAGKVYAAATEDMDCLTFGSPVLMRHLTASEAKKLPIQEFHLSRILQ 213
Query: 121 GMELSHEEFIDLCILLGCDYCDSIRGIGPKRAIELIKEHRSIEKILENIDTKKYTVPEGW 180
+ L+ E+F+DLCILLG DYC+SIRGIGPKRA++LI++H+SIE+I+ +D KY VPE W
Sbjct: 214 ELGLNQEQFVDLCILLGSDYCESIRGIGPKRAVDLIQKHKSIEEIVRRLDPNKYPVPENW 273
Query: 181 LYKEARELFRHPEVADPETIEF 202
L+KEA +LF PEV DPE++E
Sbjct: 274 LHKEAHQLFLEPEVLDPESVEL 295
|
| >3q8k_A Flap endonuclease 1; helix-3 turn-helix, hydrophobic wedge, 3' flap binding site, hydrolase-DNA complex, DNA repair, replication; HET: DNA; 2.20A {Homo sapiens} PDB: 3q8l_A* 3q8m_A* Length = 341 | Back alignment and structure |
|---|
| >3q8k_A Flap endonuclease 1; helix-3 turn-helix, hydrophobic wedge, 3' flap binding site, hydrolase-DNA complex, DNA repair, replication; HET: DNA; 2.20A {Homo sapiens} PDB: 3q8l_A* 3q8m_A* Length = 341 | Back alignment and structure |
|---|
| >3q8k_A Flap endonuclease 1; helix-3 turn-helix, hydrophobic wedge, 3' flap binding site, hydrolase-DNA complex, DNA repair, replication; HET: DNA; 2.20A {Homo sapiens} PDB: 3q8l_A* 3q8m_A* Length = 341 | Back alignment and structure |
|---|
| >3q8k_A Flap endonuclease 1; helix-3 turn-helix, hydrophobic wedge, 3' flap binding site, hydrolase-DNA complex, DNA repair, replication; HET: DNA; 2.20A {Homo sapiens} PDB: 3q8l_A* 3q8m_A* Length = 341 | Back alignment and structure |
|---|
| >1ul1_X Flap endonuclease-1; protein complex, DNA-binding protein, flap DNA, flap endonuclease, sliding clamp, DNA clamp; 2.90A {Homo sapiens} SCOP: a.60.7.1 c.120.1.2 Length = 379 | Back alignment and structure |
|---|
| >1ul1_X Flap endonuclease-1; protein complex, DNA-binding protein, flap DNA, flap endonuclease, sliding clamp, DNA clamp; 2.90A {Homo sapiens} SCOP: a.60.7.1 c.120.1.2 Length = 379 | Back alignment and structure |
|---|
| >1ul1_X Flap endonuclease-1; protein complex, DNA-binding protein, flap DNA, flap endonuclease, sliding clamp, DNA clamp; 2.90A {Homo sapiens} SCOP: a.60.7.1 c.120.1.2 Length = 379 | Back alignment and structure |
|---|
| >1ul1_X Flap endonuclease-1; protein complex, DNA-binding protein, flap DNA, flap endonuclease, sliding clamp, DNA clamp; 2.90A {Homo sapiens} SCOP: a.60.7.1 c.120.1.2 Length = 379 | Back alignment and structure |
|---|
| >1ul1_X Flap endonuclease-1; protein complex, DNA-binding protein, flap DNA, flap endonuclease, sliding clamp, DNA clamp; 2.90A {Homo sapiens} SCOP: a.60.7.1 c.120.1.2 Length = 379 | Back alignment and structure |
|---|
| >1rxw_A Flap structure-specific endonuclease; helical clamp, helix-3 turn-helix, hydrophobic wedge, 3' FLA site, hydrolase-DNA complex; 2.00A {Archaeoglobus fulgidus} SCOP: a.60.7.1 c.120.1.2 PDB: 1rxv_A Length = 336 | Back alignment and structure |
|---|
| >1rxw_A Flap structure-specific endonuclease; helical clamp, helix-3 turn-helix, hydrophobic wedge, 3' FLA site, hydrolase-DNA complex; 2.00A {Archaeoglobus fulgidus} SCOP: a.60.7.1 c.120.1.2 PDB: 1rxv_A Length = 336 | Back alignment and structure |
|---|
| >1rxw_A Flap structure-specific endonuclease; helical clamp, helix-3 turn-helix, hydrophobic wedge, 3' FLA site, hydrolase-DNA complex; 2.00A {Archaeoglobus fulgidus} SCOP: a.60.7.1 c.120.1.2 PDB: 1rxv_A Length = 336 | Back alignment and structure |
|---|
| >1rxw_A Flap structure-specific endonuclease; helical clamp, helix-3 turn-helix, hydrophobic wedge, 3' FLA site, hydrolase-DNA complex; 2.00A {Archaeoglobus fulgidus} SCOP: a.60.7.1 c.120.1.2 PDB: 1rxv_A Length = 336 | Back alignment and structure |
|---|
| >1rxw_A Flap structure-specific endonuclease; helical clamp, helix-3 turn-helix, hydrophobic wedge, 3' FLA site, hydrolase-DNA complex; 2.00A {Archaeoglobus fulgidus} SCOP: a.60.7.1 c.120.1.2 PDB: 1rxv_A Length = 336 | Back alignment and structure |
|---|
| >3ory_A Flap endonuclease 1; hydrolase; 2.00A {Desulfurococcus amylolyticus} Length = 363 | Back alignment and structure |
|---|
| >3ory_A Flap endonuclease 1; hydrolase; 2.00A {Desulfurococcus amylolyticus} Length = 363 | Back alignment and structure |
|---|
| >3ory_A Flap endonuclease 1; hydrolase; 2.00A {Desulfurococcus amylolyticus} Length = 363 | Back alignment and structure |
|---|
| >3ory_A Flap endonuclease 1; hydrolase; 2.00A {Desulfurococcus amylolyticus} Length = 363 | Back alignment and structure |
|---|
| >3ory_A Flap endonuclease 1; hydrolase; 2.00A {Desulfurococcus amylolyticus} Length = 363 | Back alignment and structure |
|---|
| >1a76_A Flap endonuclease-1 protein; 5'-3' EXO/endo nuclease, DNA replication, RTH, RAD27, DNA repair; 2.00A {Methanocaldococcus jannaschii} SCOP: a.60.7.1 c.120.1.2 PDB: 1a77_A Length = 326 | Back alignment and structure |
|---|
| >1a76_A Flap endonuclease-1 protein; 5'-3' EXO/endo nuclease, DNA replication, RTH, RAD27, DNA repair; 2.00A {Methanocaldococcus jannaschii} SCOP: a.60.7.1 c.120.1.2 PDB: 1a77_A Length = 326 | Back alignment and structure |
|---|
| >1a76_A Flap endonuclease-1 protein; 5'-3' EXO/endo nuclease, DNA replication, RTH, RAD27, DNA repair; 2.00A {Methanocaldococcus jannaschii} SCOP: a.60.7.1 c.120.1.2 PDB: 1a77_A Length = 326 | Back alignment and structure |
|---|
| >1a76_A Flap endonuclease-1 protein; 5'-3' EXO/endo nuclease, DNA replication, RTH, RAD27, DNA repair; 2.00A {Methanocaldococcus jannaschii} SCOP: a.60.7.1 c.120.1.2 PDB: 1a77_A Length = 326 | Back alignment and structure |
|---|
| >1a76_A Flap endonuclease-1 protein; 5'-3' EXO/endo nuclease, DNA replication, RTH, RAD27, DNA repair; 2.00A {Methanocaldococcus jannaschii} SCOP: a.60.7.1 c.120.1.2 PDB: 1a77_A Length = 326 | Back alignment and structure |
|---|
| >2izo_A FEN1, flap structure-specific endonuclease; hydrolase, DNA repair, DNA-binding, endonuclease, metal-BIND excision repair, DNA replication, PCNA; HET: DNA; 2.9A {Sulfolobus solfataricus} Length = 346 | Back alignment and structure |
|---|
| >2izo_A FEN1, flap structure-specific endonuclease; hydrolase, DNA repair, DNA-binding, endonuclease, metal-BIND excision repair, DNA replication, PCNA; HET: DNA; 2.9A {Sulfolobus solfataricus} Length = 346 | Back alignment and structure |
|---|
| >2izo_A FEN1, flap structure-specific endonuclease; hydrolase, DNA repair, DNA-binding, endonuclease, metal-BIND excision repair, DNA replication, PCNA; HET: DNA; 2.9A {Sulfolobus solfataricus} Length = 346 | Back alignment and structure |
|---|
| >2izo_A FEN1, flap structure-specific endonuclease; hydrolase, DNA repair, DNA-binding, endonuclease, metal-BIND excision repair, DNA replication, PCNA; HET: DNA; 2.9A {Sulfolobus solfataricus} Length = 346 | Back alignment and structure |
|---|
| >2izo_A FEN1, flap structure-specific endonuclease; hydrolase, DNA repair, DNA-binding, endonuclease, metal-BIND excision repair, DNA replication, PCNA; HET: DNA; 2.9A {Sulfolobus solfataricus} Length = 346 | Back alignment and structure |
|---|
| >1b43_A Protein (FEN-1); nuclease, DNA repair, DNA replication, transferase; 2.00A {Pyrococcus furiosus} SCOP: a.60.7.1 c.120.1.2 PDB: 1mc8_A Length = 340 | Back alignment and structure |
|---|
| >1b43_A Protein (FEN-1); nuclease, DNA repair, DNA replication, transferase; 2.00A {Pyrococcus furiosus} SCOP: a.60.7.1 c.120.1.2 PDB: 1mc8_A Length = 340 | Back alignment and structure |
|---|
| >1b43_A Protein (FEN-1); nuclease, DNA repair, DNA replication, transferase; 2.00A {Pyrococcus furiosus} SCOP: a.60.7.1 c.120.1.2 PDB: 1mc8_A Length = 340 | Back alignment and structure |
|---|
| >1b43_A Protein (FEN-1); nuclease, DNA repair, DNA replication, transferase; 2.00A {Pyrococcus furiosus} SCOP: a.60.7.1 c.120.1.2 PDB: 1mc8_A Length = 340 | Back alignment and structure |
|---|
| >1b43_A Protein (FEN-1); nuclease, DNA repair, DNA replication, transferase; 2.00A {Pyrococcus furiosus} SCOP: a.60.7.1 c.120.1.2 PDB: 1mc8_A Length = 340 | Back alignment and structure |
|---|
| >3qe9_Y Exonuclease 1; exonuclease, hydrolase-DNA complex; HET: DNA; 2.51A {Homo sapiens} PDB: 3qeb_Z* 3qea_Z* Length = 352 | Back alignment and structure |
|---|
| >3qe9_Y Exonuclease 1; exonuclease, hydrolase-DNA complex; HET: DNA; 2.51A {Homo sapiens} PDB: 3qeb_Z* 3qea_Z* Length = 352 | Back alignment and structure |
|---|
| >3qe9_Y Exonuclease 1; exonuclease, hydrolase-DNA complex; HET: DNA; 2.51A {Homo sapiens} PDB: 3qeb_Z* 3qea_Z* Length = 352 | Back alignment and structure |
|---|
| >3qe9_Y Exonuclease 1; exonuclease, hydrolase-DNA complex; HET: DNA; 2.51A {Homo sapiens} PDB: 3qeb_Z* 3qea_Z* Length = 352 | Back alignment and structure |
|---|
| >3qe9_Y Exonuclease 1; exonuclease, hydrolase-DNA complex; HET: DNA; 2.51A {Homo sapiens} PDB: 3qeb_Z* 3qea_Z* Length = 352 | Back alignment and structure |
|---|
| >1exn_A 5'-exonuclease, 5'-nuclease; hydrolase; 2.50A {Enterobacteria phage T5} SCOP: a.60.7.1 c.120.1.2 PDB: 1ut5_A 1ut8_A 1xo1_A Length = 290 | Back alignment and structure |
|---|
| >1exn_A 5'-exonuclease, 5'-nuclease; hydrolase; 2.50A {Enterobacteria phage T5} SCOP: a.60.7.1 c.120.1.2 PDB: 1ut5_A 1ut8_A 1xo1_A Length = 290 | Back alignment and structure |
|---|
| >1bgx_T TAQ DNA polymerase; DNA polymerase, FAB, PCR, inhibition, helix-coil dynamics, inhibitor design, complex (polymerase/inhibitor); 2.30A {Thermus aquaticus} SCOP: a.60.7.1 c.120.1.2 c.55.3.5 e.8.1.1 PDB: 1cmw_A 1tau_A* 1taq_A* Length = 832 | Back alignment and structure |
|---|
| >1bgx_T TAQ DNA polymerase; DNA polymerase, FAB, PCR, inhibition, helix-coil dynamics, inhibitor design, complex (polymerase/inhibitor); 2.30A {Thermus aquaticus} SCOP: a.60.7.1 c.120.1.2 c.55.3.5 e.8.1.1 PDB: 1cmw_A 1tau_A* 1taq_A* Length = 832 | Back alignment and structure |
|---|
| >1igr_A Insulin-like growth factor receptor 1; hormone receptor, insulin receptor family; HET: NAG FUC BMA MAN; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 Length = 478 | Back alignment and structure |
|---|
| >2ahx_A P180ERBB4, receptor tyrosine-protein kinase ERBB-4; X-RAY crystallography, neuregulins, heparin-binding, cell CY signaling protein; HET: NAG NDG; 2.40A {Homo sapiens} PDB: 3u2p_A* Length = 617 | Back alignment and structure |
|---|
| >1mox_A Epidermal growth factor receptor; EGFR, receptor, complex, transferase-growth F complex; HET: NAG FUC BMA MAN; 2.50A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 Length = 501 | Back alignment and structure |
|---|
| >2hr7_A Insulin receptor; hormone receptor, leucine rich repeat, transferase; HET: NAG BMA MAN FUC P33; 2.32A {Homo sapiens} Length = 486 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 531 | |||
| 1b43_A | 340 | Protein (FEN-1); nuclease, DNA repair, DNA replica | 100.0 | |
| 3ory_A | 363 | Flap endonuclease 1; hydrolase; 2.00A {Desulfuroco | 100.0 | |
| 3q8k_A | 341 | Flap endonuclease 1; helix-3 turn-helix, hydrophob | 100.0 | |
| 1ul1_X | 379 | Flap endonuclease-1; protein complex, DNA-binding | 100.0 | |
| 2izo_A | 346 | FEN1, flap structure-specific endonuclease; hydrol | 100.0 | |
| 3qe9_Y | 352 | Exonuclease 1; exonuclease, hydrolase-DNA complex; | 100.0 | |
| 1a76_A | 326 | Flap endonuclease-1 protein; 5'-3' EXO/endo nuclea | 100.0 | |
| 1rxw_A | 336 | Flap structure-specific endonuclease; helical clam | 100.0 | |
| 1exn_A | 290 | 5'-exonuclease, 5'-nuclease; hydrolase; 2.50A {Ent | 99.95 | |
| 3ory_A | 363 | Flap endonuclease 1; hydrolase; 2.00A {Desulfuroco | 99.92 | |
| 1bgx_T | 832 | TAQ DNA polymerase; DNA polymerase, FAB, PCR, inhi | 99.92 | |
| 3q8k_A | 341 | Flap endonuclease 1; helix-3 turn-helix, hydrophob | 99.92 | |
| 3qe9_Y | 352 | Exonuclease 1; exonuclease, hydrolase-DNA complex; | 99.89 | |
| 2izo_A | 346 | FEN1, flap structure-specific endonuclease; hydrol | 99.87 | |
| 1b43_A | 340 | Protein (FEN-1); nuclease, DNA repair, DNA replica | 99.85 | |
| 1rxw_A | 336 | Flap structure-specific endonuclease; helical clam | 99.85 | |
| 1ul1_X | 379 | Flap endonuclease-1; protein complex, DNA-binding | 99.84 | |
| 1a76_A | 326 | Flap endonuclease-1 protein; 5'-3' EXO/endo nuclea | 99.8 | |
| 3h7i_A | 305 | Ribonuclease H, RNAse H; BPT4 RNAse H, 5'-3' exonu | 99.78 | |
| 1exn_A | 290 | 5'-exonuclease, 5'-nuclease; hydrolase; 2.50A {Ent | 98.87 | |
| 1bgx_T | 832 | TAQ DNA polymerase; DNA polymerase, FAB, PCR, inhi | 98.68 | |
| 2ztd_A | 212 | Holliday junction ATP-dependent DNA helicase RUVA; | 95.57 | |
| 1ixr_A | 191 | Holliday junction DNA helicase RUVA; heterooligome | 95.5 | |
| 2a1j_A | 63 | DNA repair endonuclease XPF; XPF, xeroderma pigmen | 95.08 | |
| 1cuk_A | 203 | RUVA protein; DNA repair, SOS response, DNA-bindin | 94.79 | |
| 1z00_B | 84 | DNA repair endonuclease XPF; helix-hairpin-helix, | 94.25 | |
| 2a1j_A | 63 | DNA repair endonuclease XPF; XPF, xeroderma pigmen | 94.12 | |
| 2y35_A | 1140 | LD22664P; hydrolase-DNA complex, RNA degradation, | 93.37 | |
| 1x2i_A | 75 | HEF helicase/nuclease; alpha helix, helix-hairpin- | 93.15 | |
| 1z00_B | 84 | DNA repair endonuclease XPF; helix-hairpin-helix, | 93.14 | |
| 4glx_A | 586 | DNA ligase; inhibitor, ligase-ligase inhibitor-DNA | 92.8 | |
| 1kft_A | 78 | UVRC, excinuclease ABC subunit C; helix-hairpin-he | 92.8 | |
| 1z00_A | 89 | DNA excision repair protein ERCC-1; helix-hairpin- | 92.65 | |
| 3fqd_A | 899 | Protein DHP1, 5'-3' exoribonuclease 2; protein-pro | 92.47 | |
| 2a1j_B | 91 | DNA excision repair protein ERCC-1; XPF, xeroderma | 91.67 | |
| 3b0x_A | 575 | DNA polymerase beta family (X family); structural | 91.17 | |
| 2w9m_A | 578 | Polymerase X; SAXS, DNA repair, DNA polymerase, DN | 91.08 | |
| 2owo_A | 671 | DNA ligase; protein-DNA complex, ligase-DNA comple | 89.89 | |
| 3sgi_A | 615 | DNA ligase; HET: DNA AMP; 3.50A {Mycobacterium tub | 89.86 | |
| 1kft_A | 78 | UVRC, excinuclease ABC subunit C; helix-hairpin-he | 89.73 | |
| 3pie_A | 1155 | 5'->3' exoribonuclease (XRN1); beta berrel, tudor | 89.56 | |
| 2nrt_A | 220 | Uvrabc system protein C; UVRC, endonuclease, RNAse | 89.39 | |
| 1dgs_A | 667 | DNA ligase; AMP complex, NAD+-dependent; HET: DNA | 88.24 | |
| 1z00_A | 89 | DNA excision repair protein ERCC-1; helix-hairpin- | 87.7 | |
| 1x2i_A | 75 | HEF helicase/nuclease; alpha helix, helix-hairpin- | 87.56 | |
| 2a1j_B | 91 | DNA excision repair protein ERCC-1; XPF, xeroderma | 85.02 | |
| 3c65_A | 226 | Uvrabc system protein C; UVRC, endonuclease, nucle | 84.29 | |
| 2bgw_A | 219 | XPF endonuclease; hydrolase, structure specific en | 83.87 | |
| 1dgs_A | 667 | DNA ligase; AMP complex, NAD+-dependent; HET: DNA | 80.89 |
| >1b43_A Protein (FEN-1); nuclease, DNA repair, DNA replication, transferase; 2.00A {Pyrococcus furiosus} SCOP: a.60.7.1 c.120.1.2 PDB: 1mc8_A | Back alignment and structure |
|---|
Probab=100.00 E-value=1.7e-40 Score=343.97 Aligned_cols=161 Identities=29% Similarity=0.470 Sum_probs=134.3
Q ss_pred CCCccceeecccCCCCCcchhHH------hH----HHHHHhh------------ccCCCH---HHHHHHHhhcCCccccC
Q psy1206 7 DPDEDGLVKYLCGDKNFAEDRIR------NG----AKKLLKA------------RSSTTQ---GRLDSFFTIRREEKRKA 61 (531)
Q Consensus 7 ~~d~~~~~a~~~~~~~f~~~~~R------~~----~~~~~k~------------~~~~t~---~~i~~lL~~~gIp~vvA 61 (531)
.|.+ .++.||.+.++|+++... .+ +...+++ ...+|+ +.++++|+++|||+++|
T Consensus 71 ~~i~-pv~VFDG~~~~~K~~~~~~R~~~r~~~~~~~~~~yk~g~~~~~~~~~~~~~~vt~~~~~~~~~lL~~~gip~i~a 149 (340)
T 1b43_A 71 AGIK-PVYVFDGEPPEFKKKELEKRREAREEAEEKWREALEKGEIEEARKYAQRATRVNEMLIEDAKKLLELMGIPIVQA 149 (340)
T ss_dssp TTCE-EEEEECCSCCCCSSCSSTTCCCCTTHHHHHHHHHHHHSCHHHHHHHHHTSGGGTHHHHHHHHHHHHHHTCCEEEC
T ss_pred CCCE-EEEEecCCCchhhhhhHHHHHHHHHHHHHHHHHHHHcCCHHHHHHHHHhcCCCCHHHHHHHHHHHHHcCCcEEEc
Confidence 5666 899999998999865432 11 1112333 233444 45789999999999999
Q ss_pred CCchhHHHHHHHHcCCEEEEEcCCCccccccCCeEEEeccccCcccC---------CcEEecHHHHHHhCCCCHHHHHHH
Q psy1206 62 PCEAEAQCAAMVKAGKVYATATEDMDALTFGSNILLRHMTFSEARKL---------PVQEFHLEKVLEGMELSHEEFIDL 132 (531)
Q Consensus 62 PyEADAq~A~L~r~G~vd~ViSeDsDlL~fg~~~Vi~~l~~~~~~~~---------~v~~~~~~~i~~~lglt~eqfid~ 132 (531)
|||||||||+|+++|++++|+|+|+|+|+||+++|+++++.+|..+. .++.++.+.+.+.+|++++||+|+
T Consensus 150 p~EADa~iA~La~~g~~~~i~S~D~D~l~~g~~~v~~~~~~~~~~~~p~~~~~v~~~~~~~~~~~v~~~~gl~~~q~id~ 229 (340)
T 1b43_A 150 PSEGEAQAAYMAAKGSVYASASQDYDSLLFGAPRLVRNLTITGKRKLPGKNVYVEIKPELIILEEVLKELKLTREKLIEL 229 (340)
T ss_dssp SSCHHHHHHHHHHHTSSSEEECSSSHHHHTTCSEEEESTTTCEEEECTTSSCEEEECCEEEEHHHHHHHHTCCHHHHHHH
T ss_pred ChhHHHHHHHHHHcCCEEEEEccCCCcceecCcEEEEEeccCCCccCcccccccccceeEEEHHHHHHHhCCCHHHHHHH
Confidence 99999999999999999999999999999999999999876653322 346799999999999999999999
Q ss_pred HhHcCCCCCC-CCCCccHHHHHHHHHHcCCHHHHHHH
Q psy1206 133 CILLGCDYCD-SIRGIGPKRAIELIKEHRSIEKILEN 168 (531)
Q Consensus 133 ~iL~G~DY~p-GIpGIG~ktA~kLI~~~~sle~il~~ 168 (531)
|+|+||||+| ||||||+|||++||++|+|+++++++
T Consensus 230 ~~L~G~Dy~p~gv~GiG~ktA~kli~~~gsle~il~~ 266 (340)
T 1b43_A 230 AILVGTDYNPGGIKGIGLKKALEIVRHSKDPLAKFQK 266 (340)
T ss_dssp HHHHCCTTSTTCSTTCCHHHHHHHHHTCSSGGGGTGG
T ss_pred HHhcCCCCCCCCCCCccHHHHHHHHHHcCCHHHHHcC
Confidence 9999999999 99999999999999999998876543
|
| >3ory_A Flap endonuclease 1; hydrolase; 2.00A {Desulfurococcus amylolyticus} | Back alignment and structure |
|---|
| >3q8k_A Flap endonuclease 1; helix-3 turn-helix, hydrophobic wedge, 3' flap binding site, hydrolase-DNA complex, DNA repair, replication; HET: DNA; 2.20A {Homo sapiens} PDB: 3q8l_A* 3q8m_A* | Back alignment and structure |
|---|
| >1ul1_X Flap endonuclease-1; protein complex, DNA-binding protein, flap DNA, flap endonuclease, sliding clamp, DNA clamp; 2.90A {Homo sapiens} SCOP: a.60.7.1 c.120.1.2 | Back alignment and structure |
|---|
| >2izo_A FEN1, flap structure-specific endonuclease; hydrolase, DNA repair, DNA-binding, endonuclease, metal-BIND excision repair, DNA replication, PCNA; HET: DNA; 2.9A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3qe9_Y Exonuclease 1; exonuclease, hydrolase-DNA complex; HET: DNA; 2.51A {Homo sapiens} PDB: 3qeb_Z* 3qea_Z* | Back alignment and structure |
|---|
| >1a76_A Flap endonuclease-1 protein; 5'-3' EXO/endo nuclease, DNA replication, RTH, RAD27, DNA repair; 2.00A {Methanocaldococcus jannaschii} SCOP: a.60.7.1 c.120.1.2 PDB: 1a77_A | Back alignment and structure |
|---|
| >1rxw_A Flap structure-specific endonuclease; helical clamp, helix-3 turn-helix, hydrophobic wedge, 3' FLA site, hydrolase-DNA complex; 2.00A {Archaeoglobus fulgidus} SCOP: a.60.7.1 c.120.1.2 PDB: 1rxv_A | Back alignment and structure |
|---|
| >1exn_A 5'-exonuclease, 5'-nuclease; hydrolase; 2.50A {Enterobacteria phage T5} SCOP: a.60.7.1 c.120.1.2 PDB: 1ut5_A 1ut8_A 1xo1_A | Back alignment and structure |
|---|
| >3ory_A Flap endonuclease 1; hydrolase; 2.00A {Desulfurococcus amylolyticus} | Back alignment and structure |
|---|
| >1bgx_T TAQ DNA polymerase; DNA polymerase, FAB, PCR, inhibition, helix-coil dynamics, inhibitor design, complex (polymerase/inhibitor); 2.30A {Thermus aquaticus} SCOP: a.60.7.1 c.120.1.2 c.55.3.5 e.8.1.1 PDB: 1cmw_A 1tau_A* 1taq_A* | Back alignment and structure |
|---|
| >3q8k_A Flap endonuclease 1; helix-3 turn-helix, hydrophobic wedge, 3' flap binding site, hydrolase-DNA complex, DNA repair, replication; HET: DNA; 2.20A {Homo sapiens} PDB: 3q8l_A* 3q8m_A* | Back alignment and structure |
|---|
| >3qe9_Y Exonuclease 1; exonuclease, hydrolase-DNA complex; HET: DNA; 2.51A {Homo sapiens} PDB: 3qeb_Z* 3qea_Z* | Back alignment and structure |
|---|
| >2izo_A FEN1, flap structure-specific endonuclease; hydrolase, DNA repair, DNA-binding, endonuclease, metal-BIND excision repair, DNA replication, PCNA; HET: DNA; 2.9A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1b43_A Protein (FEN-1); nuclease, DNA repair, DNA replication, transferase; 2.00A {Pyrococcus furiosus} SCOP: a.60.7.1 c.120.1.2 PDB: 1mc8_A | Back alignment and structure |
|---|
| >1rxw_A Flap structure-specific endonuclease; helical clamp, helix-3 turn-helix, hydrophobic wedge, 3' FLA site, hydrolase-DNA complex; 2.00A {Archaeoglobus fulgidus} SCOP: a.60.7.1 c.120.1.2 PDB: 1rxv_A | Back alignment and structure |
|---|
| >1ul1_X Flap endonuclease-1; protein complex, DNA-binding protein, flap DNA, flap endonuclease, sliding clamp, DNA clamp; 2.90A {Homo sapiens} SCOP: a.60.7.1 c.120.1.2 | Back alignment and structure |
|---|
| >1a76_A Flap endonuclease-1 protein; 5'-3' EXO/endo nuclease, DNA replication, RTH, RAD27, DNA repair; 2.00A {Methanocaldococcus jannaschii} SCOP: a.60.7.1 c.120.1.2 PDB: 1a77_A | Back alignment and structure |
|---|
| >3h7i_A Ribonuclease H, RNAse H; BPT4 RNAse H, 5'-3' exonuclease, hydrolase, endonuclease; 1.50A {Enterobacteria phage T4} PDB: 2ihn_A 3h8w_A 3h8j_A 1tfr_A 3h8s_A | Back alignment and structure |
|---|
| >1exn_A 5'-exonuclease, 5'-nuclease; hydrolase; 2.50A {Enterobacteria phage T5} SCOP: a.60.7.1 c.120.1.2 PDB: 1ut5_A 1ut8_A 1xo1_A | Back alignment and structure |
|---|
| >1bgx_T TAQ DNA polymerase; DNA polymerase, FAB, PCR, inhibition, helix-coil dynamics, inhibitor design, complex (polymerase/inhibitor); 2.30A {Thermus aquaticus} SCOP: a.60.7.1 c.120.1.2 c.55.3.5 e.8.1.1 PDB: 1cmw_A 1tau_A* 1taq_A* | Back alignment and structure |
|---|
| >2ztd_A Holliday junction ATP-dependent DNA helicase RUVA; recombination, branch migration, DNA BIND oligomerization, acidic PIN; 2.40A {Mycobacterium tuberculosis} PDB: 2ztc_A 2zte_A 2h5x_A 1bvs_A | Back alignment and structure |
|---|
| >1ixr_A Holliday junction DNA helicase RUVA; heterooligomeric complex, octameric RUVA, AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ANP; 3.30A {Thermus thermophilus} SCOP: a.60.2.1 b.40.4.2 | Back alignment and structure |
|---|
| >2a1j_A DNA repair endonuclease XPF; XPF, xeroderma pigmentosum, DNA repair, endonuclease, helix-hairpin-helix, DNA binding protein; HET: DNA; 2.70A {Homo sapiens} SCOP: a.60.2.5 PDB: 2kn7_A* | Back alignment and structure |
|---|
| >1cuk_A RUVA protein; DNA repair, SOS response, DNA-binding, DNA recombination; 1.90A {Escherichia coli} SCOP: a.5.1.1 a.60.2.1 b.40.4.2 PDB: 1hjp_A 1bdx_A* 1c7y_A 1d8l_A | Back alignment and structure |
|---|
| >1z00_B DNA repair endonuclease XPF; helix-hairpin-helix, hydrolase; HET: DNA; NMR {Homo sapiens} SCOP: a.60.2.5 PDB: 2aq0_A* | Back alignment and structure |
|---|
| >2a1j_A DNA repair endonuclease XPF; XPF, xeroderma pigmentosum, DNA repair, endonuclease, helix-hairpin-helix, DNA binding protein; HET: DNA; 2.70A {Homo sapiens} SCOP: a.60.2.5 PDB: 2kn7_A* | Back alignment and structure |
|---|
| >2y35_A LD22664P; hydrolase-DNA complex, RNA degradation, exonuclease 5'-3', R interference; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1x2i_A HEF helicase/nuclease; alpha helix, helix-hairpin-helix DNA binding domain, homodimer, hydrolase; 1.45A {Pyrococcus furiosus} SCOP: a.60.2.5 | Back alignment and structure |
|---|
| >1z00_B DNA repair endonuclease XPF; helix-hairpin-helix, hydrolase; HET: DNA; NMR {Homo sapiens} SCOP: a.60.2.5 PDB: 2aq0_A* | Back alignment and structure |
|---|
| >4glx_A DNA ligase; inhibitor, ligase-ligase inhibitor-DNA complex; HET: DNA 0XS; 1.90A {Escherichia coli} | Back alignment and structure |
|---|
| >1kft_A UVRC, excinuclease ABC subunit C; helix-hairpin-helix, HHH domain, DNA-binding domain, DNA binding protein; NMR {Escherichia coli} SCOP: a.60.2.3 | Back alignment and structure |
|---|
| >1z00_A DNA excision repair protein ERCC-1; helix-hairpin-helix, hydrolase; HET: DNA; NMR {Homo sapiens} SCOP: a.60.2.5 | Back alignment and structure |
|---|
| >3fqd_A Protein DHP1, 5'-3' exoribonuclease 2; protein-protein complex, exonuclease, hydrolase, mRNA proces nuclease, nucleus, rRNA processing, transcription; 2.20A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2a1j_B DNA excision repair protein ERCC-1; XPF, xeroderma pigmentosum, DNA repair, endonuclease, helix-hairpin-helix, DNA binding protein; HET: DNA; 2.70A {Homo sapiens} SCOP: a.60.2.5 | Back alignment and structure |
|---|
| >3b0x_A DNA polymerase beta family (X family); structural genomics, riken structural genomics/proteomics in RSGI, polxc, PHP, DRP lyase; HET: DNA DGT; 1.36A {Thermus thermophilus} PDB: 3au2_A* 3au6_A* 3auo_A* 3b0y_A* | Back alignment and structure |
|---|
| >2w9m_A Polymerase X; SAXS, DNA repair, DNA polymerase, DNA replication; 2.46A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2owo_A DNA ligase; protein-DNA complex, ligase-DNA complex; HET: DNA OMC AMP; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >3sgi_A DNA ligase; HET: DNA AMP; 3.50A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1kft_A UVRC, excinuclease ABC subunit C; helix-hairpin-helix, HHH domain, DNA-binding domain, DNA binding protein; NMR {Escherichia coli} SCOP: a.60.2.3 | Back alignment and structure |
|---|
| >3pie_A 5'->3' exoribonuclease (XRN1); beta berrel, tudor domain, chromo domain, mRNA turnover, RRN processing, RNA binding, DNA binding; 2.90A {Kluyveromyces lactis} PDB: 3pif_A | Back alignment and structure |
|---|
| >2nrt_A Uvrabc system protein C; UVRC, endonuclease, RNAse H, helix hairpin helix, NER, hydrolase; 1.50A {Thermotoga maritima} PDB: 2nrv_A 2nrw_A 2nrx_A 2nrz_A | Back alignment and structure |
|---|
| >1dgs_A DNA ligase; AMP complex, NAD+-dependent; HET: DNA AMP; 2.90A {Thermus filiformis} SCOP: a.60.2.2 b.40.4.6 d.142.2.2 PDB: 1v9p_A* | Back alignment and structure |
|---|
| >1z00_A DNA excision repair protein ERCC-1; helix-hairpin-helix, hydrolase; HET: DNA; NMR {Homo sapiens} SCOP: a.60.2.5 | Back alignment and structure |
|---|
| >1x2i_A HEF helicase/nuclease; alpha helix, helix-hairpin-helix DNA binding domain, homodimer, hydrolase; 1.45A {Pyrococcus furiosus} SCOP: a.60.2.5 | Back alignment and structure |
|---|
| >2a1j_B DNA excision repair protein ERCC-1; XPF, xeroderma pigmentosum, DNA repair, endonuclease, helix-hairpin-helix, DNA binding protein; HET: DNA; 2.70A {Homo sapiens} SCOP: a.60.2.5 | Back alignment and structure |
|---|
| >3c65_A Uvrabc system protein C; UVRC, endonuclease, nucleotide excision repair, DNA repair, RNAse H, cytoplasm, DNA damage, DNA excision; 1.90A {Bacillus stearothermophilus} | Back alignment and structure |
|---|
| >2bgw_A XPF endonuclease; hydrolase, structure specific endonuclease, nucleotide excision repair; 2.8A {Aeropyrum pernix} SCOP: a.60.2.5 c.52.1.20 PDB: 2bhn_A | Back alignment and structure |
|---|
| >1dgs_A DNA ligase; AMP complex, NAD+-dependent; HET: DNA AMP; 2.90A {Thermus filiformis} SCOP: a.60.2.2 b.40.4.6 d.142.2.2 PDB: 1v9p_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 531 | ||||
| d1ul1x1 | 140 | a.60.7.1 (X:218-357) Flap endonuclease-1 (Fen-1 nu | 2e-25 | |
| d1ul1x1 | 140 | a.60.7.1 (X:218-357) Flap endonuclease-1 (Fen-1 nu | 9e-23 | |
| d1ul1x1 | 140 | a.60.7.1 (X:218-357) Flap endonuclease-1 (Fen-1 nu | 6e-14 | |
| d1ul1x1 | 140 | a.60.7.1 (X:218-357) Flap endonuclease-1 (Fen-1 nu | 2e-13 | |
| d1ul1x2 | 216 | c.120.1.2 (X:2-217) Flap endonuclease-1 (Fen-1 nuc | 3e-20 | |
| d1ul1x2 | 216 | c.120.1.2 (X:2-217) Flap endonuclease-1 (Fen-1 nuc | 2e-17 | |
| d1a77a2 | 207 | c.120.1.2 (A:2-208) Flap endonuclease-1 (Fen-1 nuc | 5e-20 | |
| d1a77a2 | 207 | c.120.1.2 (A:2-208) Flap endonuclease-1 (Fen-1 nuc | 1e-12 | |
| d1b43a1 | 120 | a.60.7.1 (A:220-339) Flap endonuclease-1 (Fen-1 nu | 1e-19 | |
| d1b43a1 | 120 | a.60.7.1 (A:220-339) Flap endonuclease-1 (Fen-1 nu | 7e-17 | |
| d1b43a1 | 120 | a.60.7.1 (A:220-339) Flap endonuclease-1 (Fen-1 nu | 9e-16 | |
| d1b43a1 | 120 | a.60.7.1 (A:220-339) Flap endonuclease-1 (Fen-1 nu | 2e-15 | |
| d1rxwa1 | 105 | a.60.7.1 (A:220-324) Flap endonuclease-1 (Fen-1 nu | 2e-19 | |
| d1rxwa1 | 105 | a.60.7.1 (A:220-324) Flap endonuclease-1 (Fen-1 nu | 5e-17 | |
| d1rxwa1 | 105 | a.60.7.1 (A:220-324) Flap endonuclease-1 (Fen-1 nu | 2e-06 | |
| d1rxwa1 | 105 | a.60.7.1 (A:220-324) Flap endonuclease-1 (Fen-1 nu | 3e-06 | |
| d1a77a1 | 108 | a.60.7.1 (A:209-316) Flap endonuclease-1 (Fen-1 nu | 1e-18 | |
| d1a77a1 | 108 | a.60.7.1 (A:209-316) Flap endonuclease-1 (Fen-1 nu | 3e-16 | |
| d1a77a1 | 108 | a.60.7.1 (A:209-316) Flap endonuclease-1 (Fen-1 nu | 4e-09 | |
| d1a77a1 | 108 | a.60.7.1 (A:209-316) Flap endonuclease-1 (Fen-1 nu | 5e-09 | |
| d1rxwa2 | 217 | c.120.1.2 (A:3-219) Flap endonuclease-1 (Fen-1 nuc | 1e-17 | |
| d1rxwa2 | 217 | c.120.1.2 (A:3-219) Flap endonuclease-1 (Fen-1 nuc | 3e-17 | |
| d1b43a2 | 219 | c.120.1.2 (A:1-219) Flap endonuclease-1 (Fen-1 nuc | 2e-17 | |
| d1b43a2 | 219 | c.120.1.2 (A:1-219) Flap endonuclease-1 (Fen-1 nuc | 5e-17 | |
| d1xo1a1 | 105 | a.60.7.1 (A:186-290) T5 5'-exonuclease {Bacterioph | 1e-06 | |
| d1xo1a1 | 105 | a.60.7.1 (A:186-290) T5 5'-exonuclease {Bacterioph | 4e-06 | |
| d1xo1a1 | 105 | a.60.7.1 (A:186-290) T5 5'-exonuclease {Bacterioph | 2e-04 | |
| d1kfta_ | 56 | a.60.2.3 (A:) Excinuclease UvrC C-terminal domain | 1e-05 | |
| d1kfta_ | 56 | a.60.2.3 (A:) Excinuclease UvrC C-terminal domain | 0.001 | |
| d1kfta_ | 56 | a.60.2.3 (A:) Excinuclease UvrC C-terminal domain | 0.001 | |
| d2bgwa1 | 70 | a.60.2.5 (A:160-229) DNA repair endonuclease XPF { | 7e-05 | |
| d1n8yc3 | 157 | g.3.9.1 (C:166-322) Protooncoprotein Her2 extracel | 2e-04 | |
| d1n8yc3 | 157 | g.3.9.1 (C:166-322) Protooncoprotein Her2 extracel | 7e-04 | |
| d1n8yc3 | 157 | g.3.9.1 (C:166-322) Protooncoprotein Her2 extracel | 0.001 | |
| d1n8yc3 | 157 | g.3.9.1 (C:166-322) Protooncoprotein Her2 extracel | 0.004 | |
| d1x2ia1 | 68 | a.60.2.5 (A:2-69) ATP-dependent RNA helicase PF201 | 2e-04 | |
| d1ky8a_ | 499 | c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3 | 0.004 |
| >d1ul1x1 a.60.7.1 (X:218-357) Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo sapiens) [TaxId: 9606]} Length = 140 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: SAM domain-like superfamily: 5' to 3' exonuclease, C-terminal subdomain family: 5' to 3' exonuclease, C-terminal subdomain domain: Flap endonuclease-1 (Fen-1 nuclease) species: Human (Homo sapiens) [TaxId: 9606]
Score = 99.3 bits (247), Expect = 2e-25
Identities = 50/79 (63%), Positives = 66/79 (83%)
Query: 124 LSHEEFIDLCILLGCDYCDSIRGIGPKRAIELIKEHRSIEKILENIDTKKYTVPEGWLYK 183
L+ E+F+DLCILLG DYC+SIRGIGPKRA++LI++H+SIE+I+ +D KY VPE WL+K
Sbjct: 1 LNQEQFVDLCILLGSDYCESIRGIGPKRAVDLIQKHKSIEEIVRRLDPNKYPVPENWLHK 60
Query: 184 EARELFRHPEVADPETIEF 202
EA +LF PEV DPE++E
Sbjct: 61 EAHQLFLEPEVLDPESVEL 79
|
| >d1ul1x1 a.60.7.1 (X:218-357) Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo sapiens) [TaxId: 9606]} Length = 140 | Back information, alignment and structure |
|---|
| >d1ul1x1 a.60.7.1 (X:218-357) Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo sapiens) [TaxId: 9606]} Length = 140 | Back information, alignment and structure |
|---|
| >d1ul1x1 a.60.7.1 (X:218-357) Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo sapiens) [TaxId: 9606]} Length = 140 | Back information, alignment and structure |
|---|
| >d1ul1x2 c.120.1.2 (X:2-217) Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo sapiens) [TaxId: 9606]} Length = 216 | Back information, alignment and structure |
|---|
| >d1ul1x2 c.120.1.2 (X:2-217) Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo sapiens) [TaxId: 9606]} Length = 216 | Back information, alignment and structure |
|---|
| >d1a77a2 c.120.1.2 (A:2-208) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 207 | Back information, alignment and structure |
|---|
| >d1a77a2 c.120.1.2 (A:2-208) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 207 | Back information, alignment and structure |
|---|
| >d1b43a1 a.60.7.1 (A:220-339) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 120 | Back information, alignment and structure |
|---|
| >d1b43a1 a.60.7.1 (A:220-339) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 120 | Back information, alignment and structure |
|---|
| >d1b43a1 a.60.7.1 (A:220-339) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 120 | Back information, alignment and structure |
|---|
| >d1b43a1 a.60.7.1 (A:220-339) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 120 | Back information, alignment and structure |
|---|
| >d1rxwa1 a.60.7.1 (A:220-324) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 105 | Back information, alignment and structure |
|---|
| >d1rxwa1 a.60.7.1 (A:220-324) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 105 | Back information, alignment and structure |
|---|
| >d1rxwa1 a.60.7.1 (A:220-324) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 105 | Back information, alignment and structure |
|---|
| >d1rxwa1 a.60.7.1 (A:220-324) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 105 | Back information, alignment and structure |
|---|
| >d1a77a1 a.60.7.1 (A:209-316) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 108 | Back information, alignment and structure |
|---|
| >d1a77a1 a.60.7.1 (A:209-316) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 108 | Back information, alignment and structure |
|---|
| >d1a77a1 a.60.7.1 (A:209-316) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 108 | Back information, alignment and structure |
|---|
| >d1a77a1 a.60.7.1 (A:209-316) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 108 | Back information, alignment and structure |
|---|
| >d1rxwa2 c.120.1.2 (A:3-219) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 217 | Back information, alignment and structure |
|---|
| >d1rxwa2 c.120.1.2 (A:3-219) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 217 | Back information, alignment and structure |
|---|
| >d1b43a2 c.120.1.2 (A:1-219) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 219 | Back information, alignment and structure |
|---|
| >d1b43a2 c.120.1.2 (A:1-219) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 219 | Back information, alignment and structure |
|---|
| >d1xo1a1 a.60.7.1 (A:186-290) T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726]} Length = 105 | Back information, alignment and structure |
|---|
| >d1xo1a1 a.60.7.1 (A:186-290) T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726]} Length = 105 | Back information, alignment and structure |
|---|
| >d1xo1a1 a.60.7.1 (A:186-290) T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726]} Length = 105 | Back information, alignment and structure |
|---|
| >d1kfta_ a.60.2.3 (A:) Excinuclease UvrC C-terminal domain {Escherichia coli [TaxId: 562]} Length = 56 | Back information, alignment and structure |
|---|
| >d1kfta_ a.60.2.3 (A:) Excinuclease UvrC C-terminal domain {Escherichia coli [TaxId: 562]} Length = 56 | Back information, alignment and structure |
|---|
| >d1kfta_ a.60.2.3 (A:) Excinuclease UvrC C-terminal domain {Escherichia coli [TaxId: 562]} Length = 56 | Back information, alignment and structure |
|---|
| >d2bgwa1 a.60.2.5 (A:160-229) DNA repair endonuclease XPF {Aeropyrum pernix [TaxId: 56636]} Length = 70 | Back information, alignment and structure |
|---|
| >d1n8yc3 g.3.9.1 (C:166-322) Protooncoprotein Her2 extracellular domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 157 | Back information, alignment and structure |
|---|
| >d1n8yc3 g.3.9.1 (C:166-322) Protooncoprotein Her2 extracellular domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 157 | Back information, alignment and structure |
|---|
| >d1n8yc3 g.3.9.1 (C:166-322) Protooncoprotein Her2 extracellular domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 157 | Back information, alignment and structure |
|---|
| >d1n8yc3 g.3.9.1 (C:166-322) Protooncoprotein Her2 extracellular domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 157 | Back information, alignment and structure |
|---|
| >d1x2ia1 a.60.2.5 (A:2-69) ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 68 | Back information, alignment and structure |
|---|
| >d1ky8a_ c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase GapN {Archaeon Thermoproteus tenax [TaxId: 2271]} Length = 499 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 531 | |||
| d1rxwa2 | 217 | Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Arc | 99.92 | |
| d1b43a2 | 219 | Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Pyr | 99.91 | |
| d1a77a2 | 207 | Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Met | 99.9 | |
| d1ul1x1 | 140 | Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo | 99.88 | |
| d1ul1x2 | 216 | Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo | 99.87 | |
| d1b43a1 | 120 | Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Pyr | 99.87 | |
| d1ul1x1 | 140 | Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo | 99.76 | |
| d1rxwa1 | 105 | Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Arc | 99.73 | |
| d1ul1x2 | 216 | Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo | 99.72 | |
| d1a77a1 | 108 | Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Met | 99.72 | |
| d1a77a1 | 108 | Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Met | 99.71 | |
| d1b43a1 | 120 | Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Pyr | 99.7 | |
| d1a77a2 | 207 | Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Met | 99.68 | |
| d1rxwa2 | 217 | Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Arc | 99.67 | |
| d1rxwa1 | 105 | Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Arc | 99.66 | |
| d1b43a2 | 219 | Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Pyr | 99.65 | |
| d1xo1a1 | 105 | T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726] | 99.23 | |
| d1cmwa1 | 116 | 5' to 3' exonuclease domain of DNA polymerase Taq | 99.06 | |
| d1cmwa2 | 164 | 5' to 3' exonuclease domain of DNA polymerase Taq | 98.93 | |
| d1tfra2 | 169 | T4 RNase H {Bacteriophage T4 [TaxId: 10665]} | 98.63 | |
| d1xo1a1 | 105 | T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726] | 98.54 | |
| d1xo1a2 | 167 | T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726] | 98.46 | |
| d1cmwa1 | 116 | 5' to 3' exonuclease domain of DNA polymerase Taq | 97.71 | |
| d1kfta_ | 56 | Excinuclease UvrC C-terminal domain {Escherichia c | 97.23 | |
| d1bvsa2 | 71 | DNA helicase RuvA subunit, middle domain {Mycobact | 97.12 | |
| d1ixra1 | 73 | DNA helicase RuvA subunit, middle domain {Thermus | 97.11 | |
| d1x2ia1 | 68 | ATP-dependent RNA helicase PF2015 {Pyrococcus furi | 97.06 | |
| d1cuka2 | 78 | DNA helicase RuvA subunit, middle domain {Escheric | 96.7 | |
| d1dgsa1 | 181 | NAD+-dependent DNA ligase, domain 3 {Thermus filif | 95.75 | |
| d2a1ja1 | 62 | DNA repair endonuclease XPF {Human (Homo sapiens) | 95.6 | |
| d1kfta_ | 56 | Excinuclease UvrC C-terminal domain {Escherichia c | 95.28 | |
| d2bgwa1 | 70 | DNA repair endonuclease XPF {Aeropyrum pernix [Tax | 95.2 | |
| d2a1ja1 | 62 | DNA repair endonuclease XPF {Human (Homo sapiens) | 95.08 | |
| d1x2ia1 | 68 | ATP-dependent RNA helicase PF2015 {Pyrococcus furi | 94.08 | |
| d2a1jb1 | 78 | DNA excision repair protein ERCC-1 {Human (Homo sa | 93.4 | |
| d2bgwa1 | 70 | DNA repair endonuclease XPF {Aeropyrum pernix [Tax | 92.77 | |
| d2i1qa1 | 60 | DNA repair protein Rad51, N-terminal domain {Archa | 92.31 | |
| d2bcqa2 | 57 | DNA polymerase lambda {Human (Homo sapiens) [TaxId | 90.46 | |
| d2a1jb1 | 78 | DNA excision repair protein ERCC-1 {Human (Homo sa | 90.33 | |
| d1pzna1 | 61 | DNA repair protein Rad51, N-terminal domain {Archa | 90.11 | |
| d2i1qa1 | 60 | DNA repair protein Rad51, N-terminal domain {Archa | 90.01 | |
| d1jmsa3 | 60 | Terminal deoxynucleotidyl transferase {Mouse (Mus | 89.96 | |
| d2fmpa2 | 57 | DNA polymerase beta {Human (Homo sapiens) [TaxId: | 88.85 | |
| d1pzna1 | 61 | DNA repair protein Rad51, N-terminal domain {Archa | 88.36 | |
| d1bvsa2 | 71 | DNA helicase RuvA subunit, middle domain {Mycobact | 86.16 | |
| d1ixra1 | 73 | DNA helicase RuvA subunit, middle domain {Thermus | 85.82 | |
| d1cuka2 | 78 | DNA helicase RuvA subunit, middle domain {Escheric | 84.13 | |
| d1cmwa2 | 164 | 5' to 3' exonuclease domain of DNA polymerase Taq | 82.56 |
| >d1rxwa2 c.120.1.2 (A:3-219) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: PIN domain-like superfamily: PIN domain-like family: 5' to 3' exonuclease catalytic domain domain: Flap endonuclease-1 (Fen-1 nuclease) species: Archaeon Archaeoglobus fulgidus [TaxId: 2234]
Probab=99.92 E-value=9.6e-26 Score=217.48 Aligned_cols=125 Identities=34% Similarity=0.603 Sum_probs=117.5
Q ss_pred cccccceeeecccchHHHHHHHHhh-cCccccCCCCCCcchhhhHHHHHHHHHHcCCeeEEeecCCCCCcchHHHHHHHH
Q psy1206 313 SIRESRKICIDASMSLYQFLIAVRS-EGNQLMSVDGEPTSHLMGTFYRTIRLVEHGLKPIYVFDGKPPTLKSGELNKRME 391 (531)
Q Consensus 313 ~i~~gk~iAIDa~~~lyqfl~~ir~-~g~~l~~~~g~~tshl~g~~~R~~~ll~~gIkPVfVFDG~pp~lK~~~~~kR~~ 391 (531)
....||+||||||+|||||+.++|. +|.++.+..|++++|+.++++|+..|+.+||+|||||||.||+.|..|+++|++
T Consensus 15 ~~l~Gk~vAIDas~wL~k~l~~~~~~~~~~l~~~~~~~~~~l~~~~~ri~~l~~~~I~pifVFDG~~p~~K~~~~~~R~~ 94 (217)
T d1rxwa2 15 EYFSGKKIAVDAFNTLYQFISIIRQPDGTPLKDSQGRITSHLSGILYRVSNMVEVGIRPVFVFDGEPPEFKKAEIEERKK 94 (217)
T ss_dssp GGGTTCEEEEEHHHHHHHHHHHSBCTTSCBCBCTTSCBCHHHHHHHHHHHHHHHHTCEEEEEECCSCCGGGHHHHHHHHH
T ss_pred HHhCCCEEEEECHHHHHHHHHHhccccCCchhhccCCccHHHHHHHHHHHHHHHcCCeEEEEECCCCCcchhhHHHHHHH
Confidence 4456999999999999999999999 799999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHcccccCCCCChhHHHHHHhhccccchHHHHHHHHHHHHHhc
Q psy1206 392 KREDAQKALAKAQEQGKLKWSDPDEDGLVKYLCGDKNFAEDRIRNGAKKLLKARS 446 (531)
Q Consensus 392 ~r~~a~~~~~~a~~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ll~~~~ 446 (531)
+|+++.+.++++.++|+. ++.++..+ ...+++++++.+++||+.+|
T Consensus 95 ~r~~~~~~~~~~~~~~~~--------~~~~~~~~-~~~vt~~~~~~~~~lL~~~g 140 (217)
T d1rxwa2 95 RRAEAEEMWIAALQAGDK--------DAKKYAQA-AGRVDEYIVDSAKTLLSYMG 140 (217)
T ss_dssp HHHHHHHHHHHHHHHTCT--------THHHHHHH-HCCCCHHHHHHHHHHHHHTT
T ss_pred HHHhhhhhhhhhhhhhhH--------HHHHHHHh-hccCCHHHHHHHHHHHHHcC
Confidence 999999999999998774 47778777 88999999999999999997
|
| >d1b43a2 c.120.1.2 (A:1-219) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1a77a2 c.120.1.2 (A:2-208) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1ul1x1 a.60.7.1 (X:218-357) Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ul1x2 c.120.1.2 (X:2-217) Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b43a1 a.60.7.1 (A:220-339) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ul1x1 a.60.7.1 (X:218-357) Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rxwa1 a.60.7.1 (A:220-324) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1ul1x2 c.120.1.2 (X:2-217) Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a77a1 a.60.7.1 (A:209-316) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1a77a1 a.60.7.1 (A:209-316) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1b43a1 a.60.7.1 (A:220-339) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1a77a2 c.120.1.2 (A:2-208) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1rxwa2 c.120.1.2 (A:3-219) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1rxwa1 a.60.7.1 (A:220-324) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1b43a2 c.120.1.2 (A:1-219) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1xo1a1 a.60.7.1 (A:186-290) T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726]} | Back information, alignment and structure |
|---|
| >d1cmwa1 a.60.7.1 (A:174-289) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1cmwa2 c.120.1.2 (A:10-173) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1tfra2 c.120.1.2 (A:12-180) T4 RNase H {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1xo1a1 a.60.7.1 (A:186-290) T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726]} | Back information, alignment and structure |
|---|
| >d1xo1a2 c.120.1.2 (A:19-185) T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726]} | Back information, alignment and structure |
|---|
| >d1cmwa1 a.60.7.1 (A:174-289) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1kfta_ a.60.2.3 (A:) Excinuclease UvrC C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bvsa2 a.60.2.1 (A:64-134) DNA helicase RuvA subunit, middle domain {Mycobacterium leprae [TaxId: 1769]} | Back information, alignment and structure |
|---|
| >d1ixra1 a.60.2.1 (A:63-135) DNA helicase RuvA subunit, middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1x2ia1 a.60.2.5 (A:2-69) ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1cuka2 a.60.2.1 (A:65-142) DNA helicase RuvA subunit, middle domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1dgsa1 a.60.2.2 (A:401-581) NAD+-dependent DNA ligase, domain 3 {Thermus filiformis [TaxId: 276]} | Back information, alignment and structure |
|---|
| >d2a1ja1 a.60.2.5 (A:837-898) DNA repair endonuclease XPF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kfta_ a.60.2.3 (A:) Excinuclease UvrC C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bgwa1 a.60.2.5 (A:160-229) DNA repair endonuclease XPF {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2a1ja1 a.60.2.5 (A:837-898) DNA repair endonuclease XPF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x2ia1 a.60.2.5 (A:2-69) ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2a1jb1 a.60.2.5 (B:219-296) DNA excision repair protein ERCC-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bgwa1 a.60.2.5 (A:160-229) DNA repair endonuclease XPF {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2i1qa1 a.60.4.1 (A:5-64) DNA repair protein Rad51, N-terminal domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d2bcqa2 a.60.12.1 (A:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a1jb1 a.60.2.5 (B:219-296) DNA excision repair protein ERCC-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pzna1 a.60.4.1 (A:35-95) DNA repair protein Rad51, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2i1qa1 a.60.4.1 (A:5-64) DNA repair protein Rad51, N-terminal domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1jmsa3 a.60.12.1 (A:243-302) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fmpa2 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pzna1 a.60.4.1 (A:35-95) DNA repair protein Rad51, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1bvsa2 a.60.2.1 (A:64-134) DNA helicase RuvA subunit, middle domain {Mycobacterium leprae [TaxId: 1769]} | Back information, alignment and structure |
|---|
| >d1ixra1 a.60.2.1 (A:63-135) DNA helicase RuvA subunit, middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1cuka2 a.60.2.1 (A:65-142) DNA helicase RuvA subunit, middle domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1cmwa2 c.120.1.2 (A:10-173) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|