Psyllid ID: psy12112

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240------
MNLHKVTSETVSETSLDQSTAASWWASASLKPAFPDVAGDPFFAAPDPLAPAPQISETLNPSFGSSSNPTYPDLGYTSLDFDTRGLDVLRGNAELSSPEECARACREGEPPKLCYYHFTLELYTVLGAACQLCTPNATNTVWSHCQCVLADGVERGILAVNRMLPGPSIQVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFTANAGTHFWHAHTGCPMSEK
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEHHHHHHHHHHHcccccccEEEEEEEEEEcccccEEEEEEEcccccccEEEEEcccEEEEEEEEcccccccEEEEccccccccccccccccccccccccccEEEEEEEEccccEEEccccccccccc
cccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccHHHccccccccEEEEEEEEEEEEccccHHccccccccccEEccccccccccEcEEEEEEccEcccccEEEEcccEEEEEEEEccccccEcEEEEcccccccHHHcccEcccEccEccccEEEEEEEccccEEEEEcccccccccc
MNLHKVTSETVsetsldqstAASWWAsaslkpafpdvagdpffaapdplapapqisetlnpsfgsssnptypdlgytsldfdtrgldvlrgnaelsspeECARAcregeppklcyyhFTLELYTVLGAAcqlctpnatntvWSHCQCVLADGVERGILAVnrmlpgpsiqvcegdrVVVDVRNsmdglentihwhgihqrgtqysdgvpfvtqcpitqgntfryqftanagthfwhahtgcpmsek
mnlhkvtsetvsetsldqsTAASWWASASLKPAFPDVAGDPFFAAPDPLAPAPQISETLNPSFGSSSNPTYPDLGYTSLDFDTRGLDVLRGNAELSSPEECARACREGEPPKLCYYHFTLELYTVLGAACQLCTPNATNTVWSHCQCVLADGVERGILAVNRMLpgpsiqvcegdRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFTANAGTHFWHAHTGCPMSEK
MNLHKVTSETVSETSLDQstaaswwasasLKpafpdvagdpffaapdplapapQISETLNPSFGSSSNPTYPDLGYTSLDFDTRGLDVLRGNAELSSPEECARACREGEPPKLCYYHFTLELYTVLGAACQLCTPNATNTVWSHCQCVLADGVERGILAVNRMLPGPSIQVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFTANAGTHFWHAHTGCPMSEK
***********************WWASASLKPAFPDVA***********************************LGYTSLDFDTRGLDVLR**************C****PPKLCYYHFTLELYTVLGAACQLCTPNATNTVWSHCQCVLADGVERGILAVNRMLPGPSIQVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFTANAGTHFWHAHTGC*****
******************************************************ISETLNPSFG**********GYTSLDFDTRGLDVLRGNAELSSPEECARACREGEPPKLCYYHFTLELYTVLGAACQLCTPNATNTVWSHCQCVLADGVERGILAVNRMLPGPSIQVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFTANAGTHFWHAHTGCPMS**
**********************SWWASASLKPAFPDVAGDPFFAAPDPLAPAPQISETLNPSFGSSSNPTYPDLGYTSLDFDTRGLDVLRGNA************REGEPPKLCYYHFTLELYTVLGAACQLCTPNATNTVWSHCQCVLADGVERGILAVNRMLPGPSIQVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFTANAGTHFWHAHTGCPMSEK
***************************************************************************YTS*DFDTRGLDVLRGNAELSSPEECARACREGEPPKLCYYHFTLELYTVLGAACQLCTPNATNTVWSHCQCVLADGVERGILAVNRMLPGPSIQVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFTANAGTHFWHAHT*C**S**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNLHKVTSETVSETSLDQSTAASWWASASLKPAFPDVAGDPFFAAPDPLAPAPQISETLNPSFGSSSNPTYPDLGYTSLDFDTRGLDVLRGNAELSSPEECARACREGEPPKLCYYHFTLELYTVLGAACQLCTPNATNTVWSHCQCVLADGVERGILAVNRMLPGPSIQVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFTANAGTHFWHAHTGCPMSEK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query246 2.2.26 [Sep-21-2011]
P14133 587 L-ascorbate oxidase OS=Cu N/A N/A 0.382 0.160 0.442 7e-17
Q941X2 567 Laccase-3 OS=Oryza sativa no N/A 0.333 0.144 0.494 2e-16
Q96WT3 635 Iron transport multicoppe yes N/A 0.365 0.141 0.430 2e-16
P37064 552 L-ascorbate oxidase OS=Cu N/A N/A 0.369 0.164 0.445 4e-16
P24792 579 L-ascorbate oxidase OS=Cu N/A N/A 0.369 0.157 0.445 5e-16
A2Y9C5 590 Putative laccase-19 OS=Or N/A N/A 0.337 0.140 0.5 5e-16
P38993 636 Iron transport multicoppe yes N/A 0.365 0.141 0.440 5e-16
Q2R0L2 590 Laccase-19 OS=Oryza sativ no N/A 0.337 0.140 0.5 6e-16
Q9ZPY2 569 Laccase-6 OS=Arabidopsis no N/A 0.483 0.209 0.363 7e-16
Q8RYM9 562 Laccase-2 OS=Oryza sativa no N/A 0.341 0.149 0.471 8e-16
>sp|P14133|ASO_CUCSA L-ascorbate oxidase OS=Cucumis sativus PE=1 SV=1 Back     alignment and function desciption
 Score = 87.4 bits (215), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 58/95 (61%), Gaps = 1/95 (1%)

Query: 151 DGVERGILAVNRMLPGPSIQVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPF 210
           D VE  ++ +N   PGP+I+   GD VVV++ N +      IHWHGI QRGT ++DG   
Sbjct: 53  DCVENIVMGINGEFPGPTIRANAGDIVVVELTNKLHTEGVVIHWHGILQRGTPWADGTAS 112

Query: 211 VTQCPITQGNTFRYQFTAN-AGTHFWHAHTGCPMS 244
           ++QC I  G TF Y+F  + AGT+F+H H G   S
Sbjct: 113 ISQCAINPGETFTYRFVVDKAGTYFYHGHLGMQRS 147
May be involved in a redox system involving ascorbic acid.
Cucumis sativus (taxid: 3659)
EC: 1EC: .EC: 1EC: 0EC: .EC: 3EC: .EC: 3
>sp|Q941X2|LAC3_ORYSJ Laccase-3 OS=Oryza sativa subsp. japonica GN=LAC3 PE=2 SV=1 Back     alignment and function description
>sp|Q96WT3|FET3_CANGA Iron transport multicopper oxidase FET3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FET3 PE=3 SV=1 Back     alignment and function description
>sp|P37064|ASO_CUCPM L-ascorbate oxidase OS=Cucurbita pepo var. melopepo PE=1 SV=1 Back     alignment and function description
>sp|P24792|ASO_CUCMA L-ascorbate oxidase OS=Cucurbita maxima GN=AAO PE=1 SV=2 Back     alignment and function description
>sp|A2Y9C5|LAC19_ORYSI Putative laccase-19 OS=Oryza sativa subsp. indica GN=LAC19 PE=3 SV=1 Back     alignment and function description
>sp|P38993|FET3_YEAST Iron transport multicopper oxidase FET3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FET3 PE=1 SV=2 Back     alignment and function description
>sp|Q2R0L2|LAC19_ORYSJ Laccase-19 OS=Oryza sativa subsp. japonica GN=LAC19 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZPY2|LAC6_ARATH Laccase-6 OS=Arabidopsis thaliana GN=LAC6 PE=2 SV=1 Back     alignment and function description
>sp|Q8RYM9|LAC2_ORYSJ Laccase-2 OS=Oryza sativa subsp. japonica GN=LAC2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query246
193579938 749 PREDICTED: laccase-5-like [Acyrthosiphon 0.943 0.309 0.646 3e-86
325302576 729 laccase 2 [Megacopta punctatissima] 0.894 0.301 0.694 1e-83
295292761 729 laccase 2 [Nephotettix cincticeps] 0.934 0.315 0.665 3e-83
325302574 725 laccase 2 [Riptortus pedestris] 0.898 0.304 0.672 3e-83
312373563 795 hypothetical protein AND_17284 [Anophele 0.902 0.279 0.623 3e-81
61658224 753 laccase-2 isoform A [Anopheles gambiae] 0.963 0.314 0.594 4e-81
61658226 755 laccase-2 isoform B [Anopheles gambiae] 0.963 0.313 0.594 4e-81
158295492 754 AGAP006176-PB [Anopheles gambiae str. PE 0.939 0.306 0.613 4e-81
158295490 756 AGAP006176-PA [Anopheles gambiae str. PE 0.939 0.305 0.613 5e-81
63079853 747 laccase-like multicopper oxidase 1 [Aede 0.922 0.303 0.604 5e-78
>gi|193579938|ref|XP_001950788.1| PREDICTED: laccase-5-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  323 bits (829), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 157/243 (64%), Positives = 186/243 (76%), Gaps = 11/243 (4%)

Query: 5   KVTSETVSETSLDQSTAASWWASASLKPAFPDVAGDPFFAAPDPLAPAPQISETLNPS-- 62
           +V   T  E++ DQ+TA S+W    ++ A  D +    +  P+   P+       +P+  
Sbjct: 45  RVKKRTGGESN-DQATAESYWTPGHVQGAQEDESA---YTQPEDYFPSAHGLVQTHPATF 100

Query: 63  --FGS---SSNPTYPDLGYTSLDFDTRGLDVLRGNAELSSPEECARACREGEPPKLCYYH 117
             FGS   SS+   P LGY+SLDFD RGLD LR N ELSSPEECARACREGEPP++CYYH
Sbjct: 101 SGFGSISESSHGNLPPLGYSSLDFDKRGLDELRKNPELSSPEECARACREGEPPRICYYH 160

Query: 118 FTLELYTVLGAACQLCTPNATNTVWSHCQCVLADGVERGILAVNRMLPGPSIQVCEGDRV 177
           FT ELY VLGAACQ+CTPNATNT+WSHCQC+LADGVERG+LAVNRMLPGPSIQVCEGD+V
Sbjct: 161 FTAELYNVLGAACQVCTPNATNTLWSHCQCILADGVERGMLAVNRMLPGPSIQVCEGDKV 220

Query: 178 VVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFTANAGTHFWHA 237
           V+DV N M G+E  IHWHGIHQ+GTQY DGVP+VTQCPI +GNTFRYQF  N+GTHFWHA
Sbjct: 221 VIDVLNHMHGMELVIHWHGIHQKGTQYYDGVPYVTQCPIHEGNTFRYQFDTNSGTHFWHA 280

Query: 238 HTG 240
           H+G
Sbjct: 281 HSG 283

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|325302576|dbj|BAJ83488.1| laccase 2 [Megacopta punctatissima] Back     alignment and taxonomy information
>gi|295292761|dbj|BAJ06133.1| laccase 2 [Nephotettix cincticeps] Back     alignment and taxonomy information
>gi|325302574|dbj|BAJ83487.1| laccase 2 [Riptortus pedestris] Back     alignment and taxonomy information
>gi|312373563|gb|EFR21278.1| hypothetical protein AND_17284 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|61658224|gb|AAX49501.1| laccase-2 isoform A [Anopheles gambiae] Back     alignment and taxonomy information
>gi|61658226|gb|AAX49502.1| laccase-2 isoform B [Anopheles gambiae] Back     alignment and taxonomy information
>gi|158295492|ref|XP_001688810.1| AGAP006176-PB [Anopheles gambiae str. PEST] gi|157016064|gb|EDO63816.1| AGAP006176-PB [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|158295490|ref|XP_316236.4| AGAP006176-PA [Anopheles gambiae str. PEST] gi|157016063|gb|EAA11473.4| AGAP006176-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|63079853|gb|AAY29698.1| laccase-like multicopper oxidase 1 [Aedes aegypti] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query246
FB|FBgn0259247 784 laccase2 "laccase 2" [Drosophi 0.691 0.216 0.768 1.2e-74
FB|FBgn0032116 959 Mco1 "Multicopper oxidase-1" [ 0.593 0.152 0.523 4.7e-39
FB|FBgn0039387 677 MCO3 "multicopper oxidase 3" [ 0.707 0.257 0.370 3.8e-27
FB|FBgn0052557 645 CG32557 [Drosophila melanogast 0.552 0.210 0.394 5.6e-23
ASPGD|ASPL0000035520 570 lccB [Emericella nidulans (tax 0.455 0.196 0.444 1.6e-19
TAIR|locus:2178973 573 AT5G21100 [Arabidopsis thalian 0.390 0.167 0.432 7e-19
UNIPROTKB|G4NBF8 747 MGG_17429 "Uncharacterized pro 0.520 0.171 0.4 5.2e-18
SGD|S000004662 636 FET3 "Ferro-O2-oxidoreductase" 0.463 0.179 0.401 1.1e-17
TAIR|locus:2135242 582 AT4G39830 [Arabidopsis thalian 0.365 0.154 0.439 6.4e-17
TAIR|locus:505006625 588 AT5G21105 [Arabidopsis thalian 0.373 0.156 0.453 8.4e-17
FB|FBgn0259247 laccase2 "laccase 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 753 (270.1 bits), Expect = 1.2e-74, P = 1.2e-74
 Identities = 133/173 (76%), Positives = 146/173 (84%)

Query:    68 NPTYPDLGYTSLDFDTRGLDVLRGNAELSSPEECARACREGEPPKLCYYHFTLELYTVLG 127
             NP  P   +  LDF T     LR N  LS+P+ECARACREGEPP++CYYHFTLE YTVLG
Sbjct:   150 NPKSP---FRHLDFSTSATAELRRNPALSAPDECARACREGEPPRICYYHFTLEYYTVLG 206

Query:   128 AACQLCTPNATNTVWSHCQCVLADGVERGILAVNRMLPGPSIQVCEGDRVVVDVRNSMDG 187
             AACQ+CTPNATNTVWSHCQCVLADGVERGIL  NRM+PGPSIQVCE D+VV+DV N M+G
Sbjct:   207 AACQVCTPNATNTVWSHCQCVLADGVERGILTANRMIPGPSIQVCENDKVVIDVENHMEG 266

Query:   188 LENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFTANAGTHFWHAHTG 240
             +E TIHWHGI QRG+QY DGVPFVTQCPI QGNTFRYQ+T NAGTHFWHAHTG
Sbjct:   267 MEVTIHWHGIWQRGSQYYDGVPFVTQCPIQQGNTFRYQWTGNAGTHFWHAHTG 319
GO:0052716 "hydroquinone:oxygen oxidoreductase activity" evidence=ISS
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005507 "copper ion binding" evidence=IEA
GO:0040003 "chitin-based cuticle development" evidence=IMP
FB|FBgn0032116 Mco1 "Multicopper oxidase-1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0039387 MCO3 "multicopper oxidase 3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0052557 CG32557 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ASPGD|ASPL0000035520 lccB [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
TAIR|locus:2178973 AT5G21100 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|G4NBF8 MGG_17429 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
SGD|S000004662 FET3 "Ferro-O2-oxidoreductase" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
TAIR|locus:2135242 AT4G39830 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006625 AT5G21105 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query246
pfam07732119 pfam07732, Cu-oxidase_3, Multicopper oxidase 6e-38
TIGR03388 541 TIGR03388, ascorbase, L-ascorbate oxidase, plant t 7e-26
PLN02191 574 PLN02191, PLN02191, L-ascorbate oxidase 3e-22
TIGR03389 539 TIGR03389, laccase, laccase, plant 3e-22
PLN02604 566 PLN02604, PLN02604, oxidoreductase 1e-21
TIGR03390 538 TIGR03390, ascorbOXfungal, L-ascorbate oxidase, fu 7e-16
COG2132 451 COG2132, SufI, Putative multicopper oxidases [Seco 1e-15
TIGR01480 587 TIGR01480, copper_res_A, copper-resistance protein 1e-13
PLN02354 552 PLN02354, PLN02354, copper ion binding / oxidoredu 2e-10
PLN02792 536 PLN02792, PLN02792, oxidoreductase 1e-09
PLN00044 596 PLN00044, PLN00044, multi-copper oxidase-related p 3e-08
PRK10965 523 PRK10965, PRK10965, multicopper oxidase; Provision 6e-08
PLN02835 539 PLN02835, PLN02835, oxidoreductase 3e-07
PLN02168 545 PLN02168, PLN02168, copper ion binding / pectinest 1e-05
PLN02991 543 PLN02991, PLN02991, oxidoreductase 3e-05
>gnl|CDD|219542 pfam07732, Cu-oxidase_3, Multicopper oxidase Back     alignment and domain information 
 Score =  128 bits (324), Expect = 6e-38
 Identities = 50/96 (52%), Positives = 66/96 (68%), Gaps = 5/96 (5%)

Query: 148 VLADGVERGILAVNRMLPGPSIQVCEGDRVVVDVRNSMDGLENT-IHWHGIHQRGTQYSD 206
           V   G  R ++ VN   PGP+I+V EGD VVV+V N++D  E T IHWHG+ Q GT ++D
Sbjct: 7   VTPLGGTRQVIGVNGQFPGPTIRVREGDTVVVNVTNNLD--EPTTIHWHGLRQPGTPWAD 64

Query: 207 GVPFVTQCPITQGNTFRYQFTAN--AGTHFWHAHTG 240
           GVP VTQCPI  G +F Y+FT    AGT+++H+HT 
Sbjct: 65  GVPGVTQCPIPPGESFTYRFTVKQQAGTYWYHSHTS 100

This entry contains many divergent copper oxidase-like domains that are not recognised by the pfam00394 model. Length = 119
>gnl|CDD|234193 TIGR03388, ascorbase, L-ascorbate oxidase, plant type Back     alignment and domain information
>gnl|CDD|177843 PLN02191, PLN02191, L-ascorbate oxidase Back     alignment and domain information
>gnl|CDD|234194 TIGR03389, laccase, laccase, plant Back     alignment and domain information
>gnl|CDD|215324 PLN02604, PLN02604, oxidoreductase Back     alignment and domain information
>gnl|CDD|132431 TIGR03390, ascorbOXfungal, L-ascorbate oxidase, fungal type Back     alignment and domain information
>gnl|CDD|225043 COG2132, SufI, Putative multicopper oxidases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|233432 TIGR01480, copper_res_A, copper-resistance protein, CopA family Back     alignment and domain information
>gnl|CDD|177987 PLN02354, PLN02354, copper ion binding / oxidoreductase Back     alignment and domain information
>gnl|CDD|178389 PLN02792, PLN02792, oxidoreductase Back     alignment and domain information
>gnl|CDD|165622 PLN00044, PLN00044, multi-copper oxidase-related protein; Provisional Back     alignment and domain information
>gnl|CDD|236810 PRK10965, PRK10965, multicopper oxidase; Provisional Back     alignment and domain information
>gnl|CDD|178429 PLN02835, PLN02835, oxidoreductase Back     alignment and domain information
>gnl|CDD|215113 PLN02168, PLN02168, copper ion binding / pectinesterase Back     alignment and domain information
>gnl|CDD|215536 PLN02991, PLN02991, oxidoreductase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 246
PLN02354 552 copper ion binding / oxidoreductase 99.98
PLN02835 539 oxidoreductase 99.98
PLN02168 545 copper ion binding / pectinesterase 99.98
PLN02991 543 oxidoreductase 99.97
PLN02792 536 oxidoreductase 99.97
PLN00044 596 multi-copper oxidase-related protein; Provisional 99.97
TIGR03389 539 laccase laccase, plant. Members of this protein fa 99.97
TIGR03390 538 ascorbOXfungal L-ascorbate oxidase, fungal type. T 99.97
PLN02191 574 L-ascorbate oxidase 99.97
PF07732117 Cu-oxidase_3: Multicopper oxidase; InterPro: IPR01 99.97
TIGR03388 541 ascorbase L-ascorbate oxidase, plant type. Members 99.97
KOG1263|consensus 563 99.96
PLN02604 566 oxidoreductase 99.96
TIGR01480 587 copper_res_A copper-resistance protein, CopA famil 99.94
PRK10965 523 multicopper oxidase; Provisional 99.91
PRK10883 471 FtsI repressor; Provisional 99.89
TIGR02376 311 Cu_nitrite_red nitrite reductase, copper-containin 99.87
COG2132 451 SufI Putative multicopper oxidases [Secondary meta 99.78
TIGR01480587 copper_res_A copper-resistance protein, CopA famil 99.66
TIGR03095148 rusti_cyanin rusticyanin. Rusticyanin is a blue co 99.65
TIGR03096135 nitroso_cyanin nitrosocyanin. Nitrosocyanin, as de 99.09
PF07731138 Cu-oxidase_2: Multicopper oxidase; InterPro: IPR01 98.85
COG2132451 SufI Putative multicopper oxidases [Secondary meta 98.23
PRK10965523 multicopper oxidase; Provisional 98.02
PLN02835539 oxidoreductase 98.01
TIGR03388541 ascorbase L-ascorbate oxidase, plant type. Members 97.91
TIGR02376311 Cu_nitrite_red nitrite reductase, copper-containin 97.9
TIGR03389539 laccase laccase, plant. Members of this protein fa 97.86
PLN02604566 oxidoreductase 97.82
PLN02168545 copper ion binding / pectinesterase 97.68
PRK02888635 nitrous-oxide reductase; Validated 97.68
PF13473104 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 97.65
PLN02354552 copper ion binding / oxidoreductase 97.58
TIGR03390538 ascorbOXfungal L-ascorbate oxidase, fungal type. T 97.55
PLN02191574 L-ascorbate oxidase 97.51
PLN02792536 oxidoreductase 97.5
PLN02991543 oxidoreductase 97.47
PF00394159 Cu-oxidase: Multicopper oxidase; InterPro: IPR0011 97.37
PRK10883471 FtsI repressor; Provisional 97.35
TIGR0265699 cyanin_plasto plastocyanin. Members of this family 97.24
TIGR0265783 amicyanin amicyanin. Members of this family are am 97.23
PLN00044596 multi-copper oxidase-related protein; Provisional 97.16
PF0012799 Copper-bind: Copper binding proteins, plastocyanin 96.81
KOG1263|consensus563 96.46
PRK02710119 plastocyanin; Provisional 96.29
TIGR03102115 halo_cynanin halocyanin domain. Halocyanins are bl 94.99
PF06525196 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Memb 93.6
TIGR03094195 sulfo_cyanin sulfocyanin. Members of this family a 93.33
TIGR02375116 pseudoazurin pseudoazurin. Pseudoazurin, also call 92.75
PF00116120 COX2: Cytochrome C oxidase subunit II, periplasmic 91.36
COG3794128 PetE Plastocyanin [Energy production and conversio 89.72
>PLN02354 copper ion binding / oxidoreductase Back     alignment and domain information 
Probab=99.98  E-value=1.9e-32  Score=269.55  Aligned_cols=109  Identities=30%  Similarity=0.638  Sum_probs=101.6

Q ss_pred             ceEEEEEEEeEEEEecccccccCCCCccceeeeeeEEeCCCeEEEEEEEcCCCCCCeEEEecCCEEEEEEEeCCCCCCce
Q psy12112        112 KLCYYHFTLELYTVLGAACQLCTPNATNTVWSHCQCVLADGVERGILAVNRMLPGPSIQVCEGDRVVVDVRNSMDGLENT  191 (246)
Q Consensus       112 r~c~~~~~ie~~~~~~~~~~~~~~~~t~~~~~~~~~v~~DG~~r~v~tiNGq~PGPtI~v~~GD~V~V~V~N~l~~~~ts  191 (246)
                      ++.+|+|++.+..                       ..+||++|.+++|||++|||+|++++||+|+|+|+|+|+ ++++
T Consensus        26 ~~~~y~~~v~~~~-----------------------~~pdG~~r~~~~iNGq~PGP~I~~~~GD~v~V~v~N~l~-~~tt   81 (552)
T PLN02354         26 PYFFFTWNVTYGT-----------------------ASPLGVPQQVILINGQFPGPNINSTSNNNIVINVFNNLD-EPFL   81 (552)
T ss_pred             cEEEEEEEEEEEE-----------------------ecCCCeEEEEEEECCCCcCCcEEEeCCCEEEEEEEECCC-CCcc
Confidence            4567888887654                       258999999999999999999999999999999999998 8999


Q ss_pred             eEeecccCCCCCCCCCCccccccccCCCCEEEEEEe--cCCcccEEccCCCCCCCC
Q psy12112        192 IHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT--ANAGTHFWHAHTGCPMSE  245 (246)
Q Consensus       192 IHwHGl~q~~t~~~DGvp~vTqcpI~PGes~tY~F~--~q~GT~WYHsH~~~Q~~d  245 (246)
                      |||||++|++++||||+|+ |||||+||++|+|+|+  +++||||||||++.|++|
T Consensus        82 iHWHGi~q~~~~~~DGv~~-TQcpI~PG~sf~Y~F~~~~q~GT~WYHsH~~~Q~~~  136 (552)
T PLN02354         82 LTWSGIQQRKNSWQDGVPG-TNCPIPPGTNFTYHFQPKDQIGSYFYYPSTGMHRAA  136 (552)
T ss_pred             cccccccCCCCcccCCCcC-CcCCCCCCCcEEEEEEeCCCCcceEEecCccceecC
Confidence            9999999999999999999 9999999999999999  699999999999999986

>PLN02835 oxidoreductase Back     alignment and domain information
>PLN02168 copper ion binding / pectinesterase Back     alignment and domain information
>PLN02991 oxidoreductase Back     alignment and domain information
>PLN02792 oxidoreductase Back     alignment and domain information
>PLN00044 multi-copper oxidase-related protein; Provisional Back     alignment and domain information
>TIGR03389 laccase laccase, plant Back     alignment and domain information
>TIGR03390 ascorbOXfungal L-ascorbate oxidase, fungal type Back     alignment and domain information
>PLN02191 L-ascorbate oxidase Back     alignment and domain information
>PF07732 Cu-oxidase_3: Multicopper oxidase; InterPro: IPR011707 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties Back     alignment and domain information
>TIGR03388 ascorbase L-ascorbate oxidase, plant type Back     alignment and domain information
>KOG1263|consensus Back     alignment and domain information
>PLN02604 oxidoreductase Back     alignment and domain information
>TIGR01480 copper_res_A copper-resistance protein, CopA family Back     alignment and domain information
>PRK10965 multicopper oxidase; Provisional Back     alignment and domain information
>PRK10883 FtsI repressor; Provisional Back     alignment and domain information
>TIGR02376 Cu_nitrite_red nitrite reductase, copper-containing Back     alignment and domain information
>COG2132 SufI Putative multicopper oxidases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR01480 copper_res_A copper-resistance protein, CopA family Back     alignment and domain information
>TIGR03095 rusti_cyanin rusticyanin Back     alignment and domain information
>TIGR03096 nitroso_cyanin nitrosocyanin Back     alignment and domain information
>PF07731 Cu-oxidase_2: Multicopper oxidase; InterPro: IPR011706 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties Back     alignment and domain information
>COG2132 SufI Putative multicopper oxidases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK10965 multicopper oxidase; Provisional Back     alignment and domain information
>PLN02835 oxidoreductase Back     alignment and domain information
>TIGR03388 ascorbase L-ascorbate oxidase, plant type Back     alignment and domain information
>TIGR02376 Cu_nitrite_red nitrite reductase, copper-containing Back     alignment and domain information
>TIGR03389 laccase laccase, plant Back     alignment and domain information
>PLN02604 oxidoreductase Back     alignment and domain information
>PLN02168 copper ion binding / pectinesterase Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF13473 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 1IC0_E 1IBY_D Back     alignment and domain information
>PLN02354 copper ion binding / oxidoreductase Back     alignment and domain information
>TIGR03390 ascorbOXfungal L-ascorbate oxidase, fungal type Back     alignment and domain information
>PLN02191 L-ascorbate oxidase Back     alignment and domain information
>PLN02792 oxidoreductase Back     alignment and domain information
>PLN02991 oxidoreductase Back     alignment and domain information
>PF00394 Cu-oxidase: Multicopper oxidase; InterPro: IPR001117 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties Back     alignment and domain information
>PRK10883 FtsI repressor; Provisional Back     alignment and domain information
>TIGR02656 cyanin_plasto plastocyanin Back     alignment and domain information
>TIGR02657 amicyanin amicyanin Back     alignment and domain information
>PLN00044 multi-copper oxidase-related protein; Provisional Back     alignment and domain information
>PF00127 Copper-bind: Copper binding proteins, plastocyanin/azurin family; InterPro: IPR000923 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ] Back     alignment and domain information
>KOG1263|consensus Back     alignment and domain information
>PRK02710 plastocyanin; Provisional Back     alignment and domain information
>TIGR03102 halo_cynanin halocyanin domain Back     alignment and domain information
>PF06525 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Members of this family are blue-copper redox proteins designated sulfocyanin, from the archaeal genera Sulfolobus, Ferroplasma, and Picrophilus Back     alignment and domain information
>TIGR03094 sulfo_cyanin sulfocyanin Back     alignment and domain information
>TIGR02375 pseudoazurin pseudoazurin Back     alignment and domain information
>PF00116 COX2: Cytochrome C oxidase subunit II, periplasmic domain This family corresponds to chains b and o Back     alignment and domain information
>COG3794 PetE Plastocyanin [Energy production and conversion] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query246
1aoz_A 552 Refined Crystal Structure Of Ascorbate Oxidase At 1 3e-17
1zpu_A 534 Crystal Structure Of Fet3p, A Multicopper Oxidase T 3e-17
3kw7_A 502 Crystal Structure Of Lacb From Trametes Sp. Ah28-2 3e-16
2qt6_A 498 Crystal Structure Determination Of A Blue Laccase F 4e-16
3g5w_A 318 Crystal Structure Of Blue Copper Oxidase From Nitro 7e-16
3sqr_A 580 Crystal Structure Of Laccase From Botrytis Aclada A 8e-16
3v9e_A 580 Structure Of The L513m Mutant Of The Laccase From B 8e-16
2hzh_A 499 Crystal Structure Of Laccase From Coriolus Zonatus 2e-15
4a2f_A 497 Coriolopsis Gallica Laccase Collected At 12.65 Kev 9e-15
4a2d_A 496 Coriolopsis Gallica Laccase T2 Copper Depleted At P 9e-15
2hrg_A 496 Crystal Structure Of Blue Laccase From Trametes Tro 1e-14
1gyc_A 499 Crystal Structure Determination At Room Temperature 1e-14
1kya_A 499 Active Laccase From Trametes Versicolor Complexed W 2e-14
2h5u_A 499 Crystal Structure Of Laccase From Cerrena Maxima At 4e-14
2xyb_A 497 Crystal Structure Of A Fully Functional Laccase Fro 4e-14
3pxl_A 499 Type-2 Cu-Depleted Fungus Laccase From Trametes Hir 4e-14
3fpx_A 499 Native Fungus Laccase From Trametes Hirsuta Length 4e-14
3div_A 499 Crystal Structure Of Laccase From Cerrena Maxima At 5e-14
1hfu_A 503 Type-2 Cu-Depleted Laccase From Coprinus Cinereus A 3e-13
1a65_A 504 Type-2 Cu-depleted Laccase From Coprinus Cinereus L 3e-13
3t6v_A 495 Crystal Structure Of Laccase From Steccherinum Ochr 5e-13
3pps_A 604 Crystal Structure Of An Ascomycete Fungal Laccase F 3e-10
3dkh_A 559 L559a Mutant Of Melanocarpus Albomyces Laccase Leng 1e-09
1gw0_A 559 Crystal Structure Of Laccase From Melanocarpus Albo 1e-09
2q9o_A 559 Near-Atomic Resolution Structure Of A Melanocarpus 1e-08
1v10_A 521 Structure Of Rigidoporus Lignosus Laccase From Hemi 7e-08
3zx1_A 481 Multicopper Oxidase From Campylobacter Jejuni: A Me 9e-07
3gdc_A 288 Crystal Structure Of Multicopper Oxidase Length = 2 1e-06
>pdb|1AOZ|A Chain A, Refined Crystal Structure Of Ascorbate Oxidase At 1.9 Angstroms Resolution Length = 552 Back     alignment and structure 
Iteration: 1

 Score = 85.1 bits (209), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 53/88 (60%), Gaps = 1/88 (1%)
Query: 154 ERGILAVNRMLPGPSIQVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQ 213
           E  ++ +N   PGP+I+   GD VVV++ N +      IHWHGI QRGT ++DG   ++Q
Sbjct: 21  ENIVMGINGQFPGPTIRANAGDSVVVELTNKLHTEGVVIHWHGILQRGTPWADGTASISQ 80
Query: 214 CPITQGNTFRYQFTA-NAGTHFWHAHTG 240
           C I  G TF Y FT  N GT F+H H G
Sbjct: 81  CAINPGETFFYNFTVDNPGTFFYHGHLG 108
>pdb|1ZPU|A Chain A, Crystal Structure Of Fet3p, A Multicopper Oxidase That Functions In Iron Import Length = 534 Back     alignment and structure
>pdb|3KW7|A Chain A, Crystal Structure Of Lacb From Trametes Sp. Ah28-2 Length = 502 Back     alignment and structure
>pdb|2QT6|A Chain A, Crystal Structure Determination Of A Blue Laccase From Lentinus Tigrinus Length = 498 Back     alignment and structure
>pdb|3G5W|A Chain A, Crystal Structure Of Blue Copper Oxidase From Nitrosomonas Europaea Length = 318 Back     alignment and structure
>pdb|3SQR|A Chain A, Crystal Structure Of Laccase From Botrytis Aclada At 1.67 A Resolution Length = 580 Back     alignment and structure
>pdb|3V9E|A Chain A, Structure Of The L513m Mutant Of The Laccase From B.aclada Length = 580 Back     alignment and structure
>pdb|2HZH|A Chain A, Crystal Structure Of Laccase From Coriolus Zonatus At 2.6 A Resolution Length = 499 Back     alignment and structure
>pdb|4A2F|A Chain A, Coriolopsis Gallica Laccase Collected At 12.65 Kev Length = 497 Back     alignment and structure
>pdb|4A2D|A Chain A, Coriolopsis Gallica Laccase T2 Copper Depleted At Ph 4.5 Length = 496 Back     alignment and structure
>pdb|2HRG|A Chain A, Crystal Structure Of Blue Laccase From Trametes Trogii Complexed With P-Methylbenzoate Length = 496 Back     alignment and structure
>pdb|1GYC|A Chain A, Crystal Structure Determination At Room Temperature Of A Laccase From Trametes Versicolor In Its Oxidised Form Containing A Full Complement Of Copper Ions Length = 499 Back     alignment and structure
>pdb|1KYA|A Chain A, Active Laccase From Trametes Versicolor Complexed With 2,5-Xylidine Length = 499 Back     alignment and structure
>pdb|2H5U|A Chain A, Crystal Structure Of Laccase From Cerrena Maxima At 1.9a Resolution Length = 499 Back     alignment and structure
>pdb|2XYB|A Chain A, Crystal Structure Of A Fully Functional Laccase From The Ligninolytic Fungus Pycnoporus Cinnabarinus Length = 497 Back     alignment and structure
>pdb|3PXL|A Chain A, Type-2 Cu-Depleted Fungus Laccase From Trametes Hirsuta Length = 499 Back     alignment and structure
>pdb|3FPX|A Chain A, Native Fungus Laccase From Trametes Hirsuta Length = 499 Back     alignment and structure
>pdb|3DIV|A Chain A, Crystal Structure Of Laccase From Cerrena Maxima At 1.76a Resolution Length = 499 Back     alignment and structure
>pdb|1HFU|A Chain A, Type-2 Cu-Depleted Laccase From Coprinus Cinereus At 1.68 A Resolution Length = 503 Back     alignment and structure
>pdb|1A65|A Chain A, Type-2 Cu-depleted Laccase From Coprinus Cinereus Length = 504 Back     alignment and structure
>pdb|3T6V|A Chain A, Crystal Structure Of Laccase From Steccherinum Ochraceum Length = 495 Back     alignment and structure
>pdb|3PPS|A Chain A, Crystal Structure Of An Ascomycete Fungal Laccase From Thielavia Arenaria Length = 604 Back     alignment and structure
>pdb|3DKH|A Chain A, L559a Mutant Of Melanocarpus Albomyces Laccase Length = 559 Back     alignment and structure
>pdb|1GW0|A Chain A, Crystal Structure Of Laccase From Melanocarpus Albomyces In Four Copper Form Length = 559 Back     alignment and structure
>pdb|2Q9O|A Chain A, Near-Atomic Resolution Structure Of A Melanocarpus Albomyces Laccase Length = 559 Back     alignment and structure
>pdb|1V10|A Chain A, Structure Of Rigidoporus Lignosus Laccase From Hemihedrally Twinned Crystals Length = 521 Back     alignment and structure
>pdb|3ZX1|A Chain A, Multicopper Oxidase From Campylobacter Jejuni: A Metallo-Oxidase Length = 481 Back     alignment and structure
>pdb|3GDC|A Chain A, Crystal Structure Of Multicopper Oxidase Length = 288 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query246
3sqr_A 580 Laccase; multicopper oxidase, glycosylation, oxido 3e-48
1aoz_A 552 Ascorbate oxidase; oxidoreductase(oxygen acceptor) 3e-46
3g5w_A 318 Multicopper oxidase type 1; two domain, laccase, n 1e-44
2zwn_A 339 Two-domain type laccase; muticopper oxidase, oxido 5e-44
3t6v_A 495 Laccase; beta barrel, oxidoreductase; HET: CBS; 2. 3e-43
3pxl_A 499 Laccase; 4-copper protein, metal-binding, oxidored 5e-43
2q9o_A 559 Laccase-1; multicopper oxidase, 2-OXOH oxidoreduct 2e-41
1zpu_A 534 Iron transport multicopper oxidase FET3; ferroxida 3e-41
1v10_A 521 Laccase; multicopper blue oxidase, oxidase; 1.7A { 4e-40
1hfu_A 503 Laccase 1; oxidoreductase, blue multi-copper oxida 1e-39
3gdc_A 288 Multicopper oxidase; beta sandwich, plasmid, oxido 1e-26
2xu9_A 439 Laccase; oxidoreductase, multicopper oxidases; 1.5 1e-22
3zx1_A 481 Oxidoreductase, putative; laccase, metallo-oxidase 1e-21
3od3_A 488 Blue copper oxidase CUEO; multicopper oxidase, Cu( 2e-21
3aw5_A 448 Multicopper oxidase; beta barrel, oxidoreductase; 2e-20
3abg_A 534 Bilirubin oxidase; cleavage on PAIR of basic resid 4e-20
3kw8_A 276 Laccase, putative copper oxidase; two-domain lacca 1e-19
3cg8_A 343 Laccase; oxidoreductase, multicopper blue protein; 2e-19
2zoo_A 442 Probable nitrite reductase; electron transfer, ele 6e-18
1kbv_A 327 ANIA, major outer membrane protein PAN 1; ANIA[NO2 4e-17
2uxt_A 451 Protein SUFI, SUFI; oxidoreductase, periplasmic, c 5e-17
2r7e_A 742 Coagulation factor VIII; ceruloplasmin fold, cuppe 1e-16
2r7e_A 742 Coagulation factor VIII; ceruloplasmin fold, cuppe 8e-15
2dv6_A 447 Nitrite reductase; electron transfer, reduction, d 2e-16
2dv6_A 447 Nitrite reductase; electron transfer, reduction, d 1e-07
2bw4_A 340 Copper-containing nitrite reductase; oxidoreductas 4e-15
1sdd_A 306 Coagulation factor V; copper-binding protein, cofa 6e-15
1mzy_A 333 Copper-containing nitrite reductase; mutant M182T, 7e-15
2j5w_A 1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 1e-14
2j5w_A 1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 3e-13
2j5w_A 1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 2e-09
1oe1_A 336 Dissimilatory copper-containing nitrite reductase; 1e-13
2wsd_A 513 Spore coat protein A; oxidoreductase, multi-copper 1e-13
2g23_A 612 PHS, phenoxazinone synthase; copper, metalloprotei 8e-11
1sdd_B 647 Coagulation factor V; copper-binding protein, cofa 1e-09
>3sqr_A Laccase; multicopper oxidase, glycosylation, oxidoreductase; HET: NAG BMA MAN; 1.67A {Botrytis aclada} Length = 580 Back     alignment and structure
 Score =  166 bits (422), Expect = 3e-48
 Identities = 46/168 (27%), Positives = 77/168 (45%), Gaps = 10/168 (5%)

Query: 77  TSLDFDTRGLDVLRGNAELSSPEECARACREGEPPKLCYYHFTLEL--YTVLGAACQLC- 133
           T+L        +    + L+  +    +C      + C+  ++++   Y V         
Sbjct: 11  TALFAQASASAIPAVRSTLTPRQNTTASCANSATSRSCWGEYSIDTNWYDVTPTGVTREY 70

Query: 134 TPNATNTVWSHCQCVLADGVERGILAVNRMLPGPSIQVCEGDRVVVDVRNSMDGLENTIH 193
             +  N+  +       DG  R  +  N  +PGP+I    GD +++ V N+++    +IH
Sbjct: 71  WLSVENSTIT------PDGYTRSAMTFNGTVPGPAIIADWGDNLIIHVTNNLEHNGTSIH 124

Query: 194 WHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFTAN-AGTHFWHAHTG 240
           WHGI Q G+   DGVP VTQCPI  G+T  Y+F     GT ++H+H  
Sbjct: 125 WHGIRQLGSLEYDGVPGVTQCPIAPGDTLTYKFQVTQYGTTWYHSHFS 172
>1aoz_A Ascorbate oxidase; oxidoreductase(oxygen acceptor); HET: NAG; 1.90A {Cucurbita pepo var} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1aso_A* 1asp_A* 1asq_A* Length = 552 Back     alignment and structure
>3g5w_A Multicopper oxidase type 1; two domain, laccase, nitrifier, metal B protein; 1.90A {Nitrosomonas europaea} Length = 318 Back     alignment and structure
>2zwn_A Two-domain type laccase; muticopper oxidase, oxidoreductase; 1.70A {Metagenomes} Length = 339 Back     alignment and structure
>3t6v_A Laccase; beta barrel, oxidoreductase; HET: CBS; 2.00A {Steccherinum ochraceum} PDB: 3t6w_A* 3t6x_A* 3t6z_A* 3t71_A* Length = 495 Back     alignment and structure
>3pxl_A Laccase; 4-copper protein, metal-binding, oxidoreductase, type-2 Cu-D; HET: NAG BMA MAN; 1.20A {Trametes hirsuta} PDB: 3fpx_A* 3v9c_A* 3div_A* 2h5u_A* 2xyb_A* 1kya_A* 1gyc_A* 2qt6_A* 2hrg_A* 2hrh_A* 4a2f_A* 2vdz_A* 4a2d_A* 4a2e_A* 4a2g_A* 4a2h_A* 2ve0_A* 2vds_A* 2hzh_A* 3kw7_A* Length = 499 Back     alignment and structure
>2q9o_A Laccase-1; multicopper oxidase, 2-OXOH oxidoreductase; HET: OHI NAG MAN GOL; 1.30A {Melanocarpus albomyces} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 3fu7_A* 3fu8_A* 3fu7_B* 1gw0_A* 2ih9_A* 2ih8_A* 3fu9_A* 3qpk_A* 3dkh_A* 3pps_A* Length = 559 Back     alignment and structure
>1zpu_A Iron transport multicopper oxidase FET3; ferroxidase, oxidoreduc; HET: NAG BMA MAN NDG; 2.80A {Saccharomyces cerevisiae} Length = 534 Back     alignment and structure
>1v10_A Laccase; multicopper blue oxidase, oxidase; 1.7A {Rigidoporus lignosus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 Length = 521 Back     alignment and structure
>1hfu_A Laccase 1; oxidoreductase, blue multi-copper oxidase, type-2 copper depleted, signal, glycoprotein; HET: MAN NAG NDG; 1.68A {Coprinus cinereus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1a65_A* Length = 503 Back     alignment and structure
>3gdc_A Multicopper oxidase; beta sandwich, plasmid, oxidoreductase; 1.80A {Arthrobacter SP} Length = 288 Back     alignment and structure
>2xu9_A Laccase; oxidoreductase, multicopper oxidases; 1.50A {Thermus thermophilus} PDB: 2xuw_A 2xvb_A 2yae_A 2yaf_A 2yah_A 2yam_A 2yao_A 2yap_A 2yaq_A 2yar_A 4ai7_A Length = 439 Back     alignment and structure
>3zx1_A Oxidoreductase, putative; laccase, metallo-oxidase, cuprous oxidase; 1.95A {Campylobacter jejuni subsp} Length = 481 Back     alignment and structure
>3od3_A Blue copper oxidase CUEO; multicopper oxidase, Cu(I) oxidase, oxidoreductase; 1.10A {Escherichia coli} PDB: 1n68_A 2fqd_A* 2fqe_A* 2fqf_A* 2fqg_A* 3nsd_A 1kv7_A 3pau_A 3pav_A 3nsf_A 1pf3_A 3qqx_A 3nsc_A 3nt0_A 3uad_A 3uaa_A 3uac_A 3uab_A 3uae_A 3nsy_A ... Length = 488 Back     alignment and structure
>3aw5_A Multicopper oxidase; beta barrel, oxidoreductase; 2.00A {Pyrobaculum aerophilum} Length = 448 Back     alignment and structure
>3abg_A Bilirubin oxidase; cleavage on PAIR of basic residues, glyco metal-binding, oxidoreductase; HET: NAG BMA NDG; 2.30A {Myrothecium verrucaria} PDB: 2xll_A* Length = 534 Back     alignment and structure
>3kw8_A Laccase, putative copper oxidase; two-domain laccase, oxidoreductase, multicopper blue protein; HET: PG4 PGE; 2.29A {Streptomyces coelicolor} Length = 276 Back     alignment and structure
>3cg8_A Laccase; oxidoreductase, multicopper blue protein; HET: PG4; 2.68A {Streptomyces coelicolor} Length = 343 Back     alignment and structure
>2zoo_A Probable nitrite reductase; electron transfer, electron transport, heme, iron, binding, oxidoreductase, transport; HET: SUC HEM; 1.95A {Pseudoalteromonas haloplanktis} Length = 442 Back     alignment and structure
>1kbv_A ANIA, major outer membrane protein PAN 1; ANIA[NO2-], oxidoreductase; 1.95A {Neisseria gonorrhoeae} SCOP: b.6.1.3 b.6.1.3 PDB: 1kbw_A Length = 327 Back     alignment and structure
>2uxt_A Protein SUFI, SUFI; oxidoreductase, periplasmic, cupredoxin-like, FTS mutant suppressor; 1.90A {Escherichia coli} PDB: 2uxv_A Length = 451 Back     alignment and structure
>2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Length = 742 Back     alignment and structure
>2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Length = 742 Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Length = 447 Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Length = 447 Back     alignment and structure
>2bw4_A Copper-containing nitrite reductase; oxidoreductase, denitrification, catalysis, enzyme mechanism, nitrate assimilation; 0.90A {Achromobacter cycloclastes} SCOP: b.6.1.3 b.6.1.3 PDB: 1nib_A 1nia_A 1nid_A 1nie_A 1nic_A 1nif_A 2bw5_A 2bwd_A 2bwi_A 2nrd_A 2y1a_A 1kcb_A 1rzp_A* 1rzq_A 2avf_A 1as6_A 1aq8_A 1as7_A 1as8_A 2afn_A ... Length = 340 Back     alignment and structure
>1sdd_A Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 Length = 306 Back     alignment and structure
>1mzy_A Copper-containing nitrite reductase; mutant M182T, gating mechanism, electron oxidoreductase; 1.46A {Rhodobacter sphaeroides} SCOP: b.6.1.3 b.6.1.3 PDB: 1mzz_A 1n70_A 1zv2_A 2a3t_A 2dws_A 2dwt_A 2dy2_A Length = 333 Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Length = 1065 Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Length = 1065 Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Length = 1065 Back     alignment and structure
>1oe1_A Dissimilatory copper-containing nitrite reductase; denitrification; HET: PG4; 1.04A {Alcaligenes xylosoxidans} SCOP: b.6.1.3 b.6.1.3 PDB: 1oe3_A* 2xwz_A* 2vn3_A 2zon_A* 1haw_A 1hau_A* 2vm4_A* 2vw4_A* 2vw6_A* 2vw7_A* 2vm3_A* 1oe2_A* 2jl0_A* 2xx1_A 2xxg_A* 2xxf_A* 1gs8_A 1wa1_X* 1wa2_X* 2jl3_A* ... Length = 336 Back     alignment and structure
>2wsd_A Spore coat protein A; oxidoreductase, multi-copper oxidase, sporulation, COTA- LAC copper centre; 1.60A {Bacillus subtilis} PDB: 1gsk_A 1hkp_A 1hkz_A 1hl0_A 1hl1_A 1of0_A* 1ogr_A 1uvw_A* 1w6l_A 1w6w_A 1w8e_A 2bhf_A 2x87_A 2x88_A* 4a67_A 4akq_A 4a68_A* 4akp_A* 4a66_A 4ako_A Length = 513 Back     alignment and structure
>1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 Length = 647 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query246
3sqr_A 580 Laccase; multicopper oxidase, glycosylation, oxido 100.0
2q9o_A 559 Laccase-1; multicopper oxidase, 2-OXOH oxidoreduct 99.98
1aoz_A 552 Ascorbate oxidase; oxidoreductase(oxygen acceptor) 99.98
3t6v_A 495 Laccase; beta barrel, oxidoreductase; HET: CBS; 2. 99.97
3pxl_A 499 Laccase; 4-copper protein, metal-binding, oxidored 99.97
1zpu_A 534 Iron transport multicopper oxidase FET3; ferroxida 99.97
1v10_A 521 Laccase; multicopper blue oxidase, oxidase; 1.7A { 99.97
1hfu_A 503 Laccase 1; oxidoreductase, blue multi-copper oxida 99.96
3g5w_A 318 Multicopper oxidase type 1; two domain, laccase, n 99.96
2zwn_A 339 Two-domain type laccase; muticopper oxidase, oxido 99.95
3gdc_A 288 Multicopper oxidase; beta sandwich, plasmid, oxido 99.94
3zx1_A 481 Oxidoreductase, putative; laccase, metallo-oxidase 99.94
2uxt_A 451 Protein SUFI, SUFI; oxidoreductase, periplasmic, c 99.93
3gyr_A 612 PHS, phenoxazinone synthase; metalloprotein, lacca 99.92
3abg_A 534 Bilirubin oxidase; cleavage on PAIR of basic resid 99.92
3kw8_A 276 Laccase, putative copper oxidase; two-domain lacca 99.92
2wsd_A 513 Spore coat protein A; oxidoreductase, multi-copper 99.92
2xu9_A 439 Laccase; oxidoreductase, multicopper oxidases; 1.5 99.92
3od3_A 488 Blue copper oxidase CUEO; multicopper oxidase, Cu( 99.92
3t9w_A 299 Small laccase, multi-copper oxidase; two-domain co 99.92
3tas_A 313 Small laccase, multi-copper oxidase; two-domain la 99.91
3aw5_A 448 Multicopper oxidase; beta barrel, oxidoreductase; 99.9
2g23_A 612 PHS, phenoxazinone synthase; copper, metalloprotei 99.89
1mzy_A 333 Copper-containing nitrite reductase; mutant M182T, 99.89
1oe1_A 336 Dissimilatory copper-containing nitrite reductase; 99.87
1kbv_A 327 ANIA, major outer membrane protein PAN 1; ANIA[NO2 99.87
2zoo_A 442 Probable nitrite reductase; electron transfer, ele 99.87
2bw4_A 340 Copper-containing nitrite reductase; oxidoreductas 99.87
1sdd_A 306 Coagulation factor V; copper-binding protein, cofa 99.86
2j5w_A 1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 99.86
3cg8_A 343 Laccase; oxidoreductase, multicopper blue protein; 99.85
2r7e_A 742 Coagulation factor VIII; ceruloplasmin fold, cuppe 99.84
2r7e_B 770 Coagulation factor VIII; ceruloplasmin fold, cuppe 99.83
1sdd_B 647 Coagulation factor V; copper-binding protein, cofa 99.82
2r7e_A 742 Coagulation factor VIII; ceruloplasmin fold, cuppe 99.77
2dv6_A 447 Nitrite reductase; electron transfer, reduction, d 99.72
2j5w_A 1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 99.65
2dv6_A 447 Nitrite reductase; electron transfer, reduction, d 99.52
3cvb_A105 Plastocyanin; cupredoxin, SELF assembly, copper, e 99.41
3kw8_A276 Laccase, putative copper oxidase; two-domain lacca 99.41
1iby_A112 Nitrosocyanin; RED copper, cupredoxin, beta hairpi 99.27
3cg8_A343 Laccase; oxidoreductase, multicopper blue protein; 99.16
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 99.06
2cal_A154 Rusticyanin; iron respiratory electron transport c 99.06
2ov0_A105 Amicyanin; beta-sandwich, electron transport; 0.75 98.93
1sdd_A306 Coagulation factor V; copper-binding protein, cofa 98.92
1sdd_B 647 Coagulation factor V; copper-binding protein, cofa 98.88
3zx1_A481 Oxidoreductase, putative; laccase, metallo-oxidase 98.88
3t9w_A299 Small laccase, multi-copper oxidase; two-domain co 98.83
3g5w_A318 Multicopper oxidase type 1; two domain, laccase, n 98.81
3gdc_A288 Multicopper oxidase; beta sandwich, plasmid, oxido 98.77
3tas_A313 Small laccase, multi-copper oxidase; two-domain la 98.77
2xu9_A439 Laccase; oxidoreductase, multicopper oxidases; 1.5 98.7
2aan_A139 Auracyanin A; cupredoxin fold, electron transport; 98.7
2g23_A612 PHS, phenoxazinone synthase; copper, metalloprotei 98.69
1hfu_A503 Laccase 1; oxidoreductase, blue multi-copper oxida 98.67
2zwn_A339 Two-domain type laccase; muticopper oxidase, oxido 98.67
1kbv_A327 ANIA, major outer membrane protein PAN 1; ANIA[NO2 98.64
1v10_A521 Laccase; multicopper blue oxidase, oxidase; 1.7A { 98.59
2gim_A106 Plastocyanin; beta sheet, Cu, helix, electron tran 98.55
3t6v_A495 Laccase; beta barrel, oxidoreductase; HET: CBS; 2. 98.53
3od3_A488 Blue copper oxidase CUEO; multicopper oxidase, Cu( 98.52
1zpu_A534 Iron transport multicopper oxidase FET3; ferroxida 98.49
3abg_A534 Bilirubin oxidase; cleavage on PAIR of basic resid 98.48
3pxl_A499 Laccase; 4-copper protein, metal-binding, oxidored 98.46
2r7e_B 770 Coagulation factor VIII; ceruloplasmin fold, cuppe 98.44
2zoo_A 442 Probable nitrite reductase; electron transfer, ele 98.43
2wsd_A513 Spore coat protein A; oxidoreductase, multi-copper 98.37
1qhq_A140 Protein (auracyanin); electron transfer, cupredoxi 98.31
4hci_A100 Cupredoxin 1; structural genomics, niaid, national 98.31
2bw4_A340 Copper-containing nitrite reductase; oxidoreductas 98.3
3gyr_A612 PHS, phenoxazinone synthase; metalloprotein, lacca 98.3
1aoz_A552 Ascorbate oxidase; oxidoreductase(oxygen acceptor) 98.29
2plt_A98 Plastocyanin; electron transport; 1.50A {Chlamydom 98.25
2q9o_A559 Laccase-1; multicopper oxidase, 2-OXOH oxidoreduct 98.25
1mzy_A333 Copper-containing nitrite reductase; mutant M182T, 98.25
1bxv_A91 Plastocyanin; copper protein, electron transfer; 1 98.19
1pcs_A98 Plastocyanin; electron transport; 2.15A {Synechocy 98.12
1b3i_A97 PETE protein, protein (plastocyanin); electron tra 98.08
3aw5_A448 Multicopper oxidase; beta barrel, oxidoreductase; 98.05
1byp_A99 Protein (plastocyanin); electron transfer, photosy 98.03
1plc_A99 Plastocyanin; electron transport; 1.33A {Populus n 97.94
1oe1_A336 Dissimilatory copper-containing nitrite reductase; 97.93
1kdj_A102 Plastocyanin; electron transfer, photosystem, PAI- 97.93
3c75_A132 Amicyanin; copper proteins, electron transfer comp 97.79
2uxt_A 451 Protein SUFI, SUFI; oxidoreductase, periplasmic, c 97.78
3sqr_A580 Laccase; multicopper oxidase, glycosylation, oxido 97.73
3erx_A123 Pseudoazurin; copper protein, high-resolution, E t 97.69
3tu6_A127 Pseudoazurin (blue copper protein); cupredoxins, b 97.61
3ef4_A124 Pseudoazurin, blue copper protein; electron transf 97.59
1id2_A106 Amicyanin; beta barrel, type-1 blue copper protein 97.42
1cuo_A129 Protein (azurin ISO-2); beta barrel, periplasmic, 97.39
1iuz_A98 Plastocyanin; electron transport; 1.60A {Ulva pert 97.38
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 97.37
1pmy_A123 Pseudoazurin; electron transfer(cuproprotein); 1.5 97.24
1paz_A123 Pseudoazurin precursor; electron transfer(cupropro 97.22
3ay2_A167 Lipid modified azurin protein; beta sandwich, bact 97.22
2ux6_A122 Pseudoazurin; type-1 copper, metal-binding, redox 97.17
1nwp_A128 Azurin; electron transport, cupredoxin, electron t 96.94
2ccw_A129 Azurin II, AZN-2; electron transport (cuproprotein 96.91
2iaa_C128 Azurin; quinoprotein, tryptophan tryptophylquinone 96.87
2cua_A135 Protein (CUA); CUA center, electron transport; 1.6 94.87
3fsa_A125 Azurin; copper, cupredoxin fold, metal-binding, pr 93.69
3s8f_B168 Cytochrome C oxidase subunit 2; complex IV, respir 93.58
>3sqr_A Laccase; multicopper oxidase, glycosylation, oxidoreductase; HET: NAG BMA MAN; 1.67A {Botrytis aclada} Back     alignment and structure
Probab=100.00  E-value=3.5e-36  Score=295.55  Aligned_cols=137  Identities=32%  Similarity=0.676  Sum_probs=116.1

Q ss_pred             cccccCCCCCceEEEEEE--EeEEEEecccccccCCCCccceeeeee--EEeCCCeEEEEEEEcCCCCCCeEEEecCCEE
Q psy12112        102 ARACREGEPPKLCYYHFT--LELYTVLGAACQLCTPNATNTVWSHCQ--CVLADGVERGILAVNRMLPGPSIQVCEGDRV  177 (246)
Q Consensus       102 ~r~C~~~~~pr~c~~~~~--ie~~~~~~~~~~~~~~~~t~~~~~~~~--~v~~DG~~r~v~tiNGq~PGPtI~v~~GD~V  177 (246)
                      ++.|.+++.+|.||.+|+  ++|+...+       ...+..+.+.++  .+.+||+++.+|+|||++|||+|++++||+|
T Consensus        36 ~~~c~~~~~~r~~w~~~~i~t~~~~~~p-------~~~~~~~~l~v~~~~~~pdG~~~~~~~~NG~~PGP~I~~~~GD~v  108 (580)
T 3sqr_A           36 TASCANSATSRSCWGEYSIDTNWYDVTP-------TGVTREYWLSVENSTITPDGYTRSAMTFNGTVPGPAIIADWGDNL  108 (580)
T ss_dssp             --CBCCBTTBTTEEBTEETTSCTTTCCC-------CCCEEEEEEEEEEEEECSSSBCEEEEEETTBSSCCCEEEETTCEE
T ss_pred             cccCCCCCCCCccccCCCcCccccccCC-------CceEEEEEEEEEEEEecCCCeEEEEEEECCccCCceEEEeCCCEE
Confidence            556888888999995544  44543321       233445555554  3568999999999999999999999999999


Q ss_pred             EEEEEeCCCCCCceeEeecccCCCCCCCCCCccccccccCCCCEEEEEEe-cCCcccEEccCCCCCCCC
Q psy12112        178 VVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT-ANAGTHFWHAHTGCPMSE  245 (246)
Q Consensus       178 ~V~V~N~l~~~~tsIHwHGl~q~~t~~~DGvp~vTqcpI~PGes~tY~F~-~q~GT~WYHsH~~~Q~~d  245 (246)
                      +|+|+|+|+.++++|||||++|++++||||+|++|||||+||++|+|+|+ .|+||||||||.+.|+++
T Consensus       109 ~V~v~N~l~~~~tsIHwHGl~~~~t~~~DGvp~vTq~pI~PG~sftY~f~~~q~GT~WYHsH~~~q~~~  177 (580)
T 3sqr_A          109 IIHVTNNLEHNGTSIHWHGIRQLGSLEYDGVPGVTQCPIAPGDTLTYKFQVTQYGTTWYHSHFSLQYGD  177 (580)
T ss_dssp             EEEEEECCSSCCBCEEETTCCCTTCGGGSCCBTTTBCCBCTTCEEEEEEECCCCEEEEEEECSTTGGGG
T ss_pred             EEEEEECCCCCcceEEecccccCCCccccCCCccccCCCCCCCeEEEEEECCCCcceEEeecccccccC
Confidence            99999999756899999999999999999999999999999999999999 999999999999999875
>2q9o_A Laccase-1; multicopper oxidase, 2-OXOH oxidoreductase; HET: OHI NAG MAN GOL; 1.30A {Melanocarpus albomyces} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 3fu7_A* 3fu8_A* 3fu7_B* 1gw0_A* 2ih9_A* 2ih8_A* 3fu9_A* 3qpk_A* 3dkh_A* 3pps_A* Back     alignment and structure
>1aoz_A Ascorbate oxidase; oxidoreductase(oxygen acceptor); HET: NAG; 1.90A {Cucurbita pepo var} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1aso_A* 1asp_A* 1asq_A* Back     alignment and structure
>3t6v_A Laccase; beta barrel, oxidoreductase; HET: CBS; 2.00A {Steccherinum ochraceum} PDB: 3t6w_A* 3t6x_A* 3t6z_A* 3t71_A* Back     alignment and structure
>3pxl_A Laccase; 4-copper protein, metal-binding, oxidoreductase, type-2 Cu-D; HET: NAG BMA MAN; 1.20A {Trametes hirsuta} PDB: 3fpx_A* 3v9c_A* 3div_A* 2h5u_A* 2xyb_A* 1kya_A* 1gyc_A* 2qt6_A* 2hrg_A* 2hrh_A* 4a2f_A* 2vdz_A* 4a2d_A* 4a2e_A* 4a2g_A* 4a2h_A* 2ve0_A* 2vds_A* 2hzh_A* 3kw7_A* Back     alignment and structure
>1zpu_A Iron transport multicopper oxidase FET3; ferroxidase, oxidoreduc; HET: NAG BMA MAN NDG; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1v10_A Laccase; multicopper blue oxidase, oxidase; 1.7A {Rigidoporus lignosus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 Back     alignment and structure
>1hfu_A Laccase 1; oxidoreductase, blue multi-copper oxidase, type-2 copper depleted, signal, glycoprotein; HET: MAN NAG NDG; 1.68A {Coprinus cinereus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1a65_A* Back     alignment and structure
>3g5w_A Multicopper oxidase type 1; two domain, laccase, nitrifier, metal B protein; 1.90A {Nitrosomonas europaea} Back     alignment and structure
>2zwn_A Two-domain type laccase; muticopper oxidase, oxidoreductase; 1.70A {Metagenomes} Back     alignment and structure
>3gdc_A Multicopper oxidase; beta sandwich, plasmid, oxidoreductase; 1.80A {Arthrobacter SP} Back     alignment and structure
>3zx1_A Oxidoreductase, putative; laccase, metallo-oxidase, cuprous oxidase; 1.95A {Campylobacter jejuni subsp} Back     alignment and structure
>2uxt_A Protein SUFI, SUFI; oxidoreductase, periplasmic, cupredoxin-like, FTS mutant suppressor; 1.90A {Escherichia coli} PDB: 2uxv_A Back     alignment and structure
>3gyr_A PHS, phenoxazinone synthase; metalloprotein, laccase, multicopper oxidase, hexamer, oxidoreductase, antibiotic biosynthesis; 2.30A {Streptomyces antibioticus} Back     alignment and structure
>3abg_A Bilirubin oxidase; cleavage on PAIR of basic residues, glyco metal-binding, oxidoreductase; HET: NAG BMA NDG; 2.30A {Myrothecium verrucaria} PDB: 2xll_A* Back     alignment and structure
>3kw8_A Laccase, putative copper oxidase; two-domain laccase, oxidoreductase, multicopper blue protein; HET: PG4 PGE; 2.29A {Streptomyces coelicolor} PDB: 4gxf_A* 4gy4_A* Back     alignment and structure
>2wsd_A Spore coat protein A; oxidoreductase, multi-copper oxidase, sporulation, COTA- LAC copper centre; 1.60A {Bacillus subtilis} PDB: 1gsk_A 1hkp_A 1hkz_A 1hl0_A 1hl1_A 1of0_A* 1ogr_A 1uvw_A* 1w6l_A 1w6w_A 1w8e_A 2bhf_A 2x87_A 2x88_A* 4a67_A 4akq_A 4a68_A* 4akp_A* 4a66_A 4ako_A Back     alignment and structure
>2xu9_A Laccase; oxidoreductase, multicopper oxidases; 1.50A {Thermus thermophilus} PDB: 2xuw_A 2xvb_A 2yae_A 2yaf_A 2yah_A 2yam_A 2yao_A 2yap_A 2yaq_A 2yar_A 4ai7_A Back     alignment and structure
>3od3_A Blue copper oxidase CUEO; multicopper oxidase, Cu(I) oxidase, oxidoreductase; 1.10A {Escherichia coli} PDB: 1n68_A 2fqd_A* 2fqe_A* 2fqf_A* 2fqg_A* 3nsd_A 1kv7_A 3pau_A 3pav_A 3nsf_A 1pf3_A 3qqx_A 3nsc_A 3nt0_A 3uad_A 3uaa_A 3uac_A 3uab_A 3uae_A 3nsy_A ... Back     alignment and structure
>3t9w_A Small laccase, multi-copper oxidase; two-domain copper oxidase, Cu-binding, oxidoreducta; 1.50A {Amycolatopsis SP} Back     alignment and structure
>3tas_A Small laccase, multi-copper oxidase; two-domain laccase, oxidoreductase, secreted; HET: PG4; 2.30A {Streptomyces viridosporus} PDB: 3tbb_A 3tbc_A* Back     alignment and structure
>3aw5_A Multicopper oxidase; beta barrel, oxidoreductase; 2.00A {Pyrobaculum aerophilum} Back     alignment and structure
>1mzy_A Copper-containing nitrite reductase; mutant M182T, gating mechanism, electron oxidoreductase; 1.46A {Rhodobacter sphaeroides} SCOP: b.6.1.3 b.6.1.3 PDB: 1mzz_A 1n70_A 1zv2_A 2a3t_A 2dws_A 2dwt_A 2dy2_A Back     alignment and structure
>1oe1_A Dissimilatory copper-containing nitrite reductase; denitrification; HET: PG4; 1.04A {Alcaligenes xylosoxidans} SCOP: b.6.1.3 b.6.1.3 PDB: 1oe3_A* 2xwz_A* 2vn3_A 2zon_A* 1haw_A 1hau_A* 2vm4_A* 2vw4_A* 2vw6_A* 2vw7_A* 2vm3_A* 1oe2_A* 2jl0_A* 2xx1_A 2xxg_A* 2xxf_A* 1gs8_A 1wa1_X* 1wa2_X* 2jl3_A* ... Back     alignment and structure
>1kbv_A ANIA, major outer membrane protein PAN 1; ANIA[NO2-], oxidoreductase; 1.95A {Neisseria gonorrhoeae} SCOP: b.6.1.3 b.6.1.3 PDB: 1kbw_A Back     alignment and structure
>2zoo_A Probable nitrite reductase; electron transfer, electron transport, heme, iron, binding, oxidoreductase, transport; HET: SUC HEM; 1.95A {Pseudoalteromonas haloplanktis} Back     alignment and structure
>2bw4_A Copper-containing nitrite reductase; oxidoreductase, denitrification, catalysis, enzyme mechanism, nitrate assimilation; 0.90A {Achromobacter cycloclastes} SCOP: b.6.1.3 b.6.1.3 PDB: 1nib_A 1nia_A 1nid_A 1nie_A 1nic_A 1nif_A 2bw5_A 2bwd_A 2bwi_A 2nrd_A 2y1a_A 1kcb_A 1rzp_A* 1rzq_A 2avf_A 1as6_A 1aq8_A 1as7_A 1as8_A 2afn_A ... Back     alignment and structure
>1sdd_A Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Back     alignment and structure
>3cg8_A Laccase; oxidoreductase, multicopper blue protein; HET: PG4; 2.68A {Streptomyces coelicolor} Back     alignment and structure
>2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Back     alignment and structure
>2r7e_B Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_B* Back     alignment and structure
>1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 Back     alignment and structure
>2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Back     alignment and structure
>3cvb_A Plastocyanin; cupredoxin, SELF assembly, copper, electron transport, metal-binding, transport; 1.40A {Phormidium laminosum} PDB: 3cvc_A 3cvd_A 2w8c_A 2w88_A 2q5b_A 1baw_A 3bqv_A Back     alignment and structure
>3kw8_A Laccase, putative copper oxidase; two-domain laccase, oxidoreductase, multicopper blue protein; HET: PG4 PGE; 2.29A {Streptomyces coelicolor} PDB: 4gxf_A* 4gy4_A* Back     alignment and structure
>1iby_A Nitrosocyanin; RED copper, cupredoxin, beta hairpin, metal binding protein; 1.65A {Nitrosomonas europaea} SCOP: b.6.1.4 PDB: 1ibz_A 1ic0_A Back     alignment and structure
>3cg8_A Laccase; oxidoreductase, multicopper blue protein; HET: PG4; 2.68A {Streptomyces coelicolor} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2cal_A Rusticyanin; iron respiratory electron transport chain, blue protein, electron transport, metal- binding, periplasmic; 1.10A {Thiobacillus ferrooxidans} PDB: 1cur_A 1gy2_A 1a3z_A 1e30_A 1gy1_A 1rcy_A 1a8z_A 2cak_A Back     alignment and structure
>2ov0_A Amicyanin; beta-sandwich, electron transport; 0.75A {Paracoccus denitrificans} SCOP: b.6.1.1 PDB: 1aaj_A 1aan_A 1aac_A 1mg2_C* 1mg3_C* 1t5k_A 2gc4_C* 2gc7_C* 2j55_A* 2j56_A* 2j57_A* 2mta_A* 1bxa_A 2rac_A 3l45_A 3ie9_A 3iea_A 2idq_A 2ids_A 1sf3_A ... Back     alignment and structure
>1sdd_A Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 Back     alignment and structure
>1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 Back     alignment and structure
>3zx1_A Oxidoreductase, putative; laccase, metallo-oxidase, cuprous oxidase; 1.95A {Campylobacter jejuni subsp} Back     alignment and structure
>3t9w_A Small laccase, multi-copper oxidase; two-domain copper oxidase, Cu-binding, oxidoreducta; 1.50A {Amycolatopsis SP} Back     alignment and structure
>3g5w_A Multicopper oxidase type 1; two domain, laccase, nitrifier, metal B protein; 1.90A {Nitrosomonas europaea} Back     alignment and structure
>3gdc_A Multicopper oxidase; beta sandwich, plasmid, oxidoreductase; 1.80A {Arthrobacter SP} Back     alignment and structure
>3tas_A Small laccase, multi-copper oxidase; two-domain laccase, oxidoreductase, secreted; HET: PG4; 2.30A {Streptomyces viridosporus} PDB: 3tbb_A 3tbc_A* Back     alignment and structure
>2xu9_A Laccase; oxidoreductase, multicopper oxidases; 1.50A {Thermus thermophilus} PDB: 2xuw_A 2xvb_A 2yae_A 2yaf_A 2yah_A 2yam_A 2yao_A 2yap_A 2yaq_A 2yar_A 4ai7_A Back     alignment and structure
>2aan_A Auracyanin A; cupredoxin fold, electron transport; 1.85A {Chloroflexus aurantiacus} Back     alignment and structure
>1hfu_A Laccase 1; oxidoreductase, blue multi-copper oxidase, type-2 copper depleted, signal, glycoprotein; HET: MAN NAG NDG; 1.68A {Coprinus cinereus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1a65_A* Back     alignment and structure
>2zwn_A Two-domain type laccase; muticopper oxidase, oxidoreductase; 1.70A {Metagenomes} Back     alignment and structure
>1kbv_A ANIA, major outer membrane protein PAN 1; ANIA[NO2-], oxidoreductase; 1.95A {Neisseria gonorrhoeae} SCOP: b.6.1.3 b.6.1.3 PDB: 1kbw_A Back     alignment and structure
>1v10_A Laccase; multicopper blue oxidase, oxidase; 1.7A {Rigidoporus lignosus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 Back     alignment and structure
>2gim_A Plastocyanin; beta sheet, Cu, helix, electron transport; 1.60A {Anabaena variabilis} SCOP: b.6.1.1 PDB: 1fa4_A 1nin_A 1tu2_A* 2cj3_A Back     alignment and structure
>3t6v_A Laccase; beta barrel, oxidoreductase; HET: CBS; 2.00A {Steccherinum ochraceum} PDB: 3t6w_A* 3t6x_A* 3t6z_A* 3t71_A* Back     alignment and structure
>3od3_A Blue copper oxidase CUEO; multicopper oxidase, Cu(I) oxidase, oxidoreductase; 1.10A {Escherichia coli} PDB: 1n68_A 2fqd_A* 2fqe_A* 2fqf_A* 2fqg_A* 3nsd_A 1kv7_A 3pau_A 3pav_A 3nsf_A 1pf3_A 3qqx_A 3nsc_A 3nt0_A 3uad_A 3uaa_A 3uac_A 3uab_A 3uae_A 3nsy_A ... Back     alignment and structure
>1zpu_A Iron transport multicopper oxidase FET3; ferroxidase, oxidoreduc; HET: NAG BMA MAN NDG; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3abg_A Bilirubin oxidase; cleavage on PAIR of basic residues, glyco metal-binding, oxidoreductase; HET: NAG BMA NDG; 2.30A {Myrothecium verrucaria} PDB: 2xll_A* Back     alignment and structure
>3pxl_A Laccase; 4-copper protein, metal-binding, oxidoreductase, type-2 Cu-D; HET: NAG BMA MAN; 1.20A {Trametes hirsuta} PDB: 3fpx_A* 3v9c_A* 3div_A* 2h5u_A* 2xyb_A* 1kya_A* 1gyc_A* 2qt6_A* 2hrg_A* 2hrh_A* 4a2f_A* 2vdz_A* 4a2d_A* 4a2e_A* 4a2g_A* 4a2h_A* 2ve0_A* 2vds_A* 2hzh_A* 3kw7_A* Back     alignment and structure
>2r7e_B Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_B* Back     alignment and structure
>2zoo_A Probable nitrite reductase; electron transfer, electron transport, heme, iron, binding, oxidoreductase, transport; HET: SUC HEM; 1.95A {Pseudoalteromonas haloplanktis} Back     alignment and structure
>2wsd_A Spore coat protein A; oxidoreductase, multi-copper oxidase, sporulation, COTA- LAC copper centre; 1.60A {Bacillus subtilis} PDB: 1gsk_A 1hkp_A 1hkz_A 1hl0_A 1hl1_A 1of0_A* 1ogr_A 1uvw_A* 1w6l_A 1w6w_A 1w8e_A 2bhf_A 2x87_A 2x88_A* 4a67_A 4akq_A 4a68_A* 4akp_A* 4a66_A 4ako_A Back     alignment and structure
>1qhq_A Protein (auracyanin); electron transfer, cupredoxin, blue copper protein, azurin-L thermophIle; 1.55A {Chloroflexus aurantiacus} SCOP: b.6.1.1 PDB: 1ov8_A Back     alignment and structure
>4hci_A Cupredoxin 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.63A {Bacillus anthracis} PDB: 4hcg_A 4hcf_A Back     alignment and structure
>2bw4_A Copper-containing nitrite reductase; oxidoreductase, denitrification, catalysis, enzyme mechanism, nitrate assimilation; 0.90A {Achromobacter cycloclastes} SCOP: b.6.1.3 b.6.1.3 PDB: 1nib_A 1nia_A 1nid_A 1nie_A 1nic_A 1nif_A 2bw5_A 2bwd_A 2bwi_A 2nrd_A 2y1a_A 1kcb_A 1rzp_A* 1rzq_A 2avf_A 1as6_A 1aq8_A 1as7_A 1as8_A 2afn_A ... Back     alignment and structure
>3gyr_A PHS, phenoxazinone synthase; metalloprotein, laccase, multicopper oxidase, hexamer, oxidoreductase, antibiotic biosynthesis; 2.30A {Streptomyces antibioticus} Back     alignment and structure
>1aoz_A Ascorbate oxidase; oxidoreductase(oxygen acceptor); HET: NAG; 1.90A {Cucurbita pepo var} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1aso_A* 1asp_A* 1asq_A* Back     alignment and structure
>2plt_A Plastocyanin; electron transport; 1.50A {Chlamydomonas reinhardtii} SCOP: b.6.1.1 Back     alignment and structure
>2q9o_A Laccase-1; multicopper oxidase, 2-OXOH oxidoreductase; HET: OHI NAG MAN GOL; 1.30A {Melanocarpus albomyces} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 3fu7_A* 3fu8_A* 3fu7_B* 1gw0_A* 2ih9_A* 2ih8_A* 3fu9_A* 3qpk_A* 3dkh_A* 3pps_A* Back     alignment and structure
>1mzy_A Copper-containing nitrite reductase; mutant M182T, gating mechanism, electron oxidoreductase; 1.46A {Rhodobacter sphaeroides} SCOP: b.6.1.3 b.6.1.3 PDB: 1mzz_A 1n70_A 1zv2_A 2a3t_A 2dws_A 2dwt_A 2dy2_A Back     alignment and structure
>1bxv_A Plastocyanin; copper protein, electron transfer; 1.80A {Synechococcus elongatus} SCOP: b.6.1.1 PDB: 1bxu_A Back     alignment and structure
>1pcs_A Plastocyanin; electron transport; 2.15A {Synechocystis SP} SCOP: b.6.1.1 PDB: 1m9w_A 1j5c_A 1j5d_A 1jxd_A 1jxf_A Back     alignment and structure
>1b3i_A PETE protein, protein (plastocyanin); electron transport, type I copper protein, photosynthesis; NMR {Prochlorothrix hollandica} SCOP: b.6.1.1 PDB: 2b3i_A 2jxm_A* Back     alignment and structure
>3aw5_A Multicopper oxidase; beta barrel, oxidoreductase; 2.00A {Pyrobaculum aerophilum} Back     alignment and structure
>1byp_A Protein (plastocyanin); electron transfer, photosynthesis, acidic patch, double mutant, electron transport; 1.75A {Silene latifolia subsp} SCOP: b.6.1.1 PDB: 1pla_A 1plb_A Back     alignment and structure
>1plc_A Plastocyanin; electron transport; 1.33A {Populus nigra} SCOP: b.6.1.1 PDB: 1pnc_A 1pnd_A 1tkw_A* 2pcy_A 3pcy_A 4pcy_A 5pcy_A 6pcy_A 1jxg_A 1ag6_A 1ylb_B 2pcf_A* 1oow_A 1tef_A 9pcy_A 1teg_A 1byo_A Back     alignment and structure
>1oe1_A Dissimilatory copper-containing nitrite reductase; denitrification; HET: PG4; 1.04A {Alcaligenes xylosoxidans} SCOP: b.6.1.3 b.6.1.3 PDB: 1oe3_A* 2xwz_A* 2vn3_A 2zon_A* 1haw_A 1hau_A* 2vm4_A* 2vw4_A* 2vw6_A* 2vw7_A* 2vm3_A* 1oe2_A* 2jl0_A* 2xx1_A 2xxg_A* 2xxf_A* 1gs8_A 1wa1_X* 1wa2_X* 2jl3_A* ... Back     alignment and structure
>1kdj_A Plastocyanin; electron transfer, photosystem, PAI-PAI stacking; 1.70A {Adiantum capillus-veneris} SCOP: b.6.1.1 PDB: 1kdi_A 2bz7_A 2bzc_A Back     alignment and structure
>3c75_A Amicyanin; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2uxt_A Protein SUFI, SUFI; oxidoreductase, periplasmic, cupredoxin-like, FTS mutant suppressor; 1.90A {Escherichia coli} PDB: 2uxv_A Back     alignment and structure
>3sqr_A Laccase; multicopper oxidase, glycosylation, oxidoreductase; HET: NAG BMA MAN; 1.67A {Botrytis aclada} Back     alignment and structure
>3erx_A Pseudoazurin; copper protein, high-resolution, E transport, metal-binding, transport; 1.25A {Paracoccus pantotrophus} SCOP: b.6.1.1 PDB: 1adw_A Back     alignment and structure
>3tu6_A Pseudoazurin (blue copper protein); cupredoxins, beta barrel, electron transfer, redox, electron transport; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3ef4_A Pseudoazurin, blue copper protein; electron transfer, electron transport; HET: PO4; 1.18A {Hyphomicrobium denitrificans} SCOP: b.6.1.0 Back     alignment and structure
>1id2_A Amicyanin; beta barrel, type-1 blue copper protein, electron transfer protein, electron transport; 2.15A {Paracoccus versutus} SCOP: b.6.1.1 Back     alignment and structure
>1cuo_A Protein (azurin ISO-2); beta barrel, periplasmic, electron transport; 1.60A {Methylomonas SP} SCOP: b.6.1.1 PDB: 1uat_A Back     alignment and structure
>1iuz_A Plastocyanin; electron transport; 1.60A {Ulva pertusa} SCOP: b.6.1.1 PDB: 7pcy_A Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>1pmy_A Pseudoazurin; electron transfer(cuproprotein); 1.50A {Methylobacterium extorquens} SCOP: b.6.1.1 Back     alignment and structure
>1paz_A Pseudoazurin precursor; electron transfer(cuproprotein); 1.55A {Alcaligenes faecalis} SCOP: b.6.1.1 PDB: 1pza_A 1pzb_A 1pzc_A 2p80_D 3nyk_A 3paz_A 8paz_A 4paz_A 5paz_A 6paz_A 7paz_A 1py0_A* Back     alignment and structure
>3ay2_A Lipid modified azurin protein; beta sandwich, bacterial protein, anticancer, anti-HIV/AIDS, antiparasitic activity, antitumor protein; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>2ux6_A Pseudoazurin; type-1 copper, metal-binding, redox potential, copper, transport, cupredoxin, periplasmic, electron transport; 1.3A {Achromobacter cycloclastes} PDB: 2ux7_A 2uxf_A 2uxg_A 1bqk_A 1bqr_A 1zia_A 1zib_A 2jkw_A Back     alignment and structure
>1nwp_A Azurin; electron transport, cupredoxin, electron transfer; 1.60A {Pseudomonas putida} SCOP: b.6.1.1 PDB: 1nwo_A 1joi_A Back     alignment and structure
>2ccw_A Azurin II, AZN-2; electron transport (cuproprotein), alcaligenes xylosoxidans, electron transfer, cupredoxin, electron transport; 1.13A {Alcaligenes xylosoxydans} SCOP: b.6.1.1 PDB: 1dz0_A 1dyz_A 1aiz_A 1azb_A 1azc_A 1uri_A 2aza_A 1a4a_A 1a4b_A 1a4c_A Back     alignment and structure
>2iaa_C Azurin; quinoprotein, tryptophan tryptophylquinone, cupredoxin, electron transfer, oxidoreductase/electron transport comple; HET: TRQ; 1.95A {Alcaligenes faecalis} PDB: 2h47_C* 2h3x_C* Back     alignment and structure
>2cua_A Protein (CUA); CUA center, electron transport; 1.60A {Thermus thermophilus} SCOP: b.6.1.2 PDB: 2fwl_B* Back     alignment and structure
>3fsa_A Azurin; copper, cupredoxin fold, metal-binding, protein-protein interaction, metal binding protein; 0.98A {Pseudomonas aeruginosa} SCOP: b.6.1.1 PDB: 2xv2_A 2xv0_A 3fs9_A 2fta_A* 2hx7_A 2hx8_A 2hx9_A 2hxa_A 1cc3_A 2ft6_A 2ft7_A 2ft8_A 1azn_A 3n2j_A 2iwe_A 2ghz_A 2gi0_A 1jzg_A* 1azu_A* 1bex_A ... Back     alignment and structure
>3s8f_B Cytochrome C oxidase subunit 2; complex IV, respiratory chain, lipid cubic phase, monoolein, peroxide, electron transport, proton pump; HET: HEM HAS OLC; 1.80A {Thermus thermophilus} PDB: 1ehk_B* 2qpd_B* 3qjq_B* 3qjr_B* 3qju_B* 3qjv_B* 1xme_B* 3s8g_B* 4esl_B* 4ev3_B* 4f05_B* 4fa7_B* 4faa_B* 3qjs_B* 3bvd_B* 2qpe_B* 3qjt_B* 3s3b_B* 3s33_B* 3s39_B* ... Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 246
d1hfua1131 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprin 4e-28
d1gyca1130 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, la 4e-27
d1v10a1136 b.6.1.3 (A:1-136) Laccase {Rigidoporus lignosus [T 2e-25
d1aoza1129 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cuc 2e-24
d1kbva1151 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisser 1e-18
d1oe2a1159 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcalige 2e-18
d2q9oa1162 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces 2e-17
d1mzya1153 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodoba 2e-17
d2bw4a1157 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcalige 6e-17
d2j5wa1192 b.6.1.3 (A:1-192) Ceruloplasmin {Human (Homo sapie 2e-16
d1kv7a1140 b.6.1.3 (A:31-170) multi-copper oxidase CueO {Esch 4e-15
d1gska1181 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Baci 7e-15
d1sdda1180 b.6.1.3 (A:1-180) Coagulation factor V {Cow (Bos t 2e-14
d2j5wa3207 b.6.1.3 (A:347-553) Ceruloplasmin {Human (Homo sap 3e-14
d1e30a_153 b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidan 6e-13
d2j5wa4179 b.6.1.3 (A:706-884) Ceruloplasmin {Human (Homo sap 3e-11
d1sddb2139 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (B 3e-10
d2j5wa5149 b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sa 3e-09
d2j5wa2145 b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sap 8e-09
d1sdda2116 b.6.1.3 (A:181-296) Coagulation factor V {Cow (Bos 1e-08
d1kcwa2146 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sap 1e-06
>d1hfua1 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Length = 131 Back     information, alignment and structure

class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Multidomain cupredoxins
domain: Laccase
species: Inky cap fungus (Coprinus cinereus) [TaxId: 5346]

 Score =  101 bits (254), Expect = 4e-28
 Identities = 42/111 (37%), Positives = 63/111 (56%), Gaps = 7/111 (6%)

Query: 136 NATNTVWSHCQCVLADGVERGILAVNRMLPGPSIQVCEGDRVVVDVRNSMDGLEN----T 191
           N+ +T+      V  DG  R  + VN +  GP I+  + D   ++V N +D        +
Sbjct: 4   NSVDTMTLTNANVSPDGFTRAGILVNGV-HGPLIRGGKNDNFELNVVNDLDNPTMLRPTS 62

Query: 192 IHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFTA--NAGTHFWHAHTG 240
           IHWHG+ QRGT ++DG   V QCPI+ G+ F Y+FT   +AGT ++H+H G
Sbjct: 63  IHWHGLFQRGTNWADGADGVNQCPISPGHAFLYKFTPAGHAGTFWYHSHFG 113
>d1gyca1 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Length = 130 Back     information, alignment and structure
>d1v10a1 b.6.1.3 (A:1-136) Laccase {Rigidoporus lignosus [TaxId: 219653]} Length = 136 Back     information, alignment and structure
>d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Length = 129 Back     information, alignment and structure
>d1kbva1 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Length = 151 Back     information, alignment and structure
>d1oe2a1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Length = 159 Back     information, alignment and structure
>d2q9oa1 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces [TaxId: 204285]} Length = 162 Back     information, alignment and structure
>d1mzya1 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Length = 153 Back     information, alignment and structure
>d2bw4a1 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Length = 157 Back     information, alignment and structure
>d2j5wa1 b.6.1.3 (A:1-192) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1kv7a1 b.6.1.3 (A:31-170) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Length = 140 Back     information, alignment and structure
>d1gska1 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Length = 181 Back     information, alignment and structure
>d1sdda1 b.6.1.3 (A:1-180) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Length = 180 Back     information, alignment and structure
>d2j5wa3 b.6.1.3 (A:347-553) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} Length = 153 Back     information, alignment and structure
>d2j5wa4 b.6.1.3 (A:706-884) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 179 Back     information, alignment and structure
>d1sddb2 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Length = 139 Back     information, alignment and structure
>d2j5wa5 b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 149 Back     information, alignment and structure
>d2j5wa2 b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 145 Back     information, alignment and structure
>d1sdda2 b.6.1.3 (A:181-296) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Length = 116 Back     information, alignment and structure
>d1kcwa2 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 146 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query246
d1aoza1129 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 100.0
d1v10a1136 Laccase {Rigidoporus lignosus [TaxId: 219653]} 100.0
d2q9oa1162 Laccase {Melanocarpus albomyces [TaxId: 204285]} 99.98
d1hfua1131 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 99.97
d1gyca1130 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 99.97
d1kv7a1140 multi-copper oxidase CueO {Escherichia coli [TaxId 99.95
d2bw4a1157 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 99.93
d1oe2a1159 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 99.92
d1mzya1153 Nitrite reductase, NIR {Rhodobacter sphaeroides [T 99.92
d1kbva1151 Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani 99.9
d1gska1181 Spore coat protein A, CotA {Bacillus subtilis [Tax 99.9
d1sdda1180 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 99.8
d2j5wa3207 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.78
d2j5wa1192 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.75
d1e30a_153 Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920 99.72
d2j5wa4179 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.71
d2j5wa5149 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.62
d1kbva2151 Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani 99.61
d1sddb2139 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 99.59
d2j5wa2145 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.59
d1kcwa2146 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.58
d1sdda2116 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 99.54
d1fwxa1132 Nitrous oxide reductase, C-terminal domain {Paraco 99.39
d1ibya_112 Red copper protein nitrosocyanin {Nitrosomonas eur 99.32
d1qnia1131 Nitrous oxide reductase, C-terminal domain {Pseudo 98.93
d2bw4a2173 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 98.8
d1kv7a3181 multi-copper oxidase CueO {Escherichia coli [TaxId 98.72
d1hfua3200 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 98.57
d1gska3154 Spore coat protein A, CotA {Bacillus subtilis [Tax 98.56
d1v10a3190 Laccase {Rigidoporus lignosus [TaxId: 219653]} 98.41
d1gyca3199 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 98.39
d1aoza3214 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 98.38
d1oe1a2177 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 98.38
d1qhqa_139 Auracyanin {Chloroflexus aurantiacus [TaxId: 1108] 98.33
d1sddb167 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 98.07
d2q9oa3216 Laccase {Melanocarpus albomyces [TaxId: 204285]} 98.0
d2ov0a1105 Amicyanin {Paracoccus denitrificans [TaxId: 266]} 97.71
d2plta_98 Plastocyanin {Green alga (Chlamydomonas reinhardti 97.37
d1pcsa_98 Plastocyanin {Cyanobacterium (Synechocystis sp.), 97.29
d1v10a2168 Laccase {Rigidoporus lignosus [TaxId: 219653]} 97.26
d1hfua2172 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 97.11
d2q9oa2181 Laccase {Melanocarpus albomyces [TaxId: 204285]} 97.1
d2q5ba1105 Plastocyanin {Cyanobacterium (Phormidium laminosum 97.1
d1kdja_102 Plastocyanin {Fern (Adiantum capillus-veneris) [Ta 97.1
d1bypa_99 Plastocyanin {White campion (Silene pratensis) [Ta 96.96
d1gyca2170 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 96.86
d2cuaa_122 Cytochrome c oxidase {Thermus thermophilus, ba3 ty 96.7
d1plca_99 Plastocyanin {Poplar (Populus nigra), variant ital 96.64
d1aoza2209 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 96.47
d1id2a_106 Amicyanin {Paracoccus versutus (Thiobacillus versu 96.45
d2jxma197 Plastocyanin {Photosynthetic prokaryote (Prochloro 96.42
d1bxua_91 Plastocyanin {Cyanobacterium (Synechocystis sp.), 96.41
d2cj3a1105 Plastocyanin {Anabaena variabilis [TaxId: 1172]} 96.19
d1pmya_123 Pseudoazurin {Methylobacterium extorquens, strain 96.04
d2ccwa1129 Azurin {Alcaligenes xylosoxidans, NCIMB (11015), d 95.87
d1iuza_98 Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 95.59
d1adwa_123 Pseudoazurin {Thiosphaera pantotropha [TaxId: 8236 95.42
d1paza_120 Pseudoazurin {Alcaligenes faecalis, strain s-6 [Ta 94.95
d1bqka_124 Pseudoazurin {Achromobacter cycloclastes [TaxId: 2 94.95
d1kv7a2165 multi-copper oxidase CueO {Escherichia coli [TaxId 94.91
d1jzga_128 Azurin {Pseudomonas aeruginosa [TaxId: 287]} 94.78
d1cuoa_129 Azurin {Methylomonas sp. j [TaxId: 32038]} 94.68
d1mzya2178 Nitrite reductase, NIR {Rhodobacter sphaeroides [T 94.64
d1nwpa_128 Azurin {Pseudomonas putida [TaxId: 303]} 94.39
d1gska2174 Spore coat protein A, CotA {Bacillus subtilis [Tax 93.88
>d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Multidomain cupredoxins
domain: Ascorbate oxidase
species: Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]

Probab=100.00  E-value=7.3e-34  Score=227.90  Aligned_cols=111  Identities=39%  Similarity=0.722  Sum_probs=103.1

Q ss_pred             ceEEEEEEEeEEEEecccccccCCCCccceeeeeeEEeCCCeEEEEEEEcCCCCCCeEEEecCCEEEEEEEeCCCCCCce
Q psy12112        112 KLCYYHFTLELYTVLGAACQLCTPNATNTVWSHCQCVLADGVERGILAVNRMLPGPSIQVCEGDRVVVDVRNSMDGLENT  191 (246)
Q Consensus       112 r~c~~~~~ie~~~~~~~~~~~~~~~~t~~~~~~~~~v~~DG~~r~v~tiNGq~PGPtI~v~~GD~V~V~V~N~l~~~~ts  191 (246)
                      ++|+|+|++++...                       .+||+++.+|+|||++|||+|+|++||+|+|+|+|+++.++++
T Consensus         2 ~~~~~~~~v~~~~~-----------------------~pdg~~~~~~~~NG~~PGP~i~v~~GD~v~i~l~N~l~~~~~~   58 (129)
T d1aoza1           2 QIRHYKWEVEYMFW-----------------------APNCNENIVMGINGQFPGPTIRANAGDSVVVELTNKLHTEGVV   58 (129)
T ss_dssp             CEEEEEEEEEEEEE-----------------------CTTSSCEEEEEETTBSSCCCEEEETTCEEEEEEEECCSSCCBC
T ss_pred             cEEEEEEEEEEEEE-----------------------CCCCeEEEEEEECCCcCCCeEEEECCcEEEEEEEeCCCCCCee
Confidence            67889999887642                       5899999999999999999999999999999999998767899


Q ss_pred             eEeecccCCCCCCCCCCccccccccCCCCEEEEEEe-cCCcccEEccCCCCCCCC
Q psy12112        192 IHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT-ANAGTHFWHAHTGCPMSE  245 (246)
Q Consensus       192 IHwHGl~q~~t~~~DGvp~vTqcpI~PGes~tY~F~-~q~GT~WYHsH~~~Q~~d  245 (246)
                      |||||+++...+++||++++++|+|+||++++|+|+ +++||||||||...|.++
T Consensus        59 iH~Hg~~~~~~~~~~~~~~~~~~~I~PG~s~~y~f~a~~~Gt~~YH~H~~~h~~~  113 (129)
T d1aoza1          59 IHWHGILQRGTPWADGTASISQCAINPGETFFYNFTVDNPGTFFYHGHLGMQRSA  113 (129)
T ss_dssp             EEEETCCCTTCGGGSCCBTTTBCCBCTTCEEEEEEECCSCEEEEEEECSTTTGGG
T ss_pred             eeeccceeeccCccccccccccceECCCCEEEEEEECCCCCceEEecCCHHHHhC
Confidence            999999999999999999999999999999999999 999999999999888653
>d1v10a1 b.6.1.3 (A:1-136) Laccase {Rigidoporus lignosus [TaxId: 219653]} Back     information, alignment and structure
>d2q9oa1 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d1hfua1 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d1gyca1 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d1kv7a1 b.6.1.3 (A:31-170) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bw4a1 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1oe2a1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1mzya1 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1kbva1 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Back     information, alignment and structure
>d1gska1 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sdda1 b.6.1.3 (A:1-180) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2j5wa3 b.6.1.3 (A:347-553) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j5wa1 b.6.1.3 (A:1-192) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} Back     information, alignment and structure
>d2j5wa4 b.6.1.3 (A:706-884) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j5wa5 b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kbva2 b.6.1.3 (A:164-314) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Back     information, alignment and structure
>d1sddb2 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2j5wa2 b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kcwa2 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sdda2 b.6.1.3 (A:181-296) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fwxa1 b.6.1.4 (A:452-581) Nitrous oxide reductase, C-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ibya_ b.6.1.4 (A:) Red copper protein nitrosocyanin {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1qnia1 b.6.1.4 (A:451-581) Nitrous oxide reductase, C-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2bw4a2 b.6.1.3 (A:166-338) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1kv7a3 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hfua3 b.6.1.3 (A:304-503) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d1gska3 b.6.1.3 (A:357-510) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1v10a3 b.6.1.3 (A:305-494) Laccase {Rigidoporus lignosus [TaxId: 219653]} Back     information, alignment and structure
>d1gyca3 b.6.1.3 (A:301-499) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d1aoza3 b.6.1.3 (A:339-552) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
>d1oe1a2 b.6.1.3 (A:160-336) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1qhqa_ b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1sddb1 b.6.1.3 (B:1657-1723) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2q9oa3 b.6.1.3 (A:344-559) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d2ov0a1 b.6.1.1 (A:1-105) Amicyanin {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2plta_ b.6.1.1 (A:) Plastocyanin {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1pcsa_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 6803 [TaxId: 1143]} Back     information, alignment and structure
>d1v10a2 b.6.1.3 (A:137-304) Laccase {Rigidoporus lignosus [TaxId: 219653]} Back     information, alignment and structure
>d1hfua2 b.6.1.3 (A:132-303) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d2q9oa2 b.6.1.3 (A:163-343) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d2q5ba1 b.6.1.1 (A:1-105) Plastocyanin {Cyanobacterium (Phormidium laminosum) [TaxId: 32059]} Back     information, alignment and structure
>d1kdja_ b.6.1.1 (A:) Plastocyanin {Fern (Adiantum capillus-veneris) [TaxId: 13818]} Back     information, alignment and structure
>d1bypa_ b.6.1.1 (A:) Plastocyanin {White campion (Silene pratensis) [TaxId: 52853]} Back     information, alignment and structure
>d1gyca2 b.6.1.3 (A:131-300) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d2cuaa_ b.6.1.2 (A:) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]} Back     information, alignment and structure
>d1plca_ b.6.1.1 (A:) Plastocyanin {Poplar (Populus nigra), variant italica [TaxId: 3691]} Back     information, alignment and structure
>d1aoza2 b.6.1.3 (A:130-338) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
>d1id2a_ b.6.1.1 (A:) Amicyanin {Paracoccus versutus (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2jxma1 b.6.1.1 (A:1-97) Plastocyanin {Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId: 1223]} Back     information, alignment and structure
>d1bxua_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 7942 [TaxId: 1143]} Back     information, alignment and structure
>d2cj3a1 b.6.1.1 (A:1-105) Plastocyanin {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d1pmya_ b.6.1.1 (A:) Pseudoazurin {Methylobacterium extorquens, strain am1 [TaxId: 408]} Back     information, alignment and structure
>d2ccwa1 b.6.1.1 (A:1-129) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId: 85698]} Back     information, alignment and structure
>d1iuza_ b.6.1.1 (A:) Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 3120]} Back     information, alignment and structure
>d1adwa_ b.6.1.1 (A:) Pseudoazurin {Thiosphaera pantotropha [TaxId: 82367]} Back     information, alignment and structure
>d1paza_ b.6.1.1 (A:) Pseudoazurin {Alcaligenes faecalis, strain s-6 [TaxId: 511]} Back     information, alignment and structure
>d1bqka_ b.6.1.1 (A:) Pseudoazurin {Achromobacter cycloclastes [TaxId: 223]} Back     information, alignment and structure
>d1kv7a2 b.6.1.3 (A:171-335) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jzga_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1cuoa_ b.6.1.1 (A:) Azurin {Methylomonas sp. j [TaxId: 32038]} Back     information, alignment and structure
>d1mzya2 b.6.1.3 (A:194-371) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1nwpa_ b.6.1.1 (A:) Azurin {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1gska2 b.6.1.3 (A:183-356) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure