Psyllid ID: psy12256

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------
MADFRFDCGGKLIAPGFIDIQINGGFGVDFSHDIDSVDKNVSIVARGILAHGVTSFCPTLVTSEPQVYKKVLSRLRKTPGGKHGATVLGAHVEGPFISPDKKGAHSLSKIVTFDKGFDSVREVYGNLSNIAIITLAPELAGSMEVIDKLVEQGITVSLGHSSADINIAEEAVRHGASLITHLFNAMLPFHHRDPGIIGLLSSDNIDSSKVYYGIIADGVHTHPSALRIANSTHPEGHSSADIHIAEEAVRHGASLITHLFNAMLPFHHRDPGIIGLLSSDNIDSSKVYYGIIADGVHTHPSALRIANSTHPEGSITPFNGCVQFFMRSTRCSLWFDLGNCNNGGSITPFNGCVQFFMRSTRCSLVHALEVASLHPAKALGLEQHKGTLDFGADADFVILDEGLHVYSTWIAGDLKLT
cccEEEEccccEEEccccEEEccccccccccccccccHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHccccccccccEEEEEcccccccccccccccccccccccccHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHcccEEEEccccccHHHHHHHHHccccccccccccccccccccccHHHHcccccccccccEEEEccccccccHHHHHHHHHHcccccccHHHHHHHHHHHcccEEEEEEccccccccccccccccccccccccccccEEEEEcccEEEcccEEEEcccccccccccccccHHHHHHHcccccccccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccccccccccccEEEEcccccEEEEEEccEEEEc
cccEEEEccccEEcccEEEEEEcccccccccccccccHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHccccccEEEEEEEccccccHHHcccccHHHcccccHHHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHcccEEEEccccccHHHHHHHHHHcccEEHHHHccccccccccccEEEEEEccccccccEEEEEEEccccccHHHHHHHHHHcccccEEEEccccHccccccccEEEEEEcHHHccccccccHEEEHHHHHHHcccccEEEcccEEEEEccEEEEccccccccccccHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHcHHHHcccccccEEEccccccEEEEEccccEEEEEEEccEEEEc
madfrfdcggkliapgfidiqinggfgvdfshdidsvdknVSIVARGILAhgvtsfcptlvtsepQVYKKVLSRlrktpggkhgatvlgahvegpfispdkkgahsLSKIVTFDKGFDSVREVYGNLSNIAIITLAPELAGSMEVIDKLVEQGITvslghssadiNIAEEAVRHGASLITHLFNamlpfhhrdpgiigllssdnidsskvYYGIIAdgvhthpsalriansthpeghssadiHIAEEAVRHGASLITHLFNamlpfhhrdpgiigllssdnidsskvYYGIIAdgvhthpsalriansthpegsitpfngcvQFFMRSTRCSLWfdlgncnnggsitpfngcvQFFMRSTRCSLVHALEVaslhpakalgleqhkgtldfgadadfVILDEGLHVYSTWIAGDLKLT
MADFRFDCGGKLIAPGFIDIQINGGFGVDFSHDIDSVDKNVSIVARGILAHGVtsfcptlvtsepQVYKKVLSRLRKTPGGKHGATVLGAHVEGPFISPDKKGAHSLSKIVTFDKGFDSVREVYGNLSNIAIITLAPELAGSMEVIDKLVEQGITVSLGHSSADINIAEEAVRHGASLITHLFNAMLPFHHRDPGIIGLLSSDNIDSSKVYYGIIADGVHTHPSALRIANSTHPEGHSSADIHIAEEAVRHGASLITHLFNAMLPFHHRDPGIIGLLSSDNIDSSKVYYGIIADGVHTHPSALRIANSTHPEGSITPFNGCVQFFMRSTRCSLWFDLGNCNNGGSITPFNGCVQFFMRSTRCSLVHALEVASLHPAKALGLEQHKGTLDFGADADFVILDEGLHVYSTWIAGDLKLT
MADFRFDCGGKLIAPGFIDIQINGGFGVDFSHDIDSVDKNVSIVARGILAHGVTSFCPTLVTSEPQVYKKVLSRLRKTPGGKHGATVLGAHVEGPFISPDKKGAHSLSKIVTFDKGFDSVREVYGNLSNIAIITLAPELAGSMEVIDKLVEQGITVSLGHSSADINIAEEAVRHGASLITHLFNAMLPFHHRDPGIIGLLSSDNIDSSKVYYGIIADGVHTHPSALRIANSTHPEGHSSADIHIAEEAVRHGASLITHLFNAMLPFHHRDPGIIGLLSSDNIDSSKVYYGIIADGVHTHPSALRIANSTHPEGSITPFNGCVQFFMRSTRCSLWFDLGNCNNGGSITPFNGCVQFFMRSTRCSLVHALEVASLHPAKALGLEQHKGTLDFGADADFVILDEGLHVYSTWIAGDLKLT
***FRFDCGGKLIAPGFIDIQINGGFGVDFSHDIDSVDKNVSIVARGILAHGVTSFCPTLVTSEPQVYKKVLSRLRKTPGGKHGATVLGAHVEGPFISP**KGAHSLSKIVTFDKGFDSVREVYGNLSNIAIITLAPELAGSMEVIDKLVEQGITVSLGHSSADINIAEEAVRHGASLITHLFNAMLPFHHRDPGIIGLLSSDNIDSSKVYYGIIADGVHTHPSALRI************DIHIAEEAVRHGASLITHLFNAMLPFHHRDPGIIGLLSSDNIDSSKVYYGIIADGVHTHPSALRIANSTHPEGSITPFNGCVQFFMRSTRCSLWFDLGNCNNGGSITPFNGCVQFFMRSTRCSLVHALEVASLHPAKALGLEQHKGTLDFGADADFVILDEGLHVYSTWIAGDL***
MADFRFDCGGKLIAPGFIDIQINGGFGVDFSHDIDSVDKNVSIVARGILAHGVTSFCPTLVTSEPQVYKKVLSRLRKTPGGKHGATVLGAHVEGPFISPDKKGAHSLSKIVTFDKGFDSVREVYGNLSNIAIITLAPELAGSMEVIDKLVEQGITVSLGHSSADINIAEEAVRHGASLITHLFNAMLPFHHRDPGIIGLLSSDNIDSSKVYYGIIADGVHTHPSALRIANSTHPEGHSSADIHIAEEAVRHGASLITHLFNAMLPFHHRDPGIIGLLSSDNIDSSKVYYGIIADGVHTHPSALRIANSTHPEGSITPFNGCVQFFMRSTRCSLWFDLGNCNNGGSITPFNGCVQFFMRSTRCSLVHALEVASLHPAKALGLEQHKGTLDFGADADFVILDEGLHVYSTWIAGDLKLT
MADFRFDCGGKLIAPGFIDIQINGGFGVDFSHDIDSVDKNVSIVARGILAHGVTSFCPTLVTSEPQVYKKVLSRLRKTPGGKHGATVLGAHVEGPFISPDKKGAHSLSKIVTFDKGFDSVREVYGNLSNIAIITLAPELAGSMEVIDKLVEQGITVSLGHSSADINIAEEAVRHGASLITHLFNAMLPFHHRDPGIIGLLSSDNIDSSKVYYGIIADGVHTHPSALRIANSTHPEGHSSADIHIAEEAVRHGASLITHLFNAMLPFHHRDPGIIGLLSSDNIDSSKVYYGIIADGVHTHPSALRIANSTHPEGSITPFNGCVQFFMRSTRCSLWFDLGNCNNGGSITPFNGCVQFFMRSTRCSLVHALEVASLHPAKALGLEQHKGTLDFGADADFVILDEGLHVYSTWIAGDLKLT
*ADFRFDCGGKLIAPGFIDIQINGGFGVDFSHDIDSVDKNVSIVARGILAHGVTSFCPTLVTSEPQVYKKVLSRLRKTPGGKHGATVLGAHVEGPFISPDKKGAHSLSKIVTFDKGFDSVREVYGNLSNIAIITLAPELAGSMEVIDKLVEQGITVSLGHSSADINIAEEAVRHGASLITHLFNAMLPFHHRDPGIIGLLSSDNIDSSKVYYGIIADGVHTHPSALRIANSTHPEGHSSADIHIAEEAVRHGASLITHLFNAMLPFHHRDPGIIGLLSSDNIDSSKVYYGIIADGVHTHPSALRIANSTHPEGSITPFNGCVQFFMRSTRCSLWFDLGNCNNGGSITPFNGCVQFFMRSTRCSLVHALEVASLHPAKALGLEQHKGTLDFGADADFVILDEGLHVYSTWIAGDLKLT
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADFRFDCGGKLIAPGFIDIQINGGFGVDFSHDIDSVDKNVSIVARGILAHGVTSFCPTLVTSEPQVYKKVLSRLRKTPGGKHGATVLGAHVEGPFISPDKKGAHSLSKIVTFDKGFDSVREVYGNLSNIAIITLAPELAGSMEVIDKLVEQGITVSLGHSSADINIAEEAVRHGASLITHLFNAMLPFHHRDPGIIGLLSSDNIDSSKVYYGIIADGVHTHPSALRIANSTHPEGHSSADIHIAEEAVRHGASLITHLFNAMLPFHHRDPGIIGLLSSDNIDSSKVYYGIIADGVHTHPSALRIANSTHPEGSITPFNGCVQFFMRSTRCSLWFDLGNCNNGGSITPFNGCVQFFMRSTRCSLVHALEVASLHPAKALGLEQHKGTLDFGADADFVILDEGLHVYSTWIAGDLKLT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query417 2.2.26 [Sep-21-2011]
Q9Y303409 Putative N-acetylglucosam no N/A 0.834 0.850 0.468 3e-94
A7MBC0409 Putative N-acetylglucosam yes N/A 0.834 0.850 0.471 1e-93
Q8JZV7409 Putative N-acetylglucosam yes N/A 0.834 0.850 0.473 3e-93
Q9VR81417 Putative N-acetylglucosam yes N/A 0.820 0.820 0.467 6e-93
Q5BJY6409 Putative N-acetylglucosam yes N/A 0.834 0.850 0.468 3e-92
Q6P0U0404 Putative N-acetylglucosam yes N/A 0.827 0.853 0.467 2e-90
P34480418 Putative N-acetylglucosam yes N/A 0.822 0.820 0.380 6e-70
O32445378 N-acetylglucosamine-6-pho yes N/A 0.525 0.579 0.379 2e-32
O34450396 N-acetylglucosamine-6-pho yes N/A 0.784 0.825 0.293 5e-32
Q84F86387 N-acetylglucosamine-6-pho yes N/A 0.798 0.860 0.309 5e-31
>sp|Q9Y303|NAGA_HUMAN Putative N-acetylglucosamine-6-phosphate deacetylase OS=Homo sapiens GN=AMDHD2 PE=1 SV=2 Back     alignment and function desciption
 Score =  345 bits (886), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 195/416 (46%), Positives = 255/416 (61%), Gaps = 68/416 (16%)

Query: 1   MADFRFDCGGKLIAPGFIDIQINGGFGVDFSHDIDSVDKNVSIVARGILAHGVTSFCPTL 60
           +AD R DCGG+++APGFID+QINGGFGVDFS   + V   V++VAR IL+HGVTSFCPTL
Sbjct: 51  VADERRDCGGRILAPGFIDVQINGGFGVDFSQATEDVGSGVALVARRILSHGVTSFCPTL 110

Query: 61  VTSEPQVYKKVLSRLRKTPGGKHGATVLGAHVEGPFISPDKKGAHSLSKIVTFDK-GFDS 119
           VTS P+VY KV+ ++    GG HGA VLG H+EGPFIS +K+GAH  + + +F+   F  
Sbjct: 111 VTSPPEVYHKVVPQIPVKSGGPHGAGVLGLHLEGPFISREKRGAHPEAHLRSFEADAFQD 170

Query: 120 VREVYGNLSNIAIITLAPELAGSMEVIDKLVEQGITVSLGHSSADINIAEEAVRHGASLI 179
           +   YG L N+ I+TLAPEL  S EVI  L  +GI VSLGHS AD+  AE+AV  GA+ I
Sbjct: 171 LLATYGPLDNVRIVTLAPELGRSHEVIRALTARGICVSLGHSVADLRAAEDAVWSGATFI 230

Query: 180 THLFNAMLPFHHRDPGIIGLLSSDNIDSSK-VYYGIIADGVHTHPSALRIANSTHPEGHS 238
           THLFNAMLPFHHRDPGI+GLL+SD + + + ++YG+IADG HT+P+ALRIA+  HP+   
Sbjct: 231 THLFNAMLPFHHRDPGIVGLLTSDRLPAGRCIFYGMIADGTHTNPAALRIAHRAHPQ--- 287

Query: 239 SADIHIAEEAVRHGASLITHLFNAMLPFHHRDPGIIGLLSSDNIDSSKVYYGIIADGVHT 298
                        G  L+T    A              L   N   +     +  DG+  
Sbjct: 288 -------------GLVLVTDAIPA--------------LGLGNGRHTLGQQEVEVDGLTA 320

Query: 299 HPSALRIANSTHPEGSITPFNGCVQFFMRSTRCSLWFDLGNCNNGGSITPFNGCVQFFMR 358
           +     +A +    GSI P + CV+ F+++T CS+                         
Sbjct: 321 Y-----VAGTKTLSGSIAPMDVCVRHFLQATGCSME------------------------ 351

Query: 359 STRCSLVHALEVASLHPAKALGLEQHKGTLDFGADADFVILDEGLHVYSTWIAGDL 414
                   ALE ASLHPA+ LGLE+ KGTLDFGADADFV+LD+ LHV +T+I+G+L
Sbjct: 352 -------SALEAASLHPAQLLGLEKSKGTLDFGADADFVVLDDSLHVQATYISGEL 400

Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 5EC: .EC: 1EC: .EC: 2EC: 5
>sp|A7MBC0|NAGA_BOVIN Putative N-acetylglucosamine-6-phosphate deacetylase OS=Bos taurus GN=AMDHD2 PE=2 SV=1 Back     alignment and function description
>sp|Q8JZV7|NAGA_MOUSE Putative N-acetylglucosamine-6-phosphate deacetylase OS=Mus musculus GN=Amdhd2 PE=2 SV=1 Back     alignment and function description
>sp|Q9VR81|NAGA_DROME Putative N-acetylglucosamine-6-phosphate deacetylase OS=Drosophila melanogaster GN=CG17065 PE=2 SV=1 Back     alignment and function description
>sp|Q5BJY6|NAGA_RAT Putative N-acetylglucosamine-6-phosphate deacetylase OS=Rattus norvegicus GN=Amdhd2 PE=3 SV=2 Back     alignment and function description
>sp|Q6P0U0|NAGA_DANRE Putative N-acetylglucosamine-6-phosphate deacetylase OS=Danio rerio GN=amdhd2 PE=2 SV=1 Back     alignment and function description
>sp|P34480|NAGA_CAEEL Putative N-acetylglucosamine-6-phosphate deacetylase OS=Caenorhabditis elegans GN=F59B2.3 PE=1 SV=1 Back     alignment and function description
>sp|O32445|NAGA_VIBCH N-acetylglucosamine-6-phosphate deacetylase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=nagA PE=1 SV=2 Back     alignment and function description
>sp|O34450|NAGA_BACSU N-acetylglucosamine-6-phosphate deacetylase OS=Bacillus subtilis (strain 168) GN=nagA PE=1 SV=1 Back     alignment and function description
>sp|Q84F86|NAGA_LYSSH N-acetylglucosamine-6-phosphate deacetylase OS=Lysinibacillus sphaericus GN=nagA PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query417
312374016439 hypothetical protein AND_16646 [Anophele 0.872 0.829 0.515 1e-105
347967666414 AGAP002347-PA [Anopheles gambiae str. PE 0.827 0.833 0.497 1e-103
157128842416 n-acetylglucosamine-6-phosphate deacetyl 0.827 0.829 0.483 1e-100
170048107410 N-acetylglucosamine-6-phosphate deacetyl 0.832 0.846 0.487 1e-100
332024001411 Putative N-acetylglucosamine-6-phosphate 0.820 0.832 0.465 1e-97
307179451405 Putative N-acetylglucosamine-6-phosphate 0.820 0.844 0.462 2e-97
345802401449 PREDICTED: LOW QUALITY PROTEIN: putative 0.930 0.864 0.492 4e-97
345491956409 PREDICTED: putative N-acetylglucosamine- 0.822 0.838 0.468 2e-95
189236112394 PREDICTED: similar to AGAP002347-PA [Tri 0.829 0.878 0.470 4e-95
270005701 948 hypothetical protein TcasGA2_TC007801 [T 0.822 0.361 0.466 6e-95
>gi|312374016|gb|EFR21671.1| hypothetical protein AND_16646 [Anopheles darlingi] Back     alignment and taxonomy information
 Score =  386 bits (992), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 215/417 (51%), Positives = 276/417 (66%), Gaps = 53/417 (12%)

Query: 2   ADFRFDCGGKLIAPGFIDIQINGGFGVDFSHDIDSVDKNVSIVARGILAHGVTSFCPTLV 61
           AD + DC G +IAPGFID+QINGG+GVDFS D+++V++ V+ VA+G+LAHGVTSFCPTLV
Sbjct: 56  ADQQIDCHGAIIAPGFIDLQINGGYGVDFSFDVNTVEQGVAKVAKGLLAHGVTSFCPTLV 115

Query: 62  TSEPQVYKKVLSRLRKTPGGKHGATVLGAHVEGPFISPDKKGAHSLSKIVTFDKGFDSVR 121
           TS    Y  VL R+ +  GG+HGATVLG HVEGPFI+ +KKGAH    I  FD+G  +VR
Sbjct: 116 TSPSATYHTVLPRIPRQAGGRHGATVLGCHVEGPFINTNKKGAHPPECIREFDEGIKTVR 175

Query: 122 EVYGNLSNIAIITLAPELAGSMEVIDKLVEQGITVSLGHSSADINIAEEAVRHGASLITH 181
           EVYG+L N+ I+TLAPE  GS EVI +L   GITVS+GHS A+++  EEAVRHGA L+TH
Sbjct: 176 EVYGSLDNVQIVTLAPEKRGSSEVIQELSSSGITVSVGHSMANLSDGEEAVRHGARLVTH 235

Query: 182 LFNAMLPFHHRDPGIIGLLSSDNI-DSSKVYYGIIADGVHTHPSALRIANSTHPEGHSSA 240
           LFNAMLPFHHRDPG++GLL++DNI   + VY+GII+DGVHTHP+ALRIA  THP      
Sbjct: 236 LFNAMLPFHHRDPGLVGLLTTDNIPKDALVYFGIISDGVHTHPAALRIAYKTHPA----- 290

Query: 241 DIHIAEEAVRHGASLITHLFNAM--LPFHHRDPGIIGLLSSDNIDSSKVYYGIIADGVHT 298
                      G  L+T   +AM      HR    IG +  + I S + Y          
Sbjct: 291 -----------GLILVTDAISAMGLAEGRHR----IGQMEIE-IRSGRAY---------- 324

Query: 299 HPSALRIANSTHPEGSITPFNGCVQFFMRSTRCSLWFDLGNCNNGGSITPFNGCVQFFMR 358
                 +A +    GSI P + C++FF ++     W      + GG+    + C     R
Sbjct: 325 ------VAGTNTLCGSIAPMDECIRFF-KTASSKYW------HPGGA----DSCPITNSR 367

Query: 359 STR--CSLVHALEVASLHPAKALGLEQHKGTLDFGADADFVILDEGLHVYSTWIAGD 413
           S+   CS+ +ALE ASLHPA+ LG+E  KGTL++GADADFV+LD+GL+V STWIAGD
Sbjct: 368 SSLVGCSIEYALEAASLHPARCLGIETKKGTLEYGADADFVLLDDGLNVQSTWIAGD 424

Source: Anopheles darlingi

Species: Anopheles darlingi

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|347967666|ref|XP_312617.5| AGAP002347-PA [Anopheles gambiae str. PEST] gi|333468356|gb|EAA08223.5| AGAP002347-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|157128842|ref|XP_001655220.1| n-acetylglucosamine-6-phosphate deacetylase [Aedes aegypti] gi|108882175|gb|EAT46400.1| AAEL002430-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170048107|ref|XP_001851539.1| N-acetylglucosamine-6-phosphate deacetylase [Culex quinquefasciatus] gi|167870291|gb|EDS33674.1| N-acetylglucosamine-6-phosphate deacetylase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|332024001|gb|EGI64219.1| Putative N-acetylglucosamine-6-phosphate deacetylase [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307179451|gb|EFN67775.1| Putative N-acetylglucosamine-6-phosphate deacetylase [Camponotus floridanus] Back     alignment and taxonomy information
>gi|345802401|ref|XP_537001.3| PREDICTED: LOW QUALITY PROTEIN: putative N-acetylglucosamine-6-phosphate deacetylase [Canis lupus familiaris] Back     alignment and taxonomy information
>gi|345491956|ref|XP_001601946.2| PREDICTED: putative N-acetylglucosamine-6-phosphate deacetylase-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|189236112|ref|XP_974011.2| PREDICTED: similar to AGAP002347-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270005701|gb|EFA02149.1| hypothetical protein TcasGA2_TC007801 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query417
MGI|MGI:2443978409 Amdhd2 "amidohydrolase domain 0.565 0.577 0.600 5.1e-74
ZFIN|ZDB-GENE-040426-1871404 amdhd2 "amidohydrolase domain 0.563 0.581 0.599 5.1e-74
UNIPROTKB|Q9Y303409 AMDHD2 "Putative N-acetylgluco 0.565 0.577 0.596 8.4e-74
UNIPROTKB|E2R3Q7528 E2R3Q7 "Uncharacterized protei 0.565 0.446 0.600 8.4e-74
UNIPROTKB|A7MBC0409 AMDHD2 "Putative N-acetylgluco 0.565 0.577 0.600 1.7e-73
RGD|1304601409 Amdhd2 "amidohydrolase domain 0.565 0.577 0.596 2.2e-73
UNIPROTKB|F1SUH7412 F1SUH7 "N-acetylglucosamine-6- 0.565 0.572 0.597 5.9e-73
FB|FBgn0031099417 CG17065 [Drosophila melanogast 0.556 0.556 0.594 1.2e-72
UNIPROTKB|F1P5J8423 AMDHD2 "N-acetylglucosamine-6- 0.563 0.555 0.592 5.3e-72
UNIPROTKB|H3BSV9300 AMDHD2 "Putative N-acetylgluco 0.386 0.536 0.511 2.9e-70
MGI|MGI:2443978 Amdhd2 "amidohydrolase domain containing 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 747 (268.0 bits), Expect = 5.1e-74, P = 5.1e-74
 Identities = 143/238 (60%), Positives = 180/238 (75%)

Query:     1 MADFRFDCGGKLIAPGFIDIQINGGFGVDFSHDIDSVDKNVSIVARGILAHGVTSFCPTL 60
             +AD + DCGG+++APGFID+QINGGFGVDFS   + V   V++VAR +L+HGVTSFCPTL
Sbjct:    51 VADEQRDCGGRILAPGFIDVQINGGFGVDFSKATEDVGSGVALVARRLLSHGVTSFCPTL 110

Query:    61 VTSEPQVYKKVLSRLRKTPGGKHGATVLGAHVEGPFISPDKKGAHSLSKIVTFD-KGFDS 119
             VTS P+VY KVL ++    GG HGA VLG H+EGPFIS +K+GAH  + + +F+   F  
Sbjct:   111 VTSPPEVYHKVLPQIPVKSGGPHGAGVLGVHLEGPFISREKRGAHPEAYLRSFEANAFHD 170

Query:   120 VREVYGNLSNIAIITLAPELAGSMEVIDKLVEQGITVSLGHSSADINIAEEAVRHGASLI 179
             V   YG L N+ I+TLAPEL  S EVI  L  QGI VSLGHS AD+  AE AV+ GA+ I
Sbjct:   171 VLATYGPLDNVCIVTLAPELDRSHEVIQALTAQGIRVSLGHSVADLRAAEVAVQSGATFI 230

Query:   180 THLFNAMLPFHHRDPGIIGLLSSDNIDSSK-VYYGIIADGVHTHPSALRIANSTHPEG 236
             THLFNAMLPFHHRDPGI+GLL+SD +     ++YG+IADG+HT+P+ALRIA+  HP+G
Sbjct:   231 THLFNAMLPFHHRDPGIVGLLTSDQLPPGHCIFYGMIADGIHTNPAALRIAHRAHPQG 288
GO:0005575 "cellular_component" evidence=ND
GO:0005975 "carbohydrate metabolic process" evidence=IEA
GO:0006044 "N-acetylglucosamine metabolic process" evidence=IEA
GO:0008448 "N-acetylglucosamine-6-phosphate deacetylase activity" evidence=ISO
GO:0016787 "hydrolase activity" evidence=IEA
GO:0016810 "hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds" evidence=IEA
GO:0019262 "N-acetylneuraminate catabolic process" evidence=TAS
GO:0046872 "metal ion binding" evidence=IEA
ZFIN|ZDB-GENE-040426-1871 amdhd2 "amidohydrolase domain containing 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y303 AMDHD2 "Putative N-acetylglucosamine-6-phosphate deacetylase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2R3Q7 E2R3Q7 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|A7MBC0 AMDHD2 "Putative N-acetylglucosamine-6-phosphate deacetylase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1304601 Amdhd2 "amidohydrolase domain containing 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1SUH7 F1SUH7 "N-acetylglucosamine-6-phosphate deacetylase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
FB|FBgn0031099 CG17065 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1P5J8 AMDHD2 "N-acetylglucosamine-6-phosphate deacetylase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|H3BSV9 AMDHD2 "Putative N-acetylglucosamine-6-phosphate deacetylase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6P0U0NAGA_DANRE3, ., 5, ., 1, ., 2, 50.46740.82730.8539yesN/A
Q8JZV7NAGA_MOUSE3, ., 5, ., 1, ., 2, 50.47350.83450.8508yesN/A
Q9VR81NAGA_DROME3, ., 5, ., 1, ., 2, 50.46730.82010.8201yesN/A
A7MBC0NAGA_BOVIN3, ., 5, ., 1, ., 2, 50.47110.83450.8508yesN/A
Q84F86NAGA_LYSSH3, ., 5, ., 1, ., 2, 50.30930.79850.8604yesN/A
Q5BJY6NAGA_RAT3, ., 5, ., 1, ., 2, 50.46870.83450.8508yesN/A
P34480NAGA_CAEEL3, ., 5, ., 1, ., 2, 50.38000.82250.8205yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.5.1.25LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query417
cd00854374 cd00854, NagA, N-acetylglucosamine-6-phosphate dea 1e-102
COG1820380 COG1820, NagA, N-acetylglucosamine-6-phosphate dea 8e-67
TIGR00221380 TIGR00221, nagA, N-acetylglucosamine-6-phosphate d 2e-51
PRK11170382 PRK11170, nagA, N-acetylglucosamine-6-phosphate de 3e-49
COG1820380 COG1820, NagA, N-acetylglucosamine-6-phosphate dea 2e-37
TIGR00221380 TIGR00221, nagA, N-acetylglucosamine-6-phosphate d 1e-26
PRK11170382 PRK11170, nagA, N-acetylglucosamine-6-phosphate de 5e-17
pfam01979307 pfam01979, Amidohydro_1, Amidohydrolase family 8e-05
PRK10657388 PRK10657, PRK10657, isoaspartyl dipeptidase; Provi 1e-04
PRK09356406 PRK09356, PRK09356, imidazolonepropionase; Validat 1e-04
pfam07969392 pfam07969, Amidohydro_3, Amidohydrolase family 2e-04
cd01296371 cd01296, Imidazolone-5PH, Imidazolonepropionase/im 3e-04
PRK06189451 PRK06189, PRK06189, allantoinase; Provisional 4e-04
TIGR01224377 TIGR01224, hutI, imidazolonepropionase 4e-04
PRK09228433 PRK09228, PRK09228, guanine deaminase; Provisional 5e-04
COG1228406 COG1228, HutI, Imidazolonepropionase and related a 5e-04
COG0402421 COG0402, SsnA, Cytosine deaminase and related meta 6e-04
cd01315447 cd01315, L-HYD_ALN, L-Hydantoinases (L-HYDs) and A 8e-04
TIGR02967401 TIGR02967, guan_deamin, guanine deaminase 0.001
cd01309359 cd01309, Met_dep_hydrolase_C, Metallo-dependent hy 0.001
pfam1359466 pfam13594, Amidohydro_5, Amidohydrolase 0.001
COG1574535 COG1574, COG1574, Predicted metal-dependent hydrol 0.003
PRK08323459 PRK08323, PRK08323, phenylhydantoinase; Validated 0.003
PRK07228445 PRK07228, PRK07228, N-ethylammeline chlorohydrolas 0.004
>gnl|CDD|238434 cd00854, NagA, N-acetylglucosamine-6-phosphate deacetylase, NagA, catalyzes the hydrolysis of the N-acetyl group of N-acetyl-glucosamine-6-phosphate (GlcNAc-6-P) to glucosamine 6-phosphate and acetate Back     alignment and domain information 
 Score =  307 bits (788), Expect = e-102
 Identities = 143/418 (34%), Positives = 196/418 (46%), Gaps = 94/418 (22%)

Query: 5   RFDCGGKLIAPGFIDIQINGGFGVDFSHDIDSVDKNVSIVARGILAHGVTSFCPTLVTSE 64
             D  G+ + PGFIDI I+GG G DF    D   + +  +A  +  HG TSF PT VT+ 
Sbjct: 41  IIDLKGQYLVPGFIDIHIHGGGGADFM---DGTAEALKTIAEALAKHGTTSFLPTTVTAP 97

Query: 65  PQVYKKVLSRLRKTPGGKHGATVLGAHVEGPFISPDKKGAHSLSKIVTFDKG-FDSVREV 123
           P+   K L+ + +      GA +LG H+EGPFISP+KKGAH    +   D        E 
Sbjct: 98  PEEIAKALAAIAEAIAEGQGAEILGIHLEGPFISPEKKGAHPPEYLRAPDPEELKKWLEA 157

Query: 124 YGNLSNIAIITLAPELAGSMEVIDKLVEQGITVSLGHSSADINIAEEAVRHGASLITHLF 183
            G    I ++TLAPEL G++E+I  LVE+GI VS+GHS A    A  A   GA+ +THLF
Sbjct: 158 AGG--LIKLVTLAPELDGALELIRYLVERGIIVSIGHSDATYEQAVAAFEAGATHVTHLF 215

Query: 184 NAMLPFHHRDPGIIG-LLSSDNIDSSKVYYGIIADGVHTHPSALRIANSTHPEGHSSADI 242
           NAM P HHR+PG++G  LS D++     Y  +IADG+H HP+A+R+A             
Sbjct: 216 NAMSPLHHREPGVVGAALSDDDV-----YAELIADGIHVHPAAVRLAYRAKG-------- 262

Query: 243 HIAEEAVRHGASLITHLFNAMLPFHHRDPGIIGLLSSDNIDSSKVYYGIIADGVHT---- 298
                       L+T   +AM           GL                 DG +     
Sbjct: 263 -------ADKIVLVT---DAMAA--------AGL----------------PDGEYELGGQ 288

Query: 299 ----HPSALRIANSTHPEGSITPFNGCVQFFMRSTRCSLWFDLGNCNNGGSITPFNGCVQ 354
                    R+A+ T   GS    +  V+  ++   C L                     
Sbjct: 289 TVTVKDGVARLADGT-LAGSTLTMDQAVRNMVKWGGCPLE-------------------- 327

Query: 355 FFMRSTRCSLVHALEVASLHPAKALGLEQHKGTLDFGADADFVILDEGLHVYSTWIAG 412
                       A+ +ASL+PAK LGL+  KG+L  G DAD V+LD+ L+V +TWI G
Sbjct: 328 -----------EAVRMASLNPAKLLGLDDRKGSLKPGKDADLVVLDDDLNVKATWING 374

This is the first committed step in the biosynthetic pathway to amino-sugar-nucleotides, which is needed for cell wall peptidoglycan and teichoic acid biosynthesis. Deacetylation of N-acetylglucosamine is also important in lipopolysaccharide synthesis and cell wall recycling. Length = 374
>gnl|CDD|224733 COG1820, NagA, N-acetylglucosamine-6-phosphate deacetylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|232881 TIGR00221, nagA, N-acetylglucosamine-6-phosphate deacetylase Back     alignment and domain information
>gnl|CDD|183010 PRK11170, nagA, N-acetylglucosamine-6-phosphate deacetylase; Provisional Back     alignment and domain information
>gnl|CDD|224733 COG1820, NagA, N-acetylglucosamine-6-phosphate deacetylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|232881 TIGR00221, nagA, N-acetylglucosamine-6-phosphate deacetylase Back     alignment and domain information
>gnl|CDD|183010 PRK11170, nagA, N-acetylglucosamine-6-phosphate deacetylase; Provisional Back     alignment and domain information
>gnl|CDD|216825 pfam01979, Amidohydro_1, Amidohydrolase family Back     alignment and domain information
>gnl|CDD|182623 PRK10657, PRK10657, isoaspartyl dipeptidase; Provisional Back     alignment and domain information
>gnl|CDD|236478 PRK09356, PRK09356, imidazolonepropionase; Validated Back     alignment and domain information
>gnl|CDD|219672 pfam07969, Amidohydro_3, Amidohydrolase family Back     alignment and domain information
>gnl|CDD|238621 cd01296, Imidazolone-5PH, Imidazolonepropionase/imidazolone-5-propionate hydrolase (Imidazolone-5PH) catalyzes the third step in the histidine degradation pathway, the hydrolysis of (S)-3-(5-oxo-4,5-dihydro-3H-imidazol-4-yl)propanoate to N-formimidoyl-L-glutamate Back     alignment and domain information
>gnl|CDD|235732 PRK06189, PRK06189, allantoinase; Provisional Back     alignment and domain information
>gnl|CDD|233321 TIGR01224, hutI, imidazolonepropionase Back     alignment and domain information
>gnl|CDD|236419 PRK09228, PRK09228, guanine deaminase; Provisional Back     alignment and domain information
>gnl|CDD|224149 COG1228, HutI, Imidazolonepropionase and related amidohydrolases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|223479 COG0402, SsnA, Cytosine deaminase and related metal-dependent hydrolases [Nucleotide transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|238640 cd01315, L-HYD_ALN, L-Hydantoinases (L-HYDs) and Allantoinase (ALN); L-Hydantoinases are a member of the dihydropyrimidinase family, which catalyzes the reversible hydrolytic ring opening of dihydropyrimidines and hydantoins (five-membered cyclic diamides used in biotechnology) Back     alignment and domain information
>gnl|CDD|132012 TIGR02967, guan_deamin, guanine deaminase Back     alignment and domain information
>gnl|CDD|238634 cd01309, Met_dep_hydrolase_C, Metallo-dependent hydrolases, subgroup C is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>gnl|CDD|222250 pfam13594, Amidohydro_5, Amidohydrolase Back     alignment and domain information
>gnl|CDD|224490 COG1574, COG1574, Predicted metal-dependent hydrolase with the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>gnl|CDD|236240 PRK08323, PRK08323, phenylhydantoinase; Validated Back     alignment and domain information
>gnl|CDD|180895 PRK07228, PRK07228, N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 417
COG1820380 NagA N-acetylglucosamine-6-phosphate deacetylase [ 100.0
TIGR00221380 nagA N-acetylglucosamine-6-phosphate deacetylase. 100.0
PRK11170382 nagA N-acetylglucosamine-6-phosphate deacetylase; 100.0
KOG3892|consensus407 100.0
cd00854374 NagA N-acetylglucosamine-6-phosphate deacetylase, 100.0
TIGR03583365 EF_0837 probable amidohydrolase EF_0837/AHA_3915. 99.96
TIGR02033454 D-hydantoinase D-hydantoinase. This model represen 99.94
KOG2584|consensus522 99.93
PRK10027 588 cryptic adenine deaminase; Provisional 99.91
TIGR01975389 isoAsp_dipep isoaspartyl dipeptidase IadA. The L-i 99.91
PRK13404477 dihydropyrimidinase; Provisional 99.9
COG0044430 PyrC Dihydroorotase and related cyclic amidohydrol 99.9
cd01299342 Met_dep_hydrolase_A Metallo-dependent hydrolases, 99.9
COG1001 584 AdeC Adenine deaminase [Nucleotide transport and m 99.9
TIGR01178 552 ade adenine deaminase. The family described by thi 99.89
PRK08417386 dihydroorotase; Provisional 99.89
PRK15446383 phosphonate metabolism protein PhnM; Provisional 99.88
TIGR02318376 phosphono_phnM phosphonate metabolism protein PhnM 99.87
PRK08323459 phenylhydantoinase; Validated 99.87
cd01314447 D-HYD D-hydantoinases (D-HYD) also called dihydrop 99.87
COG3964386 Predicted amidohydrolase [General function predict 99.87
PRK09236444 dihydroorotase; Reviewed 99.87
PRK12394379 putative metallo-dependent hydrolase; Provisional 99.86
PRK07627425 dihydroorotase; Provisional 99.86
PRK04250398 dihydroorotase; Provisional 99.86
TIGR00857411 pyrC_multi dihydroorotase, multifunctional complex 99.86
PLN02942486 dihydropyrimidinase 99.86
PRK07575438 dihydroorotase; Provisional 99.85
PRK08044449 allantoinase; Provisional 99.85
PRK06189451 allantoinase; Provisional 99.85
cd01308387 Isoaspartyl-dipeptidase Isoaspartyl dipeptidase hy 99.85
cd01315447 L-HYD_ALN L-Hydantoinases (L-HYDs) and Allantoinas 99.85
PRK09060444 dihydroorotase; Validated 99.85
TIGR03178443 allantoinase allantoinase. This enzyme carries out 99.85
PRK10657388 isoaspartyl dipeptidase; Provisional 99.85
PRK09059429 dihydroorotase; Validated 99.84
PRK09237380 dihydroorotase; Provisional 99.84
PRK07369418 dihydroorotase; Provisional 99.84
PRK09357423 pyrC dihydroorotase; Validated 99.84
PRK01211409 dihydroorotase; Provisional 99.83
COG1228406 HutI Imidazolonepropionase and related amidohydrol 99.83
PRK06687419 chlorohydrolase; Validated 99.83
cd01307338 Met_dep_hydrolase_B Metallo-dependent hydrolases, 99.82
PRK09228433 guanine deaminase; Provisional 99.82
PRK07228445 N-ethylammeline chlorohydrolase; Provisional 99.82
PRK02382443 dihydroorotase; Provisional 99.82
cd01317374 DHOase_IIa Dihydroorotase (DHOase), subgroup IIa; 99.82
PRK08203451 hydroxydechloroatrazine ethylaminohydrolase; Revie 99.82
PRK00369392 pyrC dihydroorotase; Provisional 99.82
PRK09045443 N-ethylammeline chlorohydrolase; Provisional 99.81
PLN02795505 allantoinase 99.81
PRK15493435 5-methylthioadenosine/S-adenosylhomocysteine deami 99.8
cd01295 422 AdeC Adenine deaminase (AdeC) directly deaminates 99.8
cd01297415 D-aminoacylase D-aminoacylases (N-acyl-D-Amino aci 99.8
PRK09356406 imidazolonepropionase; Validated 99.8
cd01298411 ATZ_TRZ_like TRZ/ATZ family contains enzymes from 99.8
PRK08204449 hypothetical protein; Provisional 99.8
TIGR02967401 guan_deamin guanine deaminase. This model describe 99.8
PRK12393457 amidohydrolase; Provisional 99.78
PRK06380418 metal-dependent hydrolase; Provisional 99.78
TIGR01224377 hutI imidazolonepropionase. This enzyme catalyzes 99.78
cd01296371 Imidazolone-5PH Imidazolonepropionase/imidazolone- 99.78
PRK07213375 chlorohydrolase; Provisional 99.78
PRK09061509 D-glutamate deacylase; Validated 99.78
PRK13985 568 ureB urease subunit beta; Provisional 99.77
cd01318361 DHOase_IIb Dihydroorotase (DHOase), subgroup IIb; 99.77
cd01302337 Cyclic_amidohydrolases Cyclic amidohydrolases, inc 99.77
PRK13207 568 ureC urease subunit alpha; Reviewed 99.76
cd00375 567 Urease_alpha Urease alpha-subunit; Urease is a nic 99.76
PRK13206 573 ureC urease subunit alpha; Reviewed 99.76
PRK13308 569 ureC urease subunit alpha; Reviewed 99.76
cd01312381 Met_dep_hydrolase_D Metallo-dependent hydrolases, 99.76
cd01303429 GDEase Guanine deaminase (GDEase). Guanine deamina 99.76
PLN02303 837 urease 99.75
PRK07203442 putative chlorohydrolase/aminohydrolase; Validated 99.75
TIGR03121556 one_C_dehyd_A formylmethanofuran dehydrogenase sub 99.75
PRK14085382 imidazolonepropionase; Provisional 99.74
COG3454377 Metal-dependent hydrolase involved in phosphonate 99.74
cd01293398 Bact_CD Bacterial cytosine deaminase and related m 99.73
PRK06151488 N-ethylammeline chlorohydrolase; Provisional 99.73
cd01313418 Met_dep_hydrolase_E Metallo-dependent hydrolases, 99.72
PRK08418408 chlorohydrolase; Provisional 99.71
PRK09229456 N-formimino-L-glutamate deiminase; Validated 99.71
TIGR01792 567 urease_alph urease, alpha subunit. This model desc 99.7
PRK06038430 N-ethylammeline chlorohydrolase; Provisional 99.7
TIGR03314441 Se_ssnA putative selenium metabolism protein SsnA. 99.7
TIGR02022455 hutF formiminoglutamate deiminase. In some species 99.7
PRK08393424 N-ethylammeline chlorohydrolase; Provisional 99.7
cd01306325 PhnM PhnM is believed to be a subunit of the membr 99.69
COG1820380 NagA N-acetylglucosamine-6-phosphate deacetylase [ 99.69
PRK07572426 cytosine deaminase; Validated 99.68
PF01979333 Amidohydro_1: Amidohydrolase family; InterPro: IPR 99.66
cd01304541 FMDH_A Formylmethanofuran dehydrogenase (FMDH) sub 99.66
cd01316344 CAD_DHOase The eukaryotic CAD protein is a trifunc 99.65
PRK13309 572 ureC urease subunit alpha; Reviewed 99.65
PRK07583438 cytosine deaminase-like protein; Validated 99.63
cd01309359 Met_dep_hydrolase_C Metallo-dependent hydrolases, 99.63
COG0402421 SsnA Cytosine deaminase and related metal-dependen 99.61
PRK09230426 cytosine deaminase; Provisional 99.61
PRK05985391 cytosine deaminase; Provisional 99.6
PF13147304 Amidohydro_4: Amidohydrolase; PDB: 3SFW_B 2FTW_A 2 99.59
KOG3968|consensus439 99.58
PRK06846410 putative deaminase; Validated 99.51
COG1574535 Predicted metal-dependent hydrolase with the TIM-b 99.49
PRK11170382 nagA N-acetylglucosamine-6-phosphate deacetylase; 99.46
TIGR00221380 nagA N-acetylglucosamine-6-phosphate deacetylase. 99.43
cd01300479 YtcJ_like YtcJ_like metal dependent amidohydrolase 99.19
KOG3892|consensus407 99.15
COG3653579 N-acyl-D-aspartate/D-glutamate deacylase [Secondar 99.05
PF1359468 Amidohydro_5: Amidohydrolase; PDB: 4F0R_A 4F0S_A 1 99.05
cd01294335 DHOase Dihydroorotase (DHOase) catalyzes the rever 99.02
cd00854374 NagA N-acetylglucosamine-6-phosphate deacetylase, 98.77
cd01305263 archeal_chlorohydrolases Predicted chlorohydrolase 98.69
COG0804 568 UreC Urea amidohydrolase (urease) alpha subunit [A 98.68
COG1229575 FwdA Formylmethanofuran dehydrogenase subunit A [E 98.54
TIGR00856341 pyrC_dimer dihydroorotase, homodimeric type. This 98.16
TIGR00010252 hydrolase, TatD family. Several genomes have multi 97.87
PF07969404 Amidohydro_3: Amidohydrolase family; InterPro: IPR 97.8
cd01292275 metallo-dependent_hydrolases Superfamily of metall 97.58
PLN02599364 dihydroorotase 97.29
cd01310251 TatD_DNAse TatD like proteins; E.coli TatD is a cy 97.27
PRK10812265 putative DNAse; Provisional 96.67
PRK06886329 hypothetical protein; Validated 96.44
COG0084256 TatD Mg-dependent DNase [DNA replication, recombin 96.43
PRK11449258 putative deoxyribonuclease YjjV; Provisional 96.08
cd00530293 PTE Phosphotriesterase (PTE) catalyzes the hydroly 96.02
COG1099254 Predicted metal-dependent hydrolases with the TIM- 95.51
PRK09875292 putative hydrolase; Provisional 95.32
PF12890142 DHOase: Dihydro-orotase-like; InterPro: IPR024403 94.54
PRK10425258 DNase TatD; Provisional 94.01
PRK05451345 dihydroorotase; Provisional 93.99
COG4464254 CapC Capsular polysaccharide biosynthesis protein 92.34
TIGR03583365 EF_0837 probable amidohydrolase EF_0837/AHA_3915. 91.25
COG5016472 Pyruvate/oxaloacetate carboxyltransferase [Energy 89.57
PF07969404 Amidohydro_3: Amidohydrolase family; InterPro: IPR 89.51
PF01026255 TatD_DNase: TatD related DNase The Pfam entry find 89.47
TIGR01430324 aden_deam adenosine deaminase. This family include 89.36
TIGR01235 1143 pyruv_carbox pyruvate carboxylase. This enzyme pla 84.14
cd01320325 ADA Adenosine deaminase (ADA) is a monomeric zinc 82.64
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 82.09
cd00956211 Transaldolase_FSA Transaldolase-like fructose-6-ph 81.5
>COG1820 NagA N-acetylglucosamine-6-phosphate deacetylase [Carbohydrate transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=8.6e-75  Score=551.44  Aligned_cols=341  Identities=40%  Similarity=0.636  Sum_probs=313.5

Q ss_pred             CCeEEeCCCCEeeccchhhcccCCCCCCCCCCCCCcHHHHHHHHHHHHhCCceeeeeccCCCCHHHHHHHHHHHHcCCCC
Q psy12256          2 ADFRFDCGGKLIAPGFIDIQINGGFGVDFSHDIDSVDKNVSIVARGILAHGVTSFCPTLVTSEPQVYKKVLSRLRKTPGG   81 (417)
Q Consensus         2 ~~~vID~~G~~v~PG~ID~H~H~~~g~~~~~~~~~~~~~~~~~~~~~~~~GvTt~~~~~~~~~~~~~~~~~~~~~~~~~~   81 (417)
                      ..++||.+|.+|+|||||+|+||++|.+|++..  ..++++++++.++++|||+|+||.+|.+.+.+.++++++++++. 
T Consensus        39 ~~e~id~~G~~l~PGfID~hihG~gG~~~~D~~--~~~~l~~i~~~~~~~GtTsfLpT~iT~~~e~i~~al~~~~e~~~-  115 (380)
T COG1820          39 DAEIIDLKGALLVPGFIDLHIHGGGGADFMDAG--SVETLETMAEAHLRHGTTSFLPTLITASLEKIKAALRAIREAIA-  115 (380)
T ss_pred             cceeecCCCCEecccEEEEeecCcCcccccCcc--CHHHHHHHHHHhhhcCeeeeeeecccCCHHHHHHHHHHHHHHHh-
Confidence            368999999999999999999999999998732  37789999999999999999999999999999999999998875 


Q ss_pred             CCCceeEEeeeeCCCCCCCCCCCCCCcccCCCc-HHHHHHHHHhCCCCCEEEEEecCCCCChHHHHHHHHHCCCeeeecC
Q psy12256         82 KHGATVLGAHVEGPFISPDKKGAHSLSKIVTFD-KGFDSVREVYGNLSNIAIITLAPELAGSMEVIDKLVEQGITVSLGH  160 (417)
Q Consensus        82 ~~~~~~~G~~leGp~~~~~~~G~~~~~~~~~~~-~~~~~~~~~~g~~~~ik~~~~~pe~~~~~~~i~~~~~~gi~v~~GH  160 (417)
                      ..++.++|+||||||+|+.++|+|++++++.|+ +++++|++.+++  .|+++|++||.++..++++.+.++|+++|+||
T Consensus       116 ~~ga~ilGiHLEGP~ls~~kkGAh~~~~ir~~~~~~~~~~~~~a~g--~i~~vTlAPE~~~~~e~i~~l~~~giivs~GH  193 (380)
T COG1820         116 KGGAQILGIHLEGPFLSPEKKGAHNPEYIRPPDPEELEQLIAAADG--LIKLVTLAPELDGTKELIRLLANAGIVVSIGH  193 (380)
T ss_pred             ccCCceEEEEeecCccCHhhccCCCHHHhCCCCHHHHHHHHhhccC--ceEEEEECCCCCCCHHHHHHHHhCCeEEEecC
Confidence            577899999999999999999999999999999 899999998653  58999999999988999999999999999999


Q ss_pred             CcCCHHHHHHHHHCCCCeEeeCCCCcccccccCCceEEeecCCCCCCCceEEEEecCCCcCCHHHHHHHHhhCCCCCCCC
Q psy12256        161 SSADINIAEEAVRHGASLITHLFNAMLPFHHRDPGIIGLLSSDNIDSSKVYYGIIADGVHTHPSALRIANSTHPEGHSSA  240 (417)
Q Consensus       161 ~~~~~~~~~~a~~~G~~~i~Hl~~~~~~~~~r~~g~~~~~~~~~l~~~~~~~~~i~dg~h~~~~~~~~~~~~~~~~h~~~  240 (417)
                      |+++|+++++++++|++++||+||+|++++||+||++++++..    +++|||+||||+||||..++++++.+...+   
T Consensus       194 S~Atye~~~~a~~~Ga~~~THlfNaMs~l~hREPGvvGA~L~~----~~~~~eiIaDG~HVhP~~~~ia~~~kg~~~---  266 (380)
T COG1820         194 SNATYEQARAAFEAGATFVTHLFNAMSGLHHREPGVVGAALDN----PDVYAEIIADGVHVHPAAIRLALKAKGGDK---  266 (380)
T ss_pred             ccccHHHHHHHHHhCccEEEeeccCCCCCCCCCCcccceeecC----CCeEEEEEccCcccCHHHHHHHHhccCCce---
Confidence            9999999999999999999999999999999999999998653    579999999999999999999999985444   


Q ss_pred             CHHHHHHHHHccceeeeccccccCCCCCCCCccccccccccccCCcceeeeeCCceeeChHHHHHHHhcCCCCeEEeeCC
Q psy12256        241 DIHIAEEAVRHGASLITHLFNAMLPFHHRDPGIIGLLSSDNIDSSKVYYGIIADGVHTHPSALRIANSTHPEGSITPFNG  320 (417)
Q Consensus       241 ~~e~~~~a~~~g~~~~td~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~i~dg~~~~~~~l~~~~~~~~~~~~~~~d~  320 (417)
                                  +.++||++.+.           |+                +||.+.....           .+.+.||
T Consensus       267 ------------i~LVTDam~a~-----------G~----------------~dg~y~lgg~-----------~V~v~~g  296 (380)
T COG1820         267 ------------IVLVTDAMAAA-----------GL----------------PDGEYILGGQ-----------TVTVADG  296 (380)
T ss_pred             ------------EEEEEcccccc-----------CC----------------CCccEEECCE-----------EEEEECC
Confidence                        37899999877           77                7887766554           6788888


Q ss_pred             eeeeeeecccccceeeCCCCCCCCCCCchhHHHHHhhhccCCCHHHHHHHHhHHHHHHcCCCCCccccccCCCccEEEEc
Q psy12256        321 CVQFFMRSTRCSLWFDLGNCNNGGSITPFNGCVQFFMRSTRCSLVHALEVASLHPAKALGLEQHKGTLDFGADADFVILD  400 (417)
Q Consensus       321 ~~~~~~~~~~~~~~~~~~~~~~~g~~~~l~~~~~~~~~~~~~~~~~~l~~~t~~pA~~l~l~~~~G~l~~G~~ADlvv~d  400 (417)
                      .+             ...+|+++||.++|...+++++++.+++++||++|+|+|||+.+|+.+++|+|++|++||||++|
T Consensus       297 ~~-------------~~~~GtLAGS~Ltm~~avrn~v~~~~~~~~eAv~maS~~PA~~lgl~~~~G~i~~G~~Adlvvld  363 (380)
T COG1820         297 AR-------------RLEDGTLAGSTLTMDEAVRNLVEWGGISLAEAVRMASLNPAKALGLDDRLGSIKPGKDADLVVLD  363 (380)
T ss_pred             EE-------------ECCCCceeeeeeeHHHHHHHHHHHhCCCHHHHHHHhhhhHHHHhCCcCcccccCCCcccCEEEEC
Confidence            54             46899999999999999999999999999999999999999999999888999999999999999


Q ss_pred             CCCceeEEEECCEEecC
Q psy12256        401 EGLHVYSTWIAGDLKLT  417 (417)
Q Consensus       401 ~~~~v~~v~~~G~~v~~  417 (417)
                      .|.+|..||++|++++.
T Consensus       364 ~d~~v~~T~i~G~~~~~  380 (380)
T COG1820         364 DDLNVKATWINGEKVFN  380 (380)
T ss_pred             CCCcEEEEEECCEEeeC
Confidence            99999999999999873

>TIGR00221 nagA N-acetylglucosamine-6-phosphate deacetylase Back     alignment and domain information
>PRK11170 nagA N-acetylglucosamine-6-phosphate deacetylase; Provisional Back     alignment and domain information
>KOG3892|consensus Back     alignment and domain information
>cd00854 NagA N-acetylglucosamine-6-phosphate deacetylase, NagA, catalyzes the hydrolysis of the N-acetyl group of N-acetyl-glucosamine-6-phosphate (GlcNAc-6-P) to glucosamine 6-phosphate and acetate Back     alignment and domain information
>TIGR03583 EF_0837 probable amidohydrolase EF_0837/AHA_3915 Back     alignment and domain information
>TIGR02033 D-hydantoinase D-hydantoinase Back     alignment and domain information
>KOG2584|consensus Back     alignment and domain information
>PRK10027 cryptic adenine deaminase; Provisional Back     alignment and domain information
>TIGR01975 isoAsp_dipep isoaspartyl dipeptidase IadA Back     alignment and domain information
>PRK13404 dihydropyrimidinase; Provisional Back     alignment and domain information
>COG0044 PyrC Dihydroorotase and related cyclic amidohydrolases [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01299 Met_dep_hydrolase_A Metallo-dependent hydrolases, subgroup A is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>COG1001 AdeC Adenine deaminase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01178 ade adenine deaminase Back     alignment and domain information
>PRK08417 dihydroorotase; Provisional Back     alignment and domain information
>PRK15446 phosphonate metabolism protein PhnM; Provisional Back     alignment and domain information
>TIGR02318 phosphono_phnM phosphonate metabolism protein PhnM Back     alignment and domain information
>PRK08323 phenylhydantoinase; Validated Back     alignment and domain information
>cd01314 D-HYD D-hydantoinases (D-HYD) also called dihydropyrimidases (DHPase) and related proteins; DHPases are a family of enzymes that catalyze the reversible hydrolytic ring opening of the amide bond in five- or six-membered cyclic diamides, like dihydropyrimidine or hydantoin Back     alignment and domain information
>COG3964 Predicted amidohydrolase [General function prediction only] Back     alignment and domain information
>PRK09236 dihydroorotase; Reviewed Back     alignment and domain information
>PRK12394 putative metallo-dependent hydrolase; Provisional Back     alignment and domain information
>PRK07627 dihydroorotase; Provisional Back     alignment and domain information
>PRK04250 dihydroorotase; Provisional Back     alignment and domain information
>TIGR00857 pyrC_multi dihydroorotase, multifunctional complex type Back     alignment and domain information
>PLN02942 dihydropyrimidinase Back     alignment and domain information
>PRK07575 dihydroorotase; Provisional Back     alignment and domain information
>PRK08044 allantoinase; Provisional Back     alignment and domain information
>PRK06189 allantoinase; Provisional Back     alignment and domain information
>cd01308 Isoaspartyl-dipeptidase Isoaspartyl dipeptidase hydrolyzes the beta-L-isoaspartyl linkages in dipeptides, as part of the degradative pathway to eliminate proteins with beta-L-isoaspartyl peptide bonds, bonds whereby the beta-group of an aspartate forms the peptide link with the amino group of the following amino acid Back     alignment and domain information
>cd01315 L-HYD_ALN L-Hydantoinases (L-HYDs) and Allantoinase (ALN); L-Hydantoinases are a member of the dihydropyrimidinase family, which catalyzes the reversible hydrolytic ring opening of dihydropyrimidines and hydantoins (five-membered cyclic diamides used in biotechnology) Back     alignment and domain information
>PRK09060 dihydroorotase; Validated Back     alignment and domain information
>TIGR03178 allantoinase allantoinase Back     alignment and domain information
>PRK10657 isoaspartyl dipeptidase; Provisional Back     alignment and domain information
>PRK09059 dihydroorotase; Validated Back     alignment and domain information
>PRK09237 dihydroorotase; Provisional Back     alignment and domain information
>PRK07369 dihydroorotase; Provisional Back     alignment and domain information
>PRK09357 pyrC dihydroorotase; Validated Back     alignment and domain information
>PRK01211 dihydroorotase; Provisional Back     alignment and domain information
>COG1228 HutI Imidazolonepropionase and related amidohydrolases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK06687 chlorohydrolase; Validated Back     alignment and domain information
>cd01307 Met_dep_hydrolase_B Metallo-dependent hydrolases, subgroup B is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>PRK09228 guanine deaminase; Provisional Back     alignment and domain information
>PRK07228 N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>PRK02382 dihydroorotase; Provisional Back     alignment and domain information
>cd01317 DHOase_IIa Dihydroorotase (DHOase), subgroup IIa; DHOases catalyze the reversible interconversion of carbamoyl aspartate to dihydroorotate, a key reaction in pyrimidine biosynthesis Back     alignment and domain information
>PRK08203 hydroxydechloroatrazine ethylaminohydrolase; Reviewed Back     alignment and domain information
>PRK00369 pyrC dihydroorotase; Provisional Back     alignment and domain information
>PRK09045 N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>PLN02795 allantoinase Back     alignment and domain information
>PRK15493 5-methylthioadenosine/S-adenosylhomocysteine deaminase; Provisional Back     alignment and domain information
>cd01295 AdeC Adenine deaminase (AdeC) directly deaminates adenine to form hypoxanthine Back     alignment and domain information
>cd01297 D-aminoacylase D-aminoacylases (N-acyl-D-Amino acid amidohydrolases) catalyze the hydrolysis of N-acyl-D-amino acids to produce the corresponding D-amino acids, which are used as intermediates in the synthesis of pesticides, bioactive peptides, and antibiotics Back     alignment and domain information
>PRK09356 imidazolonepropionase; Validated Back     alignment and domain information
>cd01298 ATZ_TRZ_like TRZ/ATZ family contains enzymes from the atrazine degradation pathway and related hydrolases Back     alignment and domain information
>PRK08204 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02967 guan_deamin guanine deaminase Back     alignment and domain information
>PRK12393 amidohydrolase; Provisional Back     alignment and domain information
>PRK06380 metal-dependent hydrolase; Provisional Back     alignment and domain information
>TIGR01224 hutI imidazolonepropionase Back     alignment and domain information
>cd01296 Imidazolone-5PH Imidazolonepropionase/imidazolone-5-propionate hydrolase (Imidazolone-5PH) catalyzes the third step in the histidine degradation pathway, the hydrolysis of (S)-3-(5-oxo-4,5-dihydro-3H-imidazol-4-yl)propanoate to N-formimidoyl-L-glutamate Back     alignment and domain information
>PRK07213 chlorohydrolase; Provisional Back     alignment and domain information
>PRK09061 D-glutamate deacylase; Validated Back     alignment and domain information
>PRK13985 ureB urease subunit beta; Provisional Back     alignment and domain information
>cd01318 DHOase_IIb Dihydroorotase (DHOase), subgroup IIb; DHOases catalyze the reversible interconversion of carbamoyl aspartate to dihydroorotate, a key reaction in pyrimidine biosynthesis Back     alignment and domain information
>cd01302 Cyclic_amidohydrolases Cyclic amidohydrolases, including hydantoinase, dihydropyrimidinase, allantoinase, and dihydroorotase, are involved in the metabolism of pyrimidines and purines, sharing the property of hydrolyzing the cyclic amide bond of each substrate to the corresponding N-carbamyl amino acids Back     alignment and domain information
>PRK13207 ureC urease subunit alpha; Reviewed Back     alignment and domain information
>cd00375 Urease_alpha Urease alpha-subunit; Urease is a nickel-dependent metalloenzyme that catalyzes the hydrolysis of urea to form ammonia and carbon dioxide Back     alignment and domain information
>PRK13206 ureC urease subunit alpha; Reviewed Back     alignment and domain information
>PRK13308 ureC urease subunit alpha; Reviewed Back     alignment and domain information
>cd01312 Met_dep_hydrolase_D Metallo-dependent hydrolases, subgroup D is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>cd01303 GDEase Guanine deaminase (GDEase) Back     alignment and domain information
>PLN02303 urease Back     alignment and domain information
>PRK07203 putative chlorohydrolase/aminohydrolase; Validated Back     alignment and domain information
>TIGR03121 one_C_dehyd_A formylmethanofuran dehydrogenase subunit A Back     alignment and domain information
>PRK14085 imidazolonepropionase; Provisional Back     alignment and domain information
>COG3454 Metal-dependent hydrolase involved in phosphonate metabolism [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01293 Bact_CD Bacterial cytosine deaminase and related metal-dependent hydrolases Back     alignment and domain information
>PRK06151 N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>cd01313 Met_dep_hydrolase_E Metallo-dependent hydrolases, subgroup D is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>PRK08418 chlorohydrolase; Provisional Back     alignment and domain information
>PRK09229 N-formimino-L-glutamate deiminase; Validated Back     alignment and domain information
>TIGR01792 urease_alph urease, alpha subunit Back     alignment and domain information
>PRK06038 N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>TIGR03314 Se_ssnA putative selenium metabolism protein SsnA Back     alignment and domain information
>TIGR02022 hutF formiminoglutamate deiminase Back     alignment and domain information
>PRK08393 N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>cd01306 PhnM PhnM is believed to be a subunit of the membrane associated C-P lyase complex Back     alignment and domain information
>COG1820 NagA N-acetylglucosamine-6-phosphate deacetylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07572 cytosine deaminase; Validated Back     alignment and domain information
>PF01979 Amidohydro_1: Amidohydrolase family; InterPro: IPR006680 This group of enzymes represents a large metal dependent hydrolase superfamily [] Back     alignment and domain information
>cd01304 FMDH_A Formylmethanofuran dehydrogenase (FMDH) subunit A; Methanogenic bacteria and archea derive the energy for autotrophic growth from methanogenesis, the reduction of CO2 with molecular hydrogen as the electron donor Back     alignment and domain information
>cd01316 CAD_DHOase The eukaryotic CAD protein is a trifunctional enzyme of carbamoylphosphate synthetase-aspartate transcarbamoylase-dihydroorotase, which catalyzes the first three steps of de novo pyrimidine nucleotide biosynthesis Back     alignment and domain information
>PRK13309 ureC urease subunit alpha; Reviewed Back     alignment and domain information
>PRK07583 cytosine deaminase-like protein; Validated Back     alignment and domain information
>cd01309 Met_dep_hydrolase_C Metallo-dependent hydrolases, subgroup C is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>COG0402 SsnA Cytosine deaminase and related metal-dependent hydrolases [Nucleotide transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK09230 cytosine deaminase; Provisional Back     alignment and domain information
>PRK05985 cytosine deaminase; Provisional Back     alignment and domain information
>PF13147 Amidohydro_4: Amidohydrolase; PDB: 3SFW_B 2FTW_A 2PUZ_B 2GOK_B 3HM7_E 3D6N_A 1XRT_A 1XRF_A 1YNY_B 1K1D_F Back     alignment and domain information
>KOG3968|consensus Back     alignment and domain information
>PRK06846 putative deaminase; Validated Back     alignment and domain information
>COG1574 Predicted metal-dependent hydrolase with the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>PRK11170 nagA N-acetylglucosamine-6-phosphate deacetylase; Provisional Back     alignment and domain information
>TIGR00221 nagA N-acetylglucosamine-6-phosphate deacetylase Back     alignment and domain information
>cd01300 YtcJ_like YtcJ_like metal dependent amidohydrolases Back     alignment and domain information
>KOG3892|consensus Back     alignment and domain information
>COG3653 N-acyl-D-aspartate/D-glutamate deacylase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF13594 Amidohydro_5: Amidohydrolase; PDB: 4F0R_A 4F0S_A 1NFG_C 2FVM_A 2FVK_A 2FTY_D 1YBQ_B 1POJ_B 1ONW_A 2AQO_B Back     alignment and domain information
>cd01294 DHOase Dihydroorotase (DHOase) catalyzes the reversible interconversion of carbamoyl aspartate to dihydroorotate, a key reaction in the pyrimidine biosynthesis Back     alignment and domain information
>cd00854 NagA N-acetylglucosamine-6-phosphate deacetylase, NagA, catalyzes the hydrolysis of the N-acetyl group of N-acetyl-glucosamine-6-phosphate (GlcNAc-6-P) to glucosamine 6-phosphate and acetate Back     alignment and domain information
>cd01305 archeal_chlorohydrolases Predicted chlorohydrolases Back     alignment and domain information
>COG0804 UreC Urea amidohydrolase (urease) alpha subunit [Amino acid transport and metabolism] Back     alignment and domain information
>COG1229 FwdA Formylmethanofuran dehydrogenase subunit A [Energy production and conversion] Back     alignment and domain information
>TIGR00856 pyrC_dimer dihydroorotase, homodimeric type Back     alignment and domain information
>TIGR00010 hydrolase, TatD family Back     alignment and domain information
>PF07969 Amidohydro_3: Amidohydrolase family; InterPro: IPR013108 Amidohydrolases are a diverse superfamily of enzymes which catalyse the hydrolysis of amide or amine bonds in a large number of different substrates including urea, cytosine, AMP, formylmethanofuran, etc [, ] Back     alignment and domain information
>cd01292 metallo-dependent_hydrolases Superfamily of metallo-dependent hydrolases (also called amidohydrolase superfamily) is a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>PLN02599 dihydroorotase Back     alignment and domain information
>cd01310 TatD_DNAse TatD like proteins; E Back     alignment and domain information
>PRK10812 putative DNAse; Provisional Back     alignment and domain information
>PRK06886 hypothetical protein; Validated Back     alignment and domain information
>COG0084 TatD Mg-dependent DNase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11449 putative deoxyribonuclease YjjV; Provisional Back     alignment and domain information
>cd00530 PTE Phosphotriesterase (PTE) catalyzes the hydrolysis of organophosphate nerve agents, including the chemical warfare agents VX, soman, and sarin as well as the insecticide paraoxon Back     alignment and domain information
>COG1099 Predicted metal-dependent hydrolases with the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>PRK09875 putative hydrolase; Provisional Back     alignment and domain information
>PF12890 DHOase: Dihydro-orotase-like; InterPro: IPR024403 This entry represents a small family of dihydro-orotase-like proteins from bacteria Back     alignment and domain information
>PRK10425 DNase TatD; Provisional Back     alignment and domain information
>PRK05451 dihydroorotase; Provisional Back     alignment and domain information
>COG4464 CapC Capsular polysaccharide biosynthesis protein [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03583 EF_0837 probable amidohydrolase EF_0837/AHA_3915 Back     alignment and domain information
>COG5016 Pyruvate/oxaloacetate carboxyltransferase [Energy production and conversion] Back     alignment and domain information
>PF07969 Amidohydro_3: Amidohydrolase family; InterPro: IPR013108 Amidohydrolases are a diverse superfamily of enzymes which catalyse the hydrolysis of amide or amine bonds in a large number of different substrates including urea, cytosine, AMP, formylmethanofuran, etc [, ] Back     alignment and domain information
>PF01026 TatD_DNase: TatD related DNase The Pfam entry finds members not in the Prosite definition Back     alignment and domain information
>TIGR01430 aden_deam adenosine deaminase Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase Back     alignment and domain information
>cd01320 ADA Adenosine deaminase (ADA) is a monomeric zinc dependent enzyme which catalyzes the irreversible hydrolytic deamination of both adenosine, as well as desoxyadenosine, to ammonia and inosine or desoxyinosine, respectively Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd00956 Transaldolase_FSA Transaldolase-like fructose-6-phosphate aldolases (FSA) found in bacteria and archaea, which are member of the MipB/TalC subfamily of class I aldolases Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query417
3egj_A381 N-Acetylglucosamine-6-Phosphate Deacetylase From Vi 2e-33
3egj_A381 N-Acetylglucosamine-6-Phosphate Deacetylase From Vi 4e-18
2vhl_A396 The Three-Dimensional Structure Of The N-Acetylgluc 4e-33
2p53_A382 Crystal Structure Of N-acetyl-d-glucosamine-6-phosp 2e-30
2p53_A382 Crystal Structure Of N-acetyl-d-glucosamine-6-phosp 5e-15
1ymy_A382 Crystal Structure Of The N-Acetylglucosamine-6-Phos 2e-30
1ymy_A382 Crystal Structure Of The N-Acetylglucosamine-6-Phos 2e-14
1o12_A376 Crystal Structure Of N-Acetylglucosamine-6-Phosphat 6e-21
>pdb|3EGJ|A Chain A, N-Acetylglucosamine-6-Phosphate Deacetylase From Vibrio Cholerae. Length = 381 Back     alignment and structure 
Iteration: 1

 Score =  140 bits (352), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 87/229 (37%), Positives = 132/229 (57%), Gaps = 10/229 (4%)
Query: 7   DCGGKLIAPGFIDIQINGGFGVDFSHDIDSVDKNVSIVARGILAHGVTSFCPTLVTSEPQ 66
           D  G  ++PGFID+Q+NG  GV F+ +I +  + +  + +  L  G TSF PTL+TS  +
Sbjct: 48  DLNGANLSPGFIDLQLNGCGGVMFNDEITA--ETIDTMHKANLKSGCTSFLPTLITSSDE 105
Query: 67  VYKKVLSRLRKTPGGKHGATVLGAHVEGPFISPDKKGAHSLSKIVTFDKGFDSVREVYGN 126
             ++ ++  R+    K+    LG H+EGP+++  KKG HS+  I   D     +  +  N
Sbjct: 106 NMRQAIAAAREYQA-KYPNQSLGLHLEGPYLNVMKKGIHSVDFIRPSDDTM--IDTICAN 162
Query: 127 LSNIAIITLAPELAGSMEVIDKLVEQGITVSLGHSSADINIAEEAVRHGASLITHLFNAM 186
              IA +TLAPE     E I+KLV+ GI VS+GH++A  + A ++   G +  THLFNAM
Sbjct: 163 SDVIAKVTLAPE-NNKPEHIEKLVKAGIVVSIGHTNATYSEARKSFESGITFATHLFNAM 221
Query: 187 LPFHHRDPGIIGLLSSDNIDSSKVYYGIIADGVHTHPSALRIANSTHPE 235
            P   R+PG++G +     D+ +VY GIIADG H   + +RIA+    E
Sbjct: 222 TPMVGREPGVVGAI----YDTPEVYAGIIADGFHVDYANIRIAHKIKGE 266
>pdb|3EGJ|A Chain A, N-Acetylglucosamine-6-Phosphate Deacetylase From Vibrio Cholerae. Length = 381 Back     alignment and structure
>pdb|2VHL|A Chain A, The Three-Dimensional Structure Of The N-Acetylglucosamine- 6-Phosphate Deacetylase From Bacillus Subtilis Length = 396 Back     alignment and structure
>pdb|2P53|A Chain A, Crystal Structure Of N-acetyl-d-glucosamine-6-phosphate Deacetylase D273n Mutant Complexed With N-acetyl Phosphonamidate-d-glucosamine-6- Phosphate Length = 382 Back     alignment and structure
>pdb|2P53|A Chain A, Crystal Structure Of N-acetyl-d-glucosamine-6-phosphate Deacetylase D273n Mutant Complexed With N-acetyl Phosphonamidate-d-glucosamine-6- Phosphate Length = 382 Back     alignment and structure
>pdb|1YMY|A Chain A, Crystal Structure Of The N-Acetylglucosamine-6-Phosphate Deacetylase From Escherichia Coli K12 Length = 382 Back     alignment and structure
>pdb|1YMY|A Chain A, Crystal Structure Of The N-Acetylglucosamine-6-Phosphate Deacetylase From Escherichia Coli K12 Length = 382 Back     alignment and structure
>pdb|1O12|A Chain A, Crystal Structure Of N-Acetylglucosamine-6-Phosphate Deacetylase (Tm0814) From Thermotoga Maritima At 2.5 A Resolution Length = 376 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query417
2vhl_A396 N-acetylglucosamine-6-phosphate deacetylase; N- ac 1e-107
1yrr_A382 N-acetylglucosamine-6-phosphate deacetylase; (beta 2e-89
1yrr_A382 N-acetylglucosamine-6-phosphate deacetylase; (beta 5e-51
3iv8_A381 N-acetylglucosamine-6-phosphate deacetylase; IDP01 3e-88
3iv8_A381 N-acetylglucosamine-6-phosphate deacetylase; IDP01 3e-51
1o12_A376 N-acetylglucosamine-6-phosphate deacetylase; struc 3e-86
1o12_A376 N-acetylglucosamine-6-phosphate deacetylase; struc 2e-47
1onw_A390 Isoaspartyl dipeptidase; amidohydrolase, hydrolase 4e-43
2ogj_A417 Dihydroorotase; TIM barrel, binuclear zinc, imidaz 3e-10
2ogj_A417 Dihydroorotase; TIM barrel, binuclear zinc, imidaz 6e-10
1gkr_A458 Hydantoinase, non-ATP dependent L-selective hydant 6e-06
1gkp_A458 Hydantoinase; hydrolase, dihydropyrimidinase, cycl 8e-06
3sfw_A461 Dihydropyrimidinase; hydrolase, zinc binding; HET: 8e-06
1nfg_A457 D-hydantoinase; TIM barrel, hydrolase; HET: KCX; 2 9e-06
2ftw_A521 Dihydropyrimidine amidohydrolase; (beta-alpha)8-ba 1e-05
2vm8_A501 Dihydropyrimidinase-related protein 2; neurogenesi 1e-05
2vr2_A541 Dihydropyrimidinase; hydantoinase, metal-binding, 2e-05
3e74_A473 Allantoinase; (beta/alpha)8-barrel domain, small b 2e-05
3hm7_A448 Allantoinase; metallo-dependent hydrolase, protein 3e-05
2bb0_A421 Imidazolonepropionase; TIM barrel, hydrolase; 2.00 5e-05
3dc8_A490 Dihydropyrimidinase; TIM-barrel, hydrolase; HET: K 5e-05
2ics_A379 Adenine deaminase; TIM barrel, binuclear zinc, ade 5e-05
3ooq_A396 Amidohydrolase; structural genomics, protein struc 7e-05
2puz_A419 Imidazolonepropionase; NYSGXRC, PSI-2, N-formimino 9e-05
2q09_A416 Imidazolonepropionase; 9252H, NYSGXRC, 3-(2, 5-dio 2e-04
2gwn_A452 Dihydroorotase; zinc-binding prote structural geno 3e-04
4aql_A476 Guanine deaminase; hydrolase, purine metabolism; H 8e-04
>2vhl_A N-acetylglucosamine-6-phosphate deacetylase; N- acetyleglucosamine-6-phosphate, carbohydrate metabolism, hydrolase; HET: GLP PGE; 2.05A {Bacillus subtilis} Length = 396 Back     alignment and structure
 Score =  321 bits (826), Expect = e-107
 Identities = 115/414 (27%), Positives = 167/414 (40%), Gaps = 82/414 (19%)

Query: 7   DCGGKLIAPGFIDIQINGGFGVDFSHDIDSVDKNVSIVARGILAHGVTSFCPTLVTSEPQ 66
                ++ PG IDI I+GG+G D     D+    + I++  +   G TSF  T +T E  
Sbjct: 49  APADSVLLPGMIDIHIHGGYGADTM---DASFSTLDIMSSRLPEEGTTSFLATTITQEHG 105

Query: 67  VYKKVLSRLR----KTPGGKHGATVLGAHVEGPFISPDKKGAHSLSKIVTFDKG-FDSVR 121
              + L   R           GA +LG H+EGPF+SP + GA     I   D   F   +
Sbjct: 106 NISQALVNAREWKAAEESSLLGAELLGIHLEGPFVSPKRAGAQPKEWIRPSDVELFKKWQ 165

Query: 122 EVYGNLSNIAIITLAPELAGSMEVIDKLVEQGITVSLGHSSADINIAEEAVRHGASLITH 181
           +  G L  I I+TLAPE     E+I  L ++ I  S+GH+ AD  +  +A + GAS +TH
Sbjct: 166 QEAGGL--IKIVTLAPEEDQHFELIRHLKDESIIASMGHTDADSALLSDAAKAGASHMTH 223

Query: 182 LFNAMLPFHHRDPGIIG-LLSSDNIDSSKVYYGIIADGVHTHPSALRIANSTHPEGHSSA 240
           L+NAM PFHHR+PG+IG  L+ D          +IADG+H+HP A ++A           
Sbjct: 224 LYNAMSPFHHREPGVIGTALAHDG-----FVTELIADGIHSHPLAAKLAFLAKGSSK--- 275

Query: 241 DIHIAEEAVRHGASLITHLFNAMLPFHHRDPGIIGLLSSDNIDSSKVYYGIIADGVHTHP 300
                         LIT   ++M        G+             V    +        
Sbjct: 276 ------------LILIT---DSMRAK-GLKDGVYEF------GGQSV---TVRGRT---- 306

Query: 301 SALRIANSTHPEGSITPFNGCVQFFMRSTRCSLWFDLGNCNNGGSITPFNGCVQFFMRST 360
               +++ T   GSI   N   +     T CS                            
Sbjct: 307 --ALLSDGT-LAGSILKMNEGARHMREFTNCSWT-------------------------- 337

Query: 361 RCSLVHALEVASLHPAKALGLEQHKGTLDFGADADFVILDEGLHVYSTWIAGDL 414
                    + S + AK LG+   KG++  G DAD VI+     V  T   G++
Sbjct: 338 -----DIANITSENAAKQLGIFDRKGSVTVGKDADLVIVSSDCEVILTICRGNI 386
>1yrr_A N-acetylglucosamine-6-phosphate deacetylase; (beta/alpha)8 barrel, beta sandwich, hydrolase; 2.00A {Escherichia coli} SCOP: b.92.1.5 c.1.9.10 PDB: 1ymy_A 2p50_A 2p53_A* Length = 382 Back     alignment and structure
>1yrr_A N-acetylglucosamine-6-phosphate deacetylase; (beta/alpha)8 barrel, beta sandwich, hydrolase; 2.00A {Escherichia coli} SCOP: b.92.1.5 c.1.9.10 PDB: 1ymy_A 2p50_A 2p53_A* Length = 382 Back     alignment and structure
>3iv8_A N-acetylglucosamine-6-phosphate deacetylase; IDP01334, fruct phosphate, carbohydrate metabolism, hydrolase; HET: F6P; 2.53A {Vibrio cholerae} PDB: 3egj_A* Length = 381 Back     alignment and structure
>3iv8_A N-acetylglucosamine-6-phosphate deacetylase; IDP01334, fruct phosphate, carbohydrate metabolism, hydrolase; HET: F6P; 2.53A {Vibrio cholerae} PDB: 3egj_A* Length = 381 Back     alignment and structure
>1o12_A N-acetylglucosamine-6-phosphate deacetylase; structural genomics, TM0814, JCSG, PSI, protein structure initiative; 2.50A {Thermotoga maritima} SCOP: b.92.1.5 c.1.9.10 Length = 376 Back     alignment and structure
>1o12_A N-acetylglucosamine-6-phosphate deacetylase; structural genomics, TM0814, JCSG, PSI, protein structure initiative; 2.50A {Thermotoga maritima} SCOP: b.92.1.5 c.1.9.10 Length = 376 Back     alignment and structure
>1onw_A Isoaspartyl dipeptidase; amidohydrolase, hydrolase, metalloprotease; HET: KCX; 1.65A {Escherichia coli} SCOP: b.92.1.7 c.1.9.13 PDB: 1onx_A* 1po9_A* 1poj_A* 1pok_B* 2aqo_A* 1ybq_A* 2aqv_A* Length = 390 Back     alignment and structure
>2ogj_A Dihydroorotase; TIM barrel, binuclear zinc, imidazole complex, amido hydrola 9244B, structural genomics, PSI-2; HET: KCX; 2.62A {Agrobacterium tumefaciens} Length = 417 Back     alignment and structure
>2ogj_A Dihydroorotase; TIM barrel, binuclear zinc, imidazole complex, amido hydrola 9244B, structural genomics, PSI-2; HET: KCX; 2.62A {Agrobacterium tumefaciens} Length = 417 Back     alignment and structure
>1gkr_A Hydantoinase, non-ATP dependent L-selective hydantoinase; hydrolase, dihydropyrimidinase, cyclic amidase; HET: KCX; 2.60A {Arthrobacter aurescens} SCOP: b.92.1.3 c.1.9.6 Length = 458 Back     alignment and structure
>1gkp_A Hydantoinase; hydrolase, dihydropyrimidinase, cyclic amidase; HET: KCX EPE; 1.29A {Thermus SP} SCOP: b.92.1.3 c.1.9.6 PDB: 1gkq_A* Length = 458 Back     alignment and structure
>3sfw_A Dihydropyrimidinase; hydrolase, zinc binding; HET: KCX; 1.73A {Brevibacillus agri} PDB: 1yny_A 1k1d_A* Length = 461 Back     alignment and structure
>1nfg_A D-hydantoinase; TIM barrel, hydrolase; HET: KCX; 2.70A {Ralstonia pickettii} SCOP: b.92.1.3 c.1.9.6 Length = 457 Back     alignment and structure
>2ftw_A Dihydropyrimidine amidohydrolase; (beta-alpha)8-barrel, beta-sandwich; HET: KCX; 2.05A {Dictyostelium discoideum} SCOP: b.92.1.3 c.1.9.6 Length = 521 Back     alignment and structure
>2vm8_A Dihydropyrimidinase-related protein 2; neurogenesis, phosphoprotein, differentiation, CRMP, cytoplasm, TIM barrel, polymorphism, axonal pathfinding; 1.9A {Homo sapiens} PDB: 2gse_A 1kcx_A Length = 501 Back     alignment and structure
>2vr2_A Dihydropyrimidinase; hydantoinase, metal-binding, disease mutation, dihydropyrimi amidohydrolase, nucleotide metabolism, DPYS, dhpase, hydrolase; 2.80A {Homo sapiens} Length = 541 Back     alignment and structure
>3e74_A Allantoinase; (beta/alpha)8-barrel domain, small beta-sheet domain, hydrolase, metal-binding, purine metabolism, zinc; HET: KCX; 2.10A {Escherichia coli} Length = 473 Back     alignment and structure
>3hm7_A Allantoinase; metallo-dependent hydrolase, protein structure initiative, PSI-2, NEW YORK structural genomix research CON nysgxrc; 2.60A {Bacillus halodurans} Length = 448 Back     alignment and structure
>2bb0_A Imidazolonepropionase; TIM barrel, hydrolase; 2.00A {Bacillus subtilis} SCOP: b.92.1.10 c.1.9.17 PDB: 2g3f_A Length = 421 Back     alignment and structure
>3dc8_A Dihydropyrimidinase; TIM-barrel, hydrolase; HET: KCX; 1.85A {Sinorhizobium meliloti} Length = 490 Back     alignment and structure
>2ics_A Adenine deaminase; TIM barrel, binuclear zinc, adenine complex, amidohydrolase, structural genomics, PSI, protein structure initiative; HET: KCX ADE; 2.30A {Enterococcus faecalis} SCOP: b.92.1.8 c.1.9.14 Length = 379 Back     alignment and structure
>3ooq_A Amidohydrolase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, H PSI-2; 2.06A {Thermotoga maritima} Length = 396 Back     alignment and structure
>2puz_A Imidazolonepropionase; NYSGXRC, PSI-2, N-formimino-L- glutamate, product-bound, structural genomics, protein STRU initiative; HET: NIG; 1.83A {Agrobacterium tumefaciens str} SCOP: b.92.1.10 c.1.9.17 PDB: 2gok_A Length = 419 Back     alignment and structure
>2q09_A Imidazolonepropionase; 9252H, NYSGXRC, 3-(2, 5-dioxo-imidazo 4YL)-propionic acid, PSI-2 community, structural genomics, structure initiative; HET: DI6; 1.97A {Unidentified} SCOP: b.92.1.10 c.1.9.17 PDB: 2oof_A* Length = 416 Back     alignment and structure
>2gwn_A Dihydroorotase; zinc-binding prote structural genomics, PSI, protein structure initiative, MID center for structural genomics, MCSG; HET: KCX GOL; 1.85A {Porphyromonas gingivalis} Length = 452 Back     alignment and structure
>4aql_A Guanine deaminase; hydrolase, purine metabolism; HET: TXC; 1.99A {Homo sapiens} PDB: 2uz9_A* 3e0l_A Length = 476 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query417
3iv8_A381 N-acetylglucosamine-6-phosphate deacetylase; IDP01 100.0
1yrr_A382 N-acetylglucosamine-6-phosphate deacetylase; (beta 100.0
2vhl_A396 N-acetylglucosamine-6-phosphate deacetylase; N- ac 100.0
1o12_A376 N-acetylglucosamine-6-phosphate deacetylase; struc 100.0
1nfg_A457 D-hydantoinase; TIM barrel, hydrolase; HET: KCX; 2 99.95
2vr2_A541 Dihydropyrimidinase; hydantoinase, metal-binding, 99.94
3gnh_A403 L-lysine, L-arginine carboxypeptidase CC2672; N-me 99.93
1gkp_A458 Hydantoinase; hydrolase, dihydropyrimidinase, cycl 99.93
2vm8_A501 Dihydropyrimidinase-related protein 2; neurogenesi 99.93
2ftw_A521 Dihydropyrimidine amidohydrolase; (beta-alpha)8-ba 99.93
2r8c_A426 Putative amidohydrolase; unknown source, sargasso 99.92
3feq_A423 Putative amidohydrolase; unknown source, sargasso 99.92
2p9b_A458 Possible prolidase; protein structure initiative I 99.92
3be7_A408 Zn-dependent arginine carboxypeptidase; unknown so 99.92
1gkr_A458 Hydantoinase, non-ATP dependent L-selective hydant 99.92
2qs8_A418 XAA-Pro dipeptidase; amidohydrolase, TIM barrel, p 99.91
2ics_A379 Adenine deaminase; TIM barrel, binuclear zinc, ade 99.91
2paj_A492 Putative cytosine/guanine deaminase; NYSGXRC, PSI- 99.9
2q09_A416 Imidazolonepropionase; 9252H, NYSGXRC, 3-(2, 5-dio 99.9
2vun_A386 Enamidase; nicotinate degradation, binuclear metal 99.9
1onw_A390 Isoaspartyl dipeptidase; amidohydrolase, hydrolase 99.9
3h4u_A479 Amidohydrolase; signature of Zn ligands, structura 99.89
3dc8_A490 Dihydropyrimidinase; TIM-barrel, hydrolase; HET: K 99.89
3lnp_A468 Amidohydrolase family protein OLEI01672_1_465; TIM 99.89
2bb0_A421 Imidazolonepropionase; TIM barrel, hydrolase; 2.00 99.88
2puz_A419 Imidazolonepropionase; NYSGXRC, PSI-2, N-formimino 99.88
3ls9_A456 Triazine hydrolase; atrazine chlorohydrolase TRZN; 99.88
2ogj_A417 Dihydroorotase; TIM barrel, binuclear zinc, imidaz 99.88
4dyk_A451 Amidohydrolase; adenosine deaminase, nysgrc, struc 99.88
2ood_A475 BLR3880 protein; PSI-II, PSI-2, guanine deaminase, 99.88
3sfw_A461 Dihydropyrimidinase; hydrolase, zinc binding; HET: 99.88
4f0r_A447 5-methylthioadenosine/S-adenosylhomocysteine DEAM; 99.87
4aql_A476 Guanine deaminase; hydrolase, purine metabolism; H 99.87
3e74_A473 Allantoinase; (beta/alpha)8-barrel domain, small b 99.87
2i9u_A439 Cytosine/guanine deaminase related protein; protei 99.86
3gri_A424 Dihydroorotase, dhoase; hydrolase, IDP00795, metal 99.86
3nqb_A 608 Adenine deaminase 2; PSI-II, structural genomics, 99.86
4dzh_A472 Amidohydrolase; adenosine deaminase, nysgrc, struc 99.86
3mpg_A428 Dihydroorotase, dhoase; hydrolase; 2.60A {Bacillus 99.86
2fty_A559 Dihydropyrimidinase; alpha/beta barrel, beta-sandw 99.85
1p1m_A406 Hypothetical protein TM0936; putative metal depend 99.85
2gwn_A452 Dihydroorotase; zinc-binding prote structural geno 99.85
3hm7_A448 Allantoinase; metallo-dependent hydrolase, protein 99.84
2z00_A426 Dihydroorotase; zinc binding protein, hydrolase, m 99.81
1xrt_A467 Dihydroorotase, dhoase; amidohydrolase, metalloenz 99.8
3mtw_A403 L-arginine carboxypeptidase CC2672; hydrolase; HET 99.8
2imr_A420 Hypothetical protein DR_0824; zinc, NYSGXRC, PSI2, 99.79
2qt3_A403 N-isopropylammelide isopropyl amidohydrolase; N-is 99.78
3hpa_A479 Amidohydrolase; signature of Zn ligands, structura 99.77
3gip_A480 N-acyl-D-glutamate deacylase; amidohydrolase famil 99.77
3mdu_A453 N-formimino-L-glutamate iminohydrolase; amonohydra 99.76
4f0l_A458 Amidohydrolase; ssgcid, structural genomics, seatt 99.76
1ra0_A430 Cytosine deaminase; alpha-beta barrel, hexamer, co 99.75
3ooq_A396 Amidohydrolase; structural genomics, protein struc 99.73
4ac7_C 570 Urease subunit alpha; hydrolase, bacillus pasteuri 99.73
4gy7_A 840 Urease; JACK bean, hydrolase, ME binding, nickel; 99.72
3v7p_A427 Amidohydrolase family protein; iron binding site, 99.72
4ubp_C 570 Protein (urease (chain C)); bacillus pasteurii, ni 99.72
1e9y_B 569 Urease subunit beta; hydrolase, dodecamer; HET: KC 99.68
1rk6_A496 D-aminoacylase; TIM barrel, beta barrel, insertion 99.65
4ep8_C 566 Urease subunit alpha; alpha-beta barrel, nickel me 99.58
3icj_A534 Uncharacterized metal-dependent hydrolase; structu 99.46
3pnu_A359 Dihydroorotase; TIM barrel, zinc binding, hydrolas 99.38
3iv8_A381 N-acetylglucosamine-6-phosphate deacetylase; IDP01 99.32
3mkv_A426 Putative amidohydrolase; sargasso SEA, structural 99.15
2z26_A347 Dihydroorotase, dhoase; TIM barrel, hydrolase; HET 98.95
3ggm_A81 Uncharacterized protein BT9727_2919; bacillus cere 98.18
1zzm_A259 Putative deoxyribonuclease YJJV; hydrolaze, zinc, 97.72
3mkv_A426 Putative amidohydrolase; sargasso SEA, structural 97.71
1xwy_A264 DNAse TATD, deoxyribonuclease TATD; TIM barrael, z 97.67
3rcm_A287 TATD family hydrolase; HET: CIT; 2.05A {Pseudomona 97.67
2ob3_A330 Parathion hydrolase; metalloenzyme, TIM barrel, ne 97.62
1bf6_A291 Phosphotriesterase homology protein; hypothetical 97.59
1yix_A265 Deoxyribonuclease YCFH; TIM barrel, zinc ION, NEW 97.13
2y1h_A272 Putative deoxyribonuclease tatdn3; hydrolase; 2.50 97.08
2vc7_A314 Aryldialkylphosphatase; phosphotriesterase, promis 96.77
3k2g_A364 Resiniferatoxin-binding, phosphotriesterase- relat 96.45
2xio_A301 Putative deoxyribonuclease tatdn1; hydrolase; 1.19 96.25
2gzx_A265 Putative TATD related DNAse; deoxyribonuclease, NE 95.98
1o12_A376 N-acetylglucosamine-6-phosphate deacetylase; struc 95.85
3rhg_A365 Putative phophotriesterase; hydrolase, amidohydrol 95.82
1j6o_A268 TATD-related deoxyribonuclease; structural genomic 95.23
1yrr_A382 N-acetylglucosamine-6-phosphate deacetylase; (beta 94.95
3gg7_A254 Uncharacterized metalloprotein; structural genomic 94.81
3ipw_A325 Hydrolase TATD family protein; niaid, ssgcid, seat 93.86
2vhl_A396 N-acetylglucosamine-6-phosphate deacetylase; N- ac 92.48
3tn4_A360 Phosphotriesterase; lactonase, hydrolase; HET: KCX 90.57
3gtx_A339 Organophosphorus hydrolase; mutant, amidohydrolase 87.04
2wje_A247 CPS4B, tyrosine-protein phosphatase CPSB; capsule 84.65
4i6k_A294 Amidohydrolase family protein; enzyme function ini 84.0
3ovg_A363 Amidohydrolase; structural genomics, PSI-2, protei 82.21
>3iv8_A N-acetylglucosamine-6-phosphate deacetylase; IDP01334, fruct phosphate, carbohydrate metabolism, hydrolase; HET: F6P; 2.53A {Vibrio cholerae} PDB: 3egj_A* Back     alignment and structure
Probab=100.00  E-value=1.5e-68  Score=525.69  Aligned_cols=337  Identities=33%  Similarity=0.489  Sum_probs=303.5

Q ss_pred             CeEEeCCCCEeeccchhhcccCCCCCCCCCCCCCcHHHHHHHHHHHHhCCceeeeeccCCCCHHHHHHHHHHHHcCCCCC
Q psy12256          3 DFRFDCGGKLIAPGFIDIQINGGFGVDFSHDIDSVDKNVSIVARGILAHGVTSFCPTLVTSEPQVYKKVLSRLRKTPGGK   82 (417)
Q Consensus         3 ~~vID~~G~~v~PG~ID~H~H~~~g~~~~~~~~~~~~~~~~~~~~~~~~GvTt~~~~~~~~~~~~~~~~~~~~~~~~~~~   82 (417)
                      +++||++|+||+|||||+|+|+++|.+|++.  .+.+++++++++++++|||||++|.+|.+.+.+.++++.+++..+. 
T Consensus        44 ~~viD~~G~~v~PGfID~HvHg~~G~~~~d~--~~~e~l~~~~~a~~~~GvTt~l~t~~T~~~e~l~~al~~~~~~~~~-  120 (381)
T 3iv8_A           44 MNVVDLNGANLSPGFIDLQLNGCGGVMFNDE--ITAETIDTMHKANLKSGCTSFLPTLITSSDENMRQAIAAAREYQAK-  120 (381)
T ss_dssp             CEEEEEEEEEEEECEEEEEECEETTEETTTS--CSHHHHHHHHHHHHHTTEEEEEEEEESCCHHHHHHHHHHHHHHHHH-
T ss_pred             CeEEECCCCEEccCeEeeeecccCCCCCCCC--CCHHHHHHHHHHHHhCCccccccccCCCCHHHHHHHHHHHHHHHhc-
Confidence            5799999999999999999999999888652  2478899999999999999999999999999999998888776422 


Q ss_pred             CCceeEEeeeeCCCCCCCCCCCCCCcccCCCc-HHHHHHHHHhCCCCCEEEEEecCCCCChHHHHHHHHHCCCeeeecCC
Q psy12256         83 HGATVLGAHVEGPFISPDKKGAHSLSKIVTFD-KGFDSVREVYGNLSNIAIITLAPELAGSMEVIDKLVEQGITVSLGHS  161 (417)
Q Consensus        83 ~~~~~~G~~leGp~~~~~~~G~~~~~~~~~~~-~~~~~~~~~~g~~~~ik~~~~~pe~~~~~~~i~~~~~~gi~v~~GH~  161 (417)
                      .++.++|+|+||||+|+.++|+|++++++.|+ +++++|.+..   +.||++|++||.+. .++|++++++|+++|+||+
T Consensus       121 ~~~~ilGiHlEGPfis~~~~Ga~~~~~i~~p~~~~~~~~~~~~---~~i~~vTlAPE~~~-~~~i~~l~~~gi~vs~GHs  196 (381)
T 3iv8_A          121 YPNQSLGLHLEGPYLNVMKKGIHSVDFIRPSDDTMIDTICANS---DVIAKVTLAPENNK-PEHIEKLVKAGIVVSIGHT  196 (381)
T ss_dssp             CSSSBCCEEEECSSCCGGGCTTSCTTTCCCCCHHHHHHHHHTT---TSEEEEEECCTTSC-HHHHHHHHHTTCEEEECSB
T ss_pred             CCCceeEeeccCcccCHhhcCCCCHHHcCCCCHHHHHHHHhcc---CCeEEEEECCCCCc-HHHHHHHHHCCCEEEecCC
Confidence            34689999999999999999999999999999 8899998753   35999999999887 8999999999999999999


Q ss_pred             cCCHHHHHHHHHCCCCeEeeCCCCcccccccCCceEEeecCCCCCCCceEEEEecCCCcCCHHHHHHHHhhCCCCCCCCC
Q psy12256        162 SADINIAEEAVRHGASLITHLFNAMLPFHHRDPGIIGLLSSDNIDSSKVYYGIIADGVHTHPSALRIANSTHPEGHSSAD  241 (417)
Q Consensus       162 ~~~~~~~~~a~~~G~~~i~Hl~~~~~~~~~r~~g~~~~~~~~~l~~~~~~~~~i~dg~h~~~~~~~~~~~~~~~~h~~~~  241 (417)
                      .++|+++++++++|++.+||+||+|++++||+||++++++..    +++++|+||||+||||.+++++++.+. .+    
T Consensus       197 ~A~~e~~~~a~~~Ga~~~THlfNaM~~~~hR~PG~vga~l~~----~~~~~elI~DG~Hv~p~~~~~~~~~~g-~~----  267 (381)
T 3iv8_A          197 NATYSEARKSFESGITFATHLFNAMTPMVGREPGVVGAIYDT----PEVYAGIIADGFHVDYANIRIAHKIKG-EK----  267 (381)
T ss_dssp             CCCHHHHHHHHHTTCCEESSTTSSBCCCBTTBCHHHHHHHHC----TTCEEEEECSSSSSCHHHHHHHHHHHG-GG----
T ss_pred             CCCHHHHHHHHHcCCCEeeeCCCCCCCccCCCCchHHHHhcC----CCcEEEEEcCCccCCHHHHHHHHHhcC-CE----
Confidence            999999999999999999999999999999999999987643    578999999999999999999998865 33    


Q ss_pred             HHHHHHHHHccceeeeccccccCCCCCCCCccccccccccccCCcceeeeeCCceeeChHHHHHHHhcCCCCeEEeeCCe
Q psy12256        242 IHIAEEAVRHGASLITHLFNAMLPFHHRDPGIIGLLSSDNIDSSKVYYGIIADGVHTHPSALRIANSTHPEGSITPFNGC  321 (417)
Q Consensus       242 ~e~~~~a~~~g~~~~td~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~i~dg~~~~~~~l~~~~~~~~~~~~~~~d~~  321 (417)
                                 +.++||++.+.           |+                +||.|.+...           .+.+.|+.
T Consensus       268 -----------~~lvTDam~a~-----------G~----------------~dg~y~lgg~-----------~v~v~~g~  298 (381)
T 3iv8_A          268 -----------LVLVTDATAPA-----------GA----------------EMDYFIFVGK-----------KVYYRDGK  298 (381)
T ss_dssp             -----------EEEECCBCTTT-----------TS----------------CCSEEESSSC-----------EEEEETTE
T ss_pred             -----------EEEEeCccccc-----------CC----------------CCCeeecCCe-----------EEEEECCE
Confidence                       37899998776           66                7888766543           67788988


Q ss_pred             eeeeeecccccceeeCCCCCCCCCCCchhHHHHHhhhccCCCHHHHHHHHhHHHHHHcCCCCCccccccCCCccEEEEcC
Q psy12256        322 VQFFMRSTRCSLWFDLGNCNNGGSITPFNGCVQFFMRSTRCSLVHALEVASLHPAKALGLEQHKGTLDFGADADFVILDE  401 (417)
Q Consensus       322 ~~~~~~~~~~~~~~~~~~~~~~g~~~~l~~~~~~~~~~~~~~~~~~l~~~t~~pA~~l~l~~~~G~l~~G~~ADlvv~d~  401 (417)
                      +            ++ .+|+++||..+|.+.+++++++.+++++++++|+|.|||+++|+++++|+|++|++|||+++|.
T Consensus       299 ~------------~l-~~g~lAGs~l~l~~~v~~~v~~~g~~~~~al~~aT~~pA~~lg~~~~~G~i~~G~~ADlvvld~  365 (381)
T 3iv8_A          299 C------------VD-ENGTLGGSALTMIEAVQNTVEHVGIALDEALRMATLYPAKAIGVDEKLGRIKKGMIANLTVFDR  365 (381)
T ss_dssp             E------------EC-TTCCBCSBCCCHHHHHHHHHHTTCCCHHHHHHHHTHHHHHHHTCTTTSSSCCTTSBCCEEEECT
T ss_pred             E------------Ec-CCCCccChhhhHHHHHHHHHHhhCCCHHHHHHHHHHHHHHHhCCCCCCceECCCCcCCEEEECC
Confidence            7            44 6799999999999999999998899999999999999999999988789999999999999999


Q ss_pred             CCceeEEEECCEEecC
Q psy12256        402 GLHVYSTWIAGDLKLT  417 (417)
Q Consensus       402 ~~~v~~v~~~G~~v~~  417 (417)
                      +.+|..||++|+++|+
T Consensus       366 ~~~v~~t~~~G~~v~~  381 (381)
T 3iv8_A          366 DFNVKATVVNGQYEQN  381 (381)
T ss_dssp             TCCEEEEEETTEEEEC
T ss_pred             CCCEEEEEECCEEeeC
Confidence            9999999999999985
>1yrr_A N-acetylglucosamine-6-phosphate deacetylase; (beta/alpha)8 barrel, beta sandwich, hydrolase; 2.00A {Escherichia coli} SCOP: b.92.1.5 c.1.9.10 PDB: 1ymy_A 2p50_A 2p53_A* Back     alignment and structure
>2vhl_A N-acetylglucosamine-6-phosphate deacetylase; N- acetyleglucosamine-6-phosphate, carbohydrate metabolism, hydrolase; HET: GLP PGE; 2.05A {Bacillus subtilis} Back     alignment and structure
>1o12_A N-acetylglucosamine-6-phosphate deacetylase; structural genomics, TM0814, JCSG, PSI, protein structure initiative; 2.50A {Thermotoga maritima} SCOP: b.92.1.5 c.1.9.10 Back     alignment and structure
>1nfg_A D-hydantoinase; TIM barrel, hydrolase; HET: KCX; 2.70A {Ralstonia pickettii} SCOP: b.92.1.3 c.1.9.6 Back     alignment and structure
>2vr2_A Dihydropyrimidinase; hydantoinase, metal-binding, disease mutation, dihydropyrimi amidohydrolase, nucleotide metabolism, DPYS, dhpase, hydrolase; 2.80A {Homo sapiens} Back     alignment and structure
>1gkp_A Hydantoinase; hydrolase, dihydropyrimidinase, cyclic amidase; HET: KCX EPE; 1.29A {Thermus SP} SCOP: b.92.1.3 c.1.9.6 PDB: 1gkq_A* Back     alignment and structure
>2vm8_A Dihydropyrimidinase-related protein 2; neurogenesis, phosphoprotein, differentiation, CRMP, cytoplasm, TIM barrel, polymorphism, axonal pathfinding; 1.9A {Homo sapiens} PDB: 2gse_A 1kcx_A Back     alignment and structure
>2ftw_A Dihydropyrimidine amidohydrolase; (beta-alpha)8-barrel, beta-sandwich; HET: KCX; 2.05A {Dictyostelium discoideum} SCOP: b.92.1.3 c.1.9.6 Back     alignment and structure
>2r8c_A Putative amidohydrolase; unknown source, sargasso SEA, structural genomics, protein structure initiative, PSI; 2.31A {Unidentified} PDB: 3mkv_A* Back     alignment and structure
>3feq_A Putative amidohydrolase; unknown source, sargasso SEA, structural GEN protein structure initiative, PSI; 2.63A {Unidentified} PDB: 3lwy_A* 3n2c_A* Back     alignment and structure
>2p9b_A Possible prolidase; protein structure initiative II, PSI-2, amidohydrolase, structural genomics; 1.70A {Bifidobacterium longum NCC2705} SCOP: b.92.1.10 c.1.9.17 Back     alignment and structure
>3be7_A Zn-dependent arginine carboxypeptidase; unknown source, amidohydrolase, sargasso SEA, structural GEN protein structure initiative, PSI; HET: ARG; 2.30A {Unidentified} SCOP: b.92.1.9 c.1.9.18 PDB: 3dug_A* Back     alignment and structure
>1gkr_A Hydantoinase, non-ATP dependent L-selective hydantoinase; hydrolase, dihydropyrimidinase, cyclic amidase; HET: KCX; 2.60A {Arthrobacter aurescens} SCOP: b.92.1.3 c.1.9.6 Back     alignment and structure
>2qs8_A XAA-Pro dipeptidase; amidohydrolase, TIM barrel, protein structure initiative, PSI-2, NYSGXRC, structural genomics; 2.33A {Alteromonas macleodii} SCOP: b.92.1.9 c.1.9.18 Back     alignment and structure
>2ics_A Adenine deaminase; TIM barrel, binuclear zinc, adenine complex, amidohydrolase, structural genomics, PSI, protein structure initiative; HET: KCX ADE; 2.30A {Enterococcus faecalis} SCOP: b.92.1.8 c.1.9.14 Back     alignment and structure
>2paj_A Putative cytosine/guanine deaminase; NYSGXRC, PSI-II, amidohydrolase, sargasso SEA, enviro sample, structural genomics; 2.70A {Unidentified} SCOP: b.92.1.4 c.1.9.9 Back     alignment and structure
>2q09_A Imidazolonepropionase; 9252H, NYSGXRC, 3-(2, 5-dioxo-imidazo 4YL)-propionic acid, PSI-2 community, structural genomics, structure initiative; HET: DI6; 1.97A {Unidentified} SCOP: b.92.1.10 c.1.9.17 PDB: 2oof_A* Back     alignment and structure
>2vun_A Enamidase; nicotinate degradation, binuclear metal center, amidohydrolases, stereospecificity, hydrolase; 1.89A {Eubacterium barkeri} Back     alignment and structure
>1onw_A Isoaspartyl dipeptidase; amidohydrolase, hydrolase, metalloprotease; HET: KCX; 1.65A {Escherichia coli} SCOP: b.92.1.7 c.1.9.13 PDB: 1onx_A* 1po9_A* 1poj_A* 1pok_B* 2aqo_A* 1ybq_A* 2aqv_A* Back     alignment and structure
>3dc8_A Dihydropyrimidinase; TIM-barrel, hydrolase; HET: KCX; 1.85A {Sinorhizobium meliloti} Back     alignment and structure
>3lnp_A Amidohydrolase family protein OLEI01672_1_465; TIM barrel, beta-fold, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.10A {Oleispira antarctica} Back     alignment and structure
>2bb0_A Imidazolonepropionase; TIM barrel, hydrolase; 2.00A {Bacillus subtilis} SCOP: b.92.1.10 c.1.9.17 PDB: 2g3f_A Back     alignment and structure
>2puz_A Imidazolonepropionase; NYSGXRC, PSI-2, N-formimino-L- glutamate, product-bound, structural genomics, protein STRU initiative; HET: NIG; 1.83A {Agrobacterium tumefaciens str} SCOP: b.92.1.10 c.1.9.17 PDB: 2gok_A Back     alignment and structure
>3ls9_A Triazine hydrolase; atrazine chlorohydrolase TRZN; 1.40A {Arthrobacter aurescens} PDB: 3lsc_A* 3lsb_A* Back     alignment and structure
>2ogj_A Dihydroorotase; TIM barrel, binuclear zinc, imidazole complex, amido hydrola 9244B, structural genomics, PSI-2; HET: KCX; 2.62A {Agrobacterium tumefaciens} Back     alignment and structure
>4dyk_A Amidohydrolase; adenosine deaminase, nysgrc, structural GENO PSI-biology, NEW YORK structural genomics research consorti hydrolase; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>2ood_A BLR3880 protein; PSI-II, PSI-2, guanine deaminase, guanine, structural genomics, protein structure initiative; HET: GUN; 2.62A {Bradyrhizobium japonicum} SCOP: b.92.1.4 c.1.9.9 Back     alignment and structure
>3sfw_A Dihydropyrimidinase; hydrolase, zinc binding; HET: KCX; 1.73A {Brevibacillus agri} PDB: 1yny_A 1k1d_A* Back     alignment and structure
>4f0r_A 5-methylthioadenosine/S-adenosylhomocysteine DEAM; structural genomics, PSI-biology; HET: MSE MTA; 1.80A {Chromobacterium violaceum} PDB: 4f0s_A* Back     alignment and structure
>4aql_A Guanine deaminase; hydrolase, purine metabolism; HET: TXC; 1.99A {Homo sapiens} PDB: 2uz9_A* 3e0l_A Back     alignment and structure
>3e74_A Allantoinase; (beta/alpha)8-barrel domain, small beta-sheet domain, hydrolase, metal-binding, purine metabolism, zinc; HET: KCX; 2.10A {Escherichia coli} Back     alignment and structure
>2i9u_A Cytosine/guanine deaminase related protein; protein structure initiative II (PSI-II), amidohydrol guanine deaminase; HET: GUN; 2.05A {Clostridium acetobutylicum} SCOP: b.92.1.4 c.1.9.9 Back     alignment and structure
>3gri_A Dihydroorotase, dhoase; hydrolase, IDP00795, metal-binding, pyrimidine biosynthesis, structural genomics; 2.00A {Staphylococcus aureus subsp} Back     alignment and structure
>3nqb_A Adenine deaminase 2; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics, nysgxrc; 2.21A {Agrobacterium tumefaciens} PDB: 3t81_A 3t8l_A Back     alignment and structure
>4dzh_A Amidohydrolase; adenosine deaminase, nysgrc, structural GENO YORK structural genomics research consortium; 1.55A {Xanthomonas campestris PV} Back     alignment and structure
>3mpg_A Dihydroorotase, dhoase; hydrolase; 2.60A {Bacillus anthracis} Back     alignment and structure
>2fty_A Dihydropyrimidinase; alpha/beta barrel, beta-sandwich, hydrolase; HET: KCX; 2.40A {Lachancea kluyveri} SCOP: b.92.1.3 c.1.9.6 PDB: 2fvk_A* 2fvm_A* Back     alignment and structure
>1p1m_A Hypothetical protein TM0936; putative metal dependent hydrolase, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: b.92.1.4 c.1.9.9 PDB: 2plm_A* 1j6p_A Back     alignment and structure
>2gwn_A Dihydroorotase; zinc-binding prote structural genomics, PSI, protein structure initiative, MID center for structural genomics, MCSG; HET: KCX GOL; 1.85A {Porphyromonas gingivalis} Back     alignment and structure
>3hm7_A Allantoinase; metallo-dependent hydrolase, protein structure initiative, PSI-2, NEW YORK structural genomix research CON nysgxrc; 2.60A {Bacillus halodurans} Back     alignment and structure
>2z00_A Dihydroorotase; zinc binding protein, hydrolase, metal-binding, pyrimidine biosynthesis, structural genomics, NPPSFA; 2.42A {Thermus thermophilus} Back     alignment and structure
>1xrt_A Dihydroorotase, dhoase; amidohydrolase, metalloenzyme, pyrimidine; 1.61A {Aquifex aeolicus} SCOP: b.92.1.3 c.1.9.6 PDB: 1xrf_A 3d6n_A* Back     alignment and structure
>3mtw_A L-arginine carboxypeptidase CC2672; hydrolase; HET: KCX M3R; 1.70A {Caulobacter vibrioides} Back     alignment and structure
>2imr_A Hypothetical protein DR_0824; zinc, NYSGXRC, PSI2, structural genomics, protein structure initiative; 1.78A {Deinococcus radiodurans} SCOP: b.92.1.11 c.1.9.16 Back     alignment and structure
>2qt3_A N-isopropylammelide isopropyl amidohydrolase; N-isopropylammelide isopropylaminohydrolase ATZC, structural genomics, NYSGXRC, target 9364B; 2.24A {Pseudomonas SP} Back     alignment and structure
>3hpa_A Amidohydrolase; signature of Zn ligands, structural genomics, NYSGXRC, target 9236E, PSI-2, protein structure initiative; 2.20A {Unidentified} Back     alignment and structure
>3gip_A N-acyl-D-glutamate deacylase; amidohydrolase family, hydrolase; 1.50A {Bordetella bronchiseptica} PDB: 3giq_A* Back     alignment and structure
>3mdu_A N-formimino-L-glutamate iminohydrolase; amonohydralase family, N-formimino-L-glutamate iminohydrolas guanidino-L-glutamate; HET: NGQ; 1.40A {Pseudomonas aeruginosa} PDB: 3mdw_A* Back     alignment and structure
>4f0l_A Amidohydrolase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.05A {Brucella melitensis biovar abortus} Back     alignment and structure
>1ra0_A Cytosine deaminase; alpha-beta barrel, hexamer, conformation change, D314G mutant, hydrolase; 1.12A {Escherichia coli} SCOP: b.92.1.2 c.1.9.5 PDB: 1r9x_A 1ra5_A 1r9y_A 1r9z_A 1rak_A 3r0d_A* 3o7u_A* 3rn6_A* 1k6w_A 1k70_A 3g77_A Back     alignment and structure
>3ooq_A Amidohydrolase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, H PSI-2; 2.06A {Thermotoga maritima} Back     alignment and structure
>4ac7_C Urease subunit alpha; hydrolase, bacillus pasteurii; HET: CXM KCX FLC; 1.50A {Sporosarcina pasteurii} PDB: 1s3t_C* 2ubp_C* 3ubp_C* 1ubp_C* 4ubp_C* 1ie7_C* Back     alignment and structure
>4gy7_A Urease; JACK bean, hydrolase, ME binding, nickel; HET: CME KCX; 1.49A {Canavalia ensiformis} PDB: 3la4_A* 4h9m_A* Back     alignment and structure
>3v7p_A Amidohydrolase family protein; iron binding site, enzyme functio initiative, EFI; HET: TLA; 1.35A {Nitratiruptor SP} Back     alignment and structure
>4ubp_C Protein (urease (chain C)); bacillus pasteurii, nickel, acetohydroxamic acid, metalloenzyme, hydrolase; HET: KCX; 1.55A {Sporosarcina pasteurii} SCOP: b.92.1.1 c.1.9.2 PDB: 1s3t_C* 2ubp_C* 3ubp_C* 1ubp_C* 1ie7_C* Back     alignment and structure
>1e9y_B Urease subunit beta; hydrolase, dodecamer; HET: KCX; 3.00A {Helicobacter pylori} SCOP: b.92.1.1 c.1.9.2 PDB: 1e9z_B* 3qga_C* 3qgk_C* Back     alignment and structure
>1rk6_A D-aminoacylase; TIM barrel, beta barrel, insertion, hydrolase; 1.43A {Alcaligenes faecalis} SCOP: b.92.1.6 b.92.1.6 c.1.9.11 PDB: 1rjp_A 1v51_A 1rjq_A 1rjr_A 1rk5_A 1v4y_A 1m7j_A Back     alignment and structure
>4ep8_C Urease subunit alpha; alpha-beta barrel, nickel metalloenzyme, hydrolase, radiatio; HET: KCX; 1.55A {Enterobacter aerogenes} PDB: 1ef2_A* 4epb_C* 4epd_C* 4epe_C* 1ejx_C* 1ejw_C* 1fwj_C* 1kra_C 2kau_C* 1a5k_C 1ejv_C* 1ejt_C* 1eju_C* 1ejs_C* 1a5m_C 1a5n_C 1ejr_C* 1a5l_C 1a5o_C 1fwa_C* ... Back     alignment and structure
>3icj_A Uncharacterized metal-dependent hydrolase; structural genomics, amidohydrolase, PSI-2, protein structur initiative; HET: KCX; 1.95A {Pyrococcus furiosus} PDB: 3etk_A* 3igh_X* Back     alignment and structure
>3pnu_A Dihydroorotase; TIM barrel, zinc binding, hydrolase, structu genomics, center for structural genomics of infectious DISE csgid; HET: KCX; 2.40A {Campylobacter jejuni subsp} Back     alignment and structure
>3iv8_A N-acetylglucosamine-6-phosphate deacetylase; IDP01334, fruct phosphate, carbohydrate metabolism, hydrolase; HET: F6P; 2.53A {Vibrio cholerae} PDB: 3egj_A* Back     alignment and structure
>3mkv_A Putative amidohydrolase; sargasso SEA, structural genomics, protein structure initiat NEW YORK structural genomix research consortium, nysgxrc; HET: KCX; 2.40A {Undefined} Back     alignment and structure
>2z26_A Dihydroorotase, dhoase; TIM barrel, hydrolase; HET: KCX DOR NCD; 1.29A {Escherichia coli} PDB: 2z24_A* 2z25_A* 2eg6_A* 1xge_A* 2eg7_A* 2eg8_A* 2z27_A* 2e25_A* 2z28_A* 2z29_A* 3mjm_A* 2z2a_A* 1j79_A* 2z2b_A* 3ihn_A* 3jze_A* Back     alignment and structure
>3ggm_A Uncharacterized protein BT9727_2919; bacillus cereus group., structural genomics, PSI-2, protein structure initiative; 2.00A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>1zzm_A Putative deoxyribonuclease YJJV; hydrolaze, zinc, PEG, structural genomics, PSI; HET: P33; 1.80A {Escherichia coli} SCOP: c.1.9.12 Back     alignment and structure
>3mkv_A Putative amidohydrolase; sargasso SEA, structural genomics, protein structure initiat NEW YORK structural genomix research consortium, nysgxrc; HET: KCX; 2.40A {Undefined} Back     alignment and structure
>1xwy_A DNAse TATD, deoxyribonuclease TATD; TIM barrael, zinc ION, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.1.9.12 Back     alignment and structure
>3rcm_A TATD family hydrolase; HET: CIT; 2.05A {Pseudomonas putida} Back     alignment and structure
>2ob3_A Parathion hydrolase; metalloenzyme, TIM barrel, nerve agents; HET: KCX BTB; 1.04A {Brevundimonas diminuta} PDB: 1psc_A* 1jgm_A* 3cak_A* 1ez2_A* 1eyw_A* 1hzy_A 1i0b_A 1i0d_A 1p6b_A* 1p6c_A* 2oql_A* 2o4q_A* 3cs2_A* 3e3h_A* 1qw7_A* 1dpm_A* 2o4m_A* 1pta_A 3c86_A* 2d2j_A ... Back     alignment and structure
>1bf6_A Phosphotriesterase homology protein; hypothetical protein; 1.70A {Escherichia coli} SCOP: c.1.9.3 Back     alignment and structure
>1yix_A Deoxyribonuclease YCFH; TIM barrel, zinc ION, NEW YORK SGX center for structural genomics, nysgxrc; 1.90A {Escherichia coli} SCOP: c.1.9.12 Back     alignment and structure
>2y1h_A Putative deoxyribonuclease tatdn3; hydrolase; 2.50A {Homo sapiens} Back     alignment and structure
>2vc7_A Aryldialkylphosphatase; phosphotriesterase, promiscuous activities, enzyme evolution, hyperthermophilic, lactonase, hydrolase; HET: KCX GOL HT5; 2.05A {Sulfolobus solfataricus} PDB: 2vc5_A* Back     alignment and structure
>3k2g_A Resiniferatoxin-binding, phosphotriesterase- related protein; TIM barrel, binuclear zinc, protein structure initiative II (PSI II); 1.80A {Rhodobacter sphaeroides 2} Back     alignment and structure
>2xio_A Putative deoxyribonuclease tatdn1; hydrolase; 1.19A {Homo sapiens} Back     alignment and structure
>2gzx_A Putative TATD related DNAse; deoxyribonuclease, NESG, ZR237, structural GENO PSI, protein structure initiative; 2.20A {Staphylococcus aureus subsp} Back     alignment and structure
>1o12_A N-acetylglucosamine-6-phosphate deacetylase; structural genomics, TM0814, JCSG, PSI, protein structure initiative; 2.50A {Thermotoga maritima} SCOP: b.92.1.5 c.1.9.10 Back     alignment and structure
>3rhg_A Putative phophotriesterase; hydrolase, amidohydrolase, zinc binding site, enzyme functio initiative, EFI; HET: SO4; 1.53A {Proteus mirabilis} Back     alignment and structure
>1j6o_A TATD-related deoxyribonuclease; structural genomics, TM0667, JCSG, PSI, protein structure initiative, joint center for structural genomics; 1.80A {Thermotoga maritima} SCOP: c.1.9.12 Back     alignment and structure
>1yrr_A N-acetylglucosamine-6-phosphate deacetylase; (beta/alpha)8 barrel, beta sandwich, hydrolase; 2.00A {Escherichia coli} SCOP: b.92.1.5 c.1.9.10 PDB: 1ymy_A 2p50_A 2p53_A* Back     alignment and structure
>3gg7_A Uncharacterized metalloprotein; structural genomics, unknown function, plasmid, PSI-2, protein structure initiative; 1.50A {Deinococcus radiodurans} SCOP: c.1.9.0 Back     alignment and structure
>3ipw_A Hydrolase TATD family protein; niaid, ssgcid, seattle structural genomics center for infect disease, dysentery, liver abcess; 1.95A {Entamoeba histolytica hm-1} Back     alignment and structure
>2vhl_A N-acetylglucosamine-6-phosphate deacetylase; N- acetyleglucosamine-6-phosphate, carbohydrate metabolism, hydrolase; HET: GLP PGE; 2.05A {Bacillus subtilis} Back     alignment and structure
>3tn4_A Phosphotriesterase; lactonase, hydrolase; HET: KCX; 1.50A {Geobacillus kaustophilus} PDB: 3tnb_A* 3tn3_A* 3tn5_A* 3tn6_A* 3ojg_A* 3orw_A* 3f4c_A* 3f4d_A* Back     alignment and structure
>3gtx_A Organophosphorus hydrolase; mutant, amidohydrolase, alpha-beta barrel; HET: KCX; 1.62A {Deinococcus radiodurans} PDB: 2zc1_A* 3gti_A* 3gu9_A* 3gtf_A* 3gth_A* 3gu2_A* 3gu1_A* 3fdk_A* 3htw_A* Back     alignment and structure
>2wje_A CPS4B, tyrosine-protein phosphatase CPSB; capsule biogenesis/degradation, manganese, hydrolase, exopolysaccharide synthesis; 1.90A {Streptococcus pneumoniae} PDB: 2wjd_A 2wjf_A 3qy8_A Back     alignment and structure
>4i6k_A Amidohydrolase family protein; enzyme function initiative, isomerase, structural; HET: CIT; 2.28A {Acinetobacter baumannii} Back     alignment and structure
>3ovg_A Amidohydrolase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, NYSGXRC, HAD, PSI; HET: KCX; 2.06A {Mycoplasma synoviae} PDB: 3msr_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 417
d1yrra2297 c.1.9.10 (A:54-350) N-acetylglucosamine-6-phosphat 9e-28
d1o12a2288 c.1.9.10 (A:44-331) N-acetylglucosamine-6-phosphat 6e-27
d2vhla2301 c.1.9.10 (A:58-358) N-acetylglucosamine-6-phosphat 2e-24
d1onwa2284 c.1.9.13 (A:63-346) Isoaspartyl dipeptidase, catal 1e-08
d1onwa2284 c.1.9.13 (A:63-346) Isoaspartyl dipeptidase, catal 7e-07
d2icsa2267 c.1.9.14 (A:55-321) Putative adenine deaminase EF0 3e-05
d2bb0a1113 b.92.1.10 (A:3-73,A:374-415) Imidazolonepropionase 2e-04
>d1yrra2 c.1.9.10 (A:54-350) N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain {Escherichia coli [TaxId: 562]} Length = 297 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Metallo-dependent hydrolases
family: N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain
domain: N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain
species: Escherichia coli [TaxId: 562]

 Score =  109 bits (272), Expect = 9e-28
 Identities = 91/372 (24%), Positives = 148/372 (39%), Gaps = 76/372 (20%)

Query: 16  GFIDIQINGGFGVDFSHDIDSVDKN-VSIVARGILAHGVTSFCPTLVTSEPQVYKKVLSR 74
           GFID+Q+NG  GV F+   ++V    + I+ +     G T++ PTL+T+  ++ K+ +  
Sbjct: 1   GFIDVQLNGCGGVQFNDTAEAVSVETLEIMQKANEKSGCTNYLPTLITTSDELMKQGVRV 60

Query: 75  LRKTPGGKHGATVLGAHVEGPFISPDKKGAHSLSKIVTFDKGFDSVREVYGNLSNIAIIT 134
           +R+    KH    LG H+EGP+++  KKG H+ + +   D     V  +  N   I  +T
Sbjct: 61  MREY-LAKHPNQALGLHLEGPWLNLVKKGTHNPNFVRKPDAAL--VDFLCENADVITKVT 117

Query: 135 LAPELAGSMEVIDKLVEQGITVSLGHSSADINIAEEAVRHGASLITHLFNAMLPFHHRDP 194
           LAPE+    EVI KL   GI VS GHS+A +  A+   R G +  THL+NAM     R+P
Sbjct: 118 LAPEMVP-AEVISKLANAGIVVSAGHSNATLKEAKAGFRAGITFATHLYNAMPYITGREP 176

Query: 195 GIIGLLSSDNIDSSKVYYGIIADGVHTHPSALRIANSTHPEGHSSADIHIAEEAVRHGAS 254
           G+ G +    +D + +Y GIIADG+H   + +R A     +                  +
Sbjct: 177 GLAGAI----LDEADIYCGIIADGLHVDYANIRNAKRLKGDKLCLVTDA-------TAPA 225

Query: 255 LITHLFNAMLPFHHRDPGIIGLLSSDNIDSSKVYYGIIADGVHTHPSALRIANSTHPEGS 314
                              + +  +                                 GS
Sbjct: 226 GANIEQFIFAGKTIYYRNGLCVDENG-----------------------------TLSGS 256

Query: 315 ITPFNGCVQFFMRSTRCSLWFDLGNCNNGGSITPFNGCVQFFMRSTRCSLVHALEVASLH 374
                  V+  +     +L                                  L +A+L+
Sbjct: 257 SLTMIEGVRNLVEHCGIALD-------------------------------EVLRMATLY 285

Query: 375 PAKALGLEQHKG 386
           PA+A+G+E+  G
Sbjct: 286 PARAIGVEKRLG 297
>d1o12a2 c.1.9.10 (A:44-331) N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain {Thermotoga maritima [TaxId: 2336]} Length = 288 Back     information, alignment and structure
>d1onwa2 c.1.9.13 (A:63-346) Isoaspartyl dipeptidase, catalytic domain {Escherichia coli [TaxId: 562]} Length = 284 Back     information, alignment and structure
>d1onwa2 c.1.9.13 (A:63-346) Isoaspartyl dipeptidase, catalytic domain {Escherichia coli [TaxId: 562]} Length = 284 Back     information, alignment and structure
>d2icsa2 c.1.9.14 (A:55-321) Putative adenine deaminase EF0837 {Enterococcus faecalis [TaxId: 1351]} Length = 267 Back     information, alignment and structure
>d2bb0a1 b.92.1.10 (A:3-73,A:374-415) Imidazolonepropionase {Bacillus subtilis [TaxId: 1423]} Length = 113 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query417
d2vhla2301 N-acetylglucosamine-6-phosphate deacetylase, NagA, 99.88
d1o12a2288 N-acetylglucosamine-6-phosphate deacetylase, NagA, 99.85
d1yrra2297 N-acetylglucosamine-6-phosphate deacetylase, NagA, 99.83
d1gkpa2335 D-hydantoinase {Thermus sp. [TaxId: 275]} 99.44
d1kcxa2334 Dihydropyrimidinase related protein-1 {Mouse (Mus 99.41
d2ftwa2334 Dihydropyrimidine amidohydrolase Pyd2 {Dictyosteli 99.4
d1onwa2284 Isoaspartyl dipeptidase, catalytic domain {Escheri 99.39
d2icsa2267 Putative adenine deaminase EF0837 {Enterococcus fa 99.37
d1ynya2332 D-hydantoinase {Bacillus sp. AR9 [TaxId: 301298]} 99.36
d2fvka2384 Dihydropyrimidine amidohydrolase Pyd2 {Yeast (Sacc 99.26
d1nfga2330 D-hydantoinase {Burkholderia pickettii [TaxId: 329 99.26
d1gkra2325 L-hydantoinase {Arthrobacter aurescens [TaxId: 436 99.26
d2uz9a2313 Guanine deaminase {Human (Homo sapiens) [TaxId: 96 99.07
d1xrta2310 Two-domain dihydroorotase {Aquifex aeolicus [TaxId 99.05
d2p9ba2324 Uncharacterized protein BL1453 {Bifidobacterium lo 98.92
d2ooda2325 Guanine deaminase {Bradyrhizobium japonicum [TaxId 98.87
d2puza2301 Imidazolonepropionase {Agrobacterium tumefaciens [ 98.85
d2bb0a2300 Imidazolonepropionase {Bacillus subtilis [TaxId: 1 98.83
d2q09a2301 Probable 4-imidazolone-5-propanoate amidohydrolase 98.8
d2qs8a2310 Xaa-Pro dipeptidase {Alteromonas macleodii [TaxId: 98.8
d2bb0a1113 Imidazolonepropionase {Bacillus subtilis [TaxId: 1 98.78
d3be7a2303 Zn-dependent arginine carboxypeptidase {Unidentifi 98.77
d2i9ua2310 Guanine deaminase {Clostridium acetobutylicum [Tax 98.76
d2r8ca2311 Uncharacterized protein EAJ56179 {Unidentified org 98.55
d2paja2336 Hypothetical protein GOS_1943094 {Environmental sa 98.49
d3be7a195 Zn-dependent arginine carboxypeptidase {Unidentifi 98.39
d2imra2308 Hypothetical protein DR0824 {Deinococcus radiodura 98.37
d1i0da_331 Phosphotriesterase (parathion hydrolase, PTE) {Pse 98.27
d2i9ua1109 Guanine deaminase {Clostridium acetobutylicum [Tax 98.2
d2eg6a1343 Dihydroorotase {Escherichia coli [TaxId: 562]} 98.15
d1yrra185 N-acetylglucosamine-6-phosphate deacetylase, NagA 98.1
d2p9ba1118 Uncharacterized protein BL1453 {Bifidobacterium lo 98.05
d2paja1139 Hypothetical protein GOS_1943094 {Environmental sa 98.04
d1p1ma2281 Hypothetical protein TM0936, probable catalytic do 98.04
d1ejxc1181 alpha-Subunit of urease {Klebsiella aerogenes [Tax 98.04
d1p1ma1123 Hypothetical protein TM0936 {Thermotoga maritima [ 98.02
d1onwa1105 Isoaspartyl dipeptidase {Escherichia coli [TaxId: 97.93
d1m7ja261 N-acyl-D-aminoacid amidohydrolase {Alcaligenes fae 97.89
d2puza1103 Imidazolonepropionase {Agrobacterium tumefaciens [ 97.7
d1ra0a2320 Cytosine deaminase catalytic domain {Escherichia c 97.61
d2r8ca1102 Uncharacterized protein EAJ56179 {Unidentified org 97.59
d4ubpc2390 alpha-subunit of urease, catalytic domain {Bacillu 97.45
d1nfga1127 D-hydantoinase {Burkholderia pickettii [TaxId: 329 97.28
d2q09a1103 Probable 4-imidazolone-5-propanoate amidohydrolase 97.22
d2ooda1140 Guanine deaminase {Bradyrhizobium japonicum [TaxId 97.18
d2qs8a196 Xaa-Pro dipeptidase {Alteromonas macleodii [TaxId: 97.16
d1ynya1127 D-hydantoinase {Bacillus sp. AR9 [TaxId: 301298]} 97.1
d2fvka1156 Dihydropyrimidine amidohydrolase Pyd2 {Yeast (Sacc 97.04
d1xrta1112 Two-domain dihydroorotase {Aquifex aeolicus [TaxId 97.03
d2vhla191 N-acetylglucosamine-6-phosphate deacetylase, NagA 96.8
d1e9yb2389 alpha-subunit of urease, catalytic domain {Helicob 96.79
d1kcxa1142 Dihydropyrimidinase related protein-1 {Mouse (Mus 96.5
d1yixa1265 Putative deoxyribonuclease YcfH {Escherichia coli 96.5
d1bf6a_291 Phosphotriesterase homology protein {Escherichia c 96.46
d1k1da1128 D-hydantoinase {Bacillus stearothermophilus [TaxId 96.44
d2ftwa1150 Dihydropyrimidine amidohydrolase Pyd2 {Dictyosteli 96.37
d1xwya1260 Deoxyribonuclease TatD (MttC) {Escherichia coli [T 96.12
d2uz9a1131 Guanine deaminase {Human (Homo sapiens) [TaxId: 96 96.04
d1o12a176 N-acetylglucosamine-6-phosphate deacetylase, NagA 95.94
d1zzma1259 Putative deoxyribonuclease YjjV {Escherichia coli 95.71
d1gkra1126 L-hydantoinase {Arthrobacter aurescens [TaxId: 436 95.44
d1gkpa1123 D-hydantoinase {Thermus sp. [TaxId: 275]} 95.34
d1gkra1126 L-hydantoinase {Arthrobacter aurescens [TaxId: 436 95.12
d1j6oa_260 Hypothetical protein TM0667 {Thermotoga maritima [ 94.03
d2icsa1101 Putative adenine deaminase EF0837 {Enterococcus fa 93.33
d1ra0a2320 Cytosine deaminase catalytic domain {Escherichia c 91.38
d1kcxa1142 Dihydropyrimidinase related protein-1 {Mouse (Mus 90.36
d4ubpc1180 alpha-Subunit of urease {Bacillus pasteurii [TaxId 87.77
d1m7ja3358 N-acyl-D-aminoacid amidohydrolase, catalytic domai 86.77
d1m7ja3358 N-acyl-D-aminoacid amidohydrolase, catalytic domai 86.49
d1ejxc2385 alpha-subunit of urease, catalytic domain {Klebsie 85.42
d2ftwa1150 Dihydropyrimidine amidohydrolase Pyd2 {Dictyosteli 80.72
>d1o12a2 c.1.9.10 (A:44-331) N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yrra2 c.1.9.10 (A:54-350) N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkpa2 c.1.9.6 (A:55-389) D-hydantoinase {Thermus sp. [TaxId: 275]} Back     information, alignment and structure
>d1kcxa2 c.1.9.6 (A:67-400) Dihydropyrimidinase related protein-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ftwa2 c.1.9.6 (A:60-393) Dihydropyrimidine amidohydrolase Pyd2 {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1onwa2 c.1.9.13 (A:63-346) Isoaspartyl dipeptidase, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2icsa2 c.1.9.14 (A:55-321) Putative adenine deaminase EF0837 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1ynya2 c.1.9.6 (A:53-384) D-hydantoinase {Bacillus sp. AR9 [TaxId: 301298]} Back     information, alignment and structure
>d2fvka2 c.1.9.6 (A:57-440) Dihydropyrimidine amidohydrolase Pyd2 {Yeast (Saccharomyces kluyveri) [TaxId: 4934]} Back     information, alignment and structure
>d1nfga2 c.1.9.6 (A:52-381) D-hydantoinase {Burkholderia pickettii [TaxId: 329]} Back     information, alignment and structure
>d1gkra2 c.1.9.6 (A:55-379) L-hydantoinase {Arthrobacter aurescens [TaxId: 43663]} Back     information, alignment and structure
>d2uz9a2 c.1.9.9 (A:76-388) Guanine deaminase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xrta2 c.1.9.6 (A:56-365) Two-domain dihydroorotase {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2p9ba2 c.1.9.17 (A:71-394) Uncharacterized protein BL1453 {Bifidobacterium longum [TaxId: 216816]} Back     information, alignment and structure
>d2ooda2 c.1.9.9 (A:73-397) Guanine deaminase {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d2puza2 c.1.9.17 (A:80-380) Imidazolonepropionase {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2bb0a2 c.1.9.17 (A:74-373) Imidazolonepropionase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2q09a2 c.1.9.17 (A:66-366) Probable 4-imidazolone-5-propanoate amidohydrolase GOS_1928421 {Environmental samples} Back     information, alignment and structure
>d2qs8a2 c.1.9.18 (A:64-373) Xaa-Pro dipeptidase {Alteromonas macleodii [TaxId: 28108]} Back     information, alignment and structure
>d2bb0a1 b.92.1.10 (A:3-73,A:374-415) Imidazolonepropionase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3be7a2 c.1.9.18 (A:57-359) Zn-dependent arginine carboxypeptidase {Unidentified organism [TaxId: 32644]} Back     information, alignment and structure
>d2i9ua2 c.1.9.9 (A:67-376) Guanine deaminase {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2r8ca2 c.1.9.18 (A:58-368) Uncharacterized protein EAJ56179 {Unidentified organism [TaxId: 32644]} Back     information, alignment and structure
>d2paja2 c.1.9.9 (A:70-405) Hypothetical protein GOS_1943094 {Environmental samples} Back     information, alignment and structure
>d3be7a1 b.92.1.9 (A:3-56,A:360-400) Zn-dependent arginine carboxypeptidase {Unidentified organism [TaxId: 32644]} Back     information, alignment and structure
>d2imra2 c.1.9.16 (A:91-398) Hypothetical protein DR0824 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1i0da_ c.1.9.3 (A:) Phosphotriesterase (parathion hydrolase, PTE) {Pseudomonas diminuta [TaxId: 293]} Back     information, alignment and structure
>d2i9ua1 b.92.1.4 (A:9-66,A:377-427) Guanine deaminase {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2eg6a1 c.1.9.4 (A:4-346) Dihydroorotase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yrra1 b.92.1.5 (A:1-53,A:351-382) N-acetylglucosamine-6-phosphate deacetylase, NagA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p9ba1 b.92.1.10 (A:9-70,A:395-450) Uncharacterized protein BL1453 {Bifidobacterium longum [TaxId: 216816]} Back     information, alignment and structure
>d2paja1 b.92.1.4 (A:10-69,A:406-484) Hypothetical protein GOS_1943094 {Environmental samples} Back     information, alignment and structure
>d1p1ma2 c.1.9.9 (A:50-330) Hypothetical protein TM0936, probable catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ejxc1 b.92.1.1 (C:1002-1129,C:1423-1475) alpha-Subunit of urease {Klebsiella aerogenes [TaxId: 28451]} Back     information, alignment and structure
>d1p1ma1 b.92.1.4 (A:1-49,A:331-404) Hypothetical protein TM0936 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1onwa1 b.92.1.7 (A:1-62,A:347-389) Isoaspartyl dipeptidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ja2 b.92.1.6 (A:420-480) N-acyl-D-aminoacid amidohydrolase {Alcaligenes faecalis [TaxId: 511]} Back     information, alignment and structure
>d2puza1 b.92.1.10 (A:17-79,A:381-420) Imidazolonepropionase {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ra0a2 c.1.9.5 (A:56-375) Cytosine deaminase catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2r8ca1 b.92.1.9 (A:2-57,A:369-414) Uncharacterized protein EAJ56179 {Unidentified organism [TaxId: 32644]} Back     information, alignment and structure
>d4ubpc2 c.1.9.2 (C:132-434,C:484-570) alpha-subunit of urease, catalytic domain {Bacillus pasteurii [TaxId: 1474]} Back     information, alignment and structure
>d1nfga1 b.92.1.3 (A:1-51,A:382-457) D-hydantoinase {Burkholderia pickettii [TaxId: 329]} Back     information, alignment and structure
>d2q09a1 b.92.1.10 (A:4-65,A:367-407) Probable 4-imidazolone-5-propanoate amidohydrolase GOS_1928421 {Environmental samples} Back     information, alignment and structure
>d2ooda1 b.92.1.4 (A:3-72,A:398-467) Guanine deaminase {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d2qs8a1 b.92.1.9 (A:7-63,A:374-412) Xaa-Pro dipeptidase {Alteromonas macleodii [TaxId: 28108]} Back     information, alignment and structure
>d1ynya1 b.92.1.3 (A:2-52,A:385-460) D-hydantoinase {Bacillus sp. AR9 [TaxId: 301298]} Back     information, alignment and structure
>d2fvka1 b.92.1.3 (A:2-56,A:441-541) Dihydropyrimidine amidohydrolase Pyd2 {Yeast (Saccharomyces kluyveri) [TaxId: 4934]} Back     information, alignment and structure
>d1xrta1 b.92.1.3 (A:1-55,A:366-422) Two-domain dihydroorotase {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1e9yb2 c.1.9.2 (B:132-431,B:481-569) alpha-subunit of urease, catalytic domain {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1kcxa1 b.92.1.3 (A:15-66,A:401-490) Dihydropyrimidinase related protein-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yixa1 c.1.9.12 (A:1-265) Putative deoxyribonuclease YcfH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bf6a_ c.1.9.3 (A:) Phosphotriesterase homology protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k1da1 b.92.1.3 (A:1-52,A:385-460) D-hydantoinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2ftwa1 b.92.1.3 (A:7-59,A:394-490) Dihydropyrimidine amidohydrolase Pyd2 {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1xwya1 c.1.9.12 (A:1-260) Deoxyribonuclease TatD (MttC) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2uz9a1 b.92.1.4 (A:8-75,A:389-451) Guanine deaminase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o12a1 b.92.1.5 (A:1-43,A:332-364) N-acetylglucosamine-6-phosphate deacetylase, NagA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zzma1 c.1.9.12 (A:1-259) Putative deoxyribonuclease YjjV {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkra1 b.92.1.3 (A:1-54,A:380-451) L-hydantoinase {Arthrobacter aurescens [TaxId: 43663]} Back     information, alignment and structure
>d1gkpa1 b.92.1.3 (A:2-54,A:390-459) D-hydantoinase {Thermus sp. [TaxId: 275]} Back     information, alignment and structure
>d1gkra1 b.92.1.3 (A:1-54,A:380-451) L-hydantoinase {Arthrobacter aurescens [TaxId: 43663]} Back     information, alignment and structure
>d1j6oa_ c.1.9.12 (A:) Hypothetical protein TM0667 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2icsa1 b.92.1.8 (A:4-54,A:322-371) Putative adenine deaminase EF0837 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1ra0a2 c.1.9.5 (A:56-375) Cytosine deaminase catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kcxa1 b.92.1.3 (A:15-66,A:401-490) Dihydropyrimidinase related protein-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d4ubpc1 b.92.1.1 (C:1-131,C:435-483) alpha-Subunit of urease {Bacillus pasteurii [TaxId: 1474]} Back     information, alignment and structure
>d1m7ja3 c.1.9.11 (A:62-419) N-acyl-D-aminoacid amidohydrolase, catalytic domain {Alcaligenes faecalis [TaxId: 511]} Back     information, alignment and structure
>d1m7ja3 c.1.9.11 (A:62-419) N-acyl-D-aminoacid amidohydrolase, catalytic domain {Alcaligenes faecalis [TaxId: 511]} Back     information, alignment and structure
>d1ejxc2 c.1.9.2 (C:1130-1422,C:1476-1567) alpha-subunit of urease, catalytic domain {Klebsiella aerogenes [TaxId: 28451]} Back     information, alignment and structure
>d2ftwa1 b.92.1.3 (A:7-59,A:394-490) Dihydropyrimidine amidohydrolase Pyd2 {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure