Psyllid ID: psy1225


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250------
MRPQKNQTEGGNLSEPFLKLPAKRYNPDYYRIIKNPRSLLTIGKTLKSGHYSTLNELTGELNLMFENAKKFNPADSRLYRDAVKLQKLMQRKVQENPRSLLTIGKTLKSGHYSTLNELTGELNLMFENAKKFNPADSRLYRDAVKLQKLMQRKVQEFSLNELTGELSLMFENAKKFNPADLRLYRDAVKLQKLMQRKVQEVMILDIECQVYLISDELTHYQVVLTGTAEQVRLSGLPDGDWLAFTLPVVSGKASST
ccccccccccccccccccccccccccccHHHHccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccHHHccccccccccccHHHHHHHHHccccccccccccccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccc
cccccccccccEccccccccccHcccccHHHHHcccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccccccccHcHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHEEcccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccHHccHHcccccccccHHHHHHHHHHHHHHHcccccHccccccccccccccc
mrpqknqteggnlsepflklpakrynpdyyriiknprslltigktlksghySTLNELTGELNLMFEnakkfnpadsrlYRDAVKLQKLMQRKVQENPRSLLTIGKTLKSGHYSTLNELTGELNLMFEnakkfnpadsrlYRDAVKLQKLMQRKVQEFSLNELTGELSLMFENakkfnpadlRLYRDAVKLQKLMQRKVQEVMILDIECQVYLISDELTHYQVVLTGTAEQvrlsglpdgdwlaftlpvvsgkasst
mrpqknqteggnlsepflklpakryNPDYYRIIKNPRSLLTIGKTLKSGHYSTLNELTGELNLMFENAKkfnpadsrLYRDAVKLQKLmqrkvqenprslltigktlksghYSTLNELTGELNLMFENAKkfnpadsrLYRDAVKLQKLMQRKVQEFSLNELTGELSLMFENAKKFNPADLRLYRDAVKLQKLMQRKVQEVMILDIECQVYLISDELTHYQVVLTGTAEQVRLSGLPDGDWLAFTlpvvsgkasst
MRPQKNQTEGGNLSEPFLKLPAKRYNPDYYRIIKNPRSLLTIGKTLKSGHYSTLNELTGELNLMFENAKKFNPADSRLYRDAVKLQKLMQRKVQENPRSLLTIGKTLKSGHYSTLNELTGELNLMFENAKKFNPADSRLYRDAVKLQKLMQRKVQEFSLNELTGELSLMFENAKKFNPADLRLYRDAVKLQKLMQRKVQEVMILDIECQVYLISDELTHYQVVLTGTAEQVRLSGLPDGDWLAFTLPVVSGKASST
*****************LKLPAKRYNPDYYRIIKNPRSLLTIGKTLKSGHYSTLNELTGELNLMFENAKKFNPADSRLYRDAVKLQKL**********SLLTIGKTLKSGHYSTLNELTGELNLMFENAKKFNPADSRLYRDAVKLQKLMQRKVQEFSLNELTGELSLMFENAKKFNPADLRLYRDAVKLQKLMQRKVQEVMILDIECQVYLISDELTHYQVVLTGTAEQVRLSGLPDGDWLAFTLPVV*******
********EGGNLSEPFLKLPAKRYNPDYYRIIKNPRSLLTIGKTLKSGHYSTLNELTGELNLMFENAKKFNPADSRLYRDAVKLQKLMQRKVQENPRSLLTIGKTLKSGHYSTLNELTGELNLMFENAKKFNPADSRLYRDAVKLQKLMQRKVQEFSLNELTGELSLMFENAKKFNPADLRLYRDAVKLQKLMQRKVQE********************************************************
***********NLSEPFLKLPAKRYNPDYYRIIKNPRSLLTIGKTLKSGHYSTLNELTGELNLMFENAKKFNPADSRLYRDAVKLQKLMQRKVQENPRSLLTIGKTLKSGHYSTLNELTGELNLMFENAKKFNPADSRLYRDAVKLQKLMQRKVQEFSLNELTGELSLMFENAKKFNPADLRLYRDAVKLQKLMQRKVQEVMILDIECQVYLISDELTHYQVVLTGTAEQVRLSGLPDGDWLAFTLPV********
*******TEGGNLSEPFLKLPAKRYNPDYYRIIKNPRSLLTIGKTLKSGHYSTLNELTGELNLMFENAKKFNPADSRLYRDAVKLQKLMQRKVQENPRSLLTIGKTLKSGHYSTLNELTGELNLMFENAKKFNPADSRLYRDAVKLQKLMQRKVQEFSLNELTGELSLMFENAKKFNPADLRLYRDAVKLQKLMQRKVQEVMILDIECQVYLISDELTHYQVVLTGTAEQVRLSGLPDGDWLAFT***********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRPQKNQTEGGNLSEPFLKLPAKRYNPDYYRIIKNPRSLLTIGKTLKSGHYSTLNELTGELNLMFENAKKFNPADSRLYRDAVKLQKLMQRKVQENPRSLLTIGKTLKSGHYSTLNELTGELNLMFENAKKFNPADSRLYRDAVKLQKLMQRKVQEFSLNELTGELSLMFENAKKFNPADLRLYRDAVKLQKLMQRKVQEVMILDIECQVYLISDELTHYQVVLTGTAEQVRLSGLPDGDWLAFTLPVVSGKASST
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query256 2.2.26 [Sep-21-2011]
Q90941 1633 Protein polybromo-1 OS=Ga yes N/A 0.753 0.118 0.292 1e-17
Q8BSQ9 1634 Protein polybromo-1 OS=Mu yes N/A 0.753 0.118 0.318 7e-17
Q86U86 1689 Protein polybromo-1 OS=Ho no N/A 0.753 0.114 0.318 8e-17
Q9UTN61199 Chromatin structure-remod yes N/A 0.304 0.065 0.418 1e-11
P254391638 ATP-dependent helicase br no N/A 0.328 0.051 0.392 5e-11
P325971359 Nuclear protein STH1/NPS1 yes N/A 0.375 0.070 0.375 7e-11
O74964 803 Chromatin structure-remod no N/A 0.257 0.082 0.438 1e-10
Q09948 542 Chromatin structure-remod no N/A 0.285 0.134 0.419 1e-10
P515321647 Transcription activator B no N/A 0.328 0.051 0.333 1e-08
A7Z0191606 Transcription activator B no N/A 0.328 0.052 0.333 1e-08
>sp|Q90941|PB1_CHICK Protein polybromo-1 OS=Gallus gallus GN=PBRM1 PE=1 SV=1 Back     alignment and function desciption
 Score = 90.5 bits (223), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 66/226 (29%), Positives = 115/226 (50%), Gaps = 33/226 (14%)

Query: 9   EGGNLSEPFLKLPAKRYNPDYYRIIKNPRSLLTIGKTLKSGHYSTLNELTGELNLMFENA 68
           +G  +SEPF +LP+K+  PDYY+ IK P SL  I   LK+  Y TL++L  +LNLMFENA
Sbjct: 398 QGQLISEPFFQLPSKKKYPDYYQQIKTPISLQQIRAKLKNHEYETLDQLEADLNLMFENA 457

Query: 69  KKFNPADSRLYRDAVKLQKLMQRKVQENPR--------SLLT--IGKTLKSGHYSTLNEL 118
           K++N  +S +Y+  +K+Q++MQ K +E  R        S+++     T  S   S  N  
Sbjct: 458 KRYNVPNSAIYKRVLKMQQVMQAKKKELARRDDIEDGDSMISSATSDTGSSKRKSKKNMR 517

Query: 119 TGELNLMF---------------------ENAKKFNPADSRLYRDAVKLQKLMQ--RKVQ 155
              + +++                     + +KK  P   ++  + + L+ +    R  +
Sbjct: 518 KQRMKILYNAVLEARESGTGRRLCDLFMVKPSKKDYPDYYKIILEPMDLKMIEHNIRNDK 577

Query: 156 EFSLNELTGELSLMFENAKKFNPADLRLYRDAVKLQKLMQRKVQEV 201
                 +  ++ LMF NA+ +N    ++Y DA  L+K+++ K +E+
Sbjct: 578 YVGEEAMIDDMKLMFRNARHYNEEGSQVYNDAHMLEKILKEKRKEL 623




Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology).
Gallus gallus (taxid: 9031)
>sp|Q8BSQ9|PB1_MOUSE Protein polybromo-1 OS=Mus musculus GN=Pbrm1 PE=1 SV=4 Back     alignment and function description
>sp|Q86U86|PB1_HUMAN Protein polybromo-1 OS=Homo sapiens GN=PBRM1 PE=1 SV=1 Back     alignment and function description
>sp|Q9UTN6|SNF21_SCHPO Chromatin structure-remodeling complex subunit snf21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf21 PE=1 SV=1 Back     alignment and function description
>sp|P25439|BRM_DROME ATP-dependent helicase brm OS=Drosophila melanogaster GN=brm PE=1 SV=2 Back     alignment and function description
>sp|P32597|STH1_YEAST Nuclear protein STH1/NPS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STH1 PE=1 SV=1 Back     alignment and function description
>sp|O74964|RSC1_SCHPO Chromatin structure-remodeling complex subunit rsc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rsc1 PE=1 SV=1 Back     alignment and function description
>sp|Q09948|RSC4_SCHPO Chromatin structure-remodeling complex subunit rsc4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rsc4 PE=1 SV=1 Back     alignment and function description
>sp|P51532|SMCA4_HUMAN Transcription activator BRG1 OS=Homo sapiens GN=SMARCA4 PE=1 SV=2 Back     alignment and function description
>sp|A7Z019|SMCA4_BOVIN Transcription activator BRG1 OS=Bos taurus GN=SMARCA4 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query256
242010994 1673 predicted protein [Pediculus humanus cor 0.761 0.116 0.355 3e-28
383852643 1651 PREDICTED: protein polybromo-1-like [Meg 0.753 0.116 0.371 3e-25
322790256 1587 hypothetical protein SINV_09840 [Solenop 0.753 0.121 0.363 1e-24
307180267 1644 Protein polybromo-1 [Camponotus floridan 0.753 0.117 0.363 1e-24
380016641 1651 PREDICTED: protein polybromo-1-like [Api 0.753 0.116 0.363 3e-24
189234458 1648 PREDICTED: similar to polybromo-1 [Tribo 0.738 0.114 0.340 3e-24
328793686 1651 PREDICTED: protein polybromo-1 [Apis mel 0.753 0.116 0.358 9e-24
350415036 1651 PREDICTED: protein polybromo-1-like [Bom 0.753 0.116 0.358 1e-23
307207938 1647 Protein polybromo-1 [Harpegnathos saltat 0.753 0.117 0.358 1e-23
328719779 1680 PREDICTED: protein polybromo-1-like [Acy 0.753 0.114 0.326 2e-23
>gi|242010994|ref|XP_002426242.1| predicted protein [Pediculus humanus corporis] gi|212510305|gb|EEB13504.1| predicted protein [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  131 bits (329), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 87/245 (35%), Positives = 129/245 (52%), Gaps = 50/245 (20%)

Query: 5   KNQTEGGN--LSEPFLKLPAKRYNPDYYRIIKNPRSLLTIGKTLKSGHYSTLNELTGELN 62
           KN T  G   L EPF KLP++R+ PDYY+ IKNP SLL I   LK G Y T++E+ G+LN
Sbjct: 341 KNTTNNGGYALCEPFWKLPSRRHYPDYYKEIKNPVSLLQIRNKLKKGEYGTVSEVAGDLN 400

Query: 63  LMFENAKKFNPADSRLYRDAVKLQKLMQRKVQE--------------------------- 95
           +MFENAKK+N  +SRLYRDA+KLQK+MQ KV+E                           
Sbjct: 401 IMFENAKKYNRPESRLYRDAIKLQKVMQHKVKELLDFDQESESDTDSDNSPIIKKDTSPI 460

Query: 96  --------------NP---RSLLTIGKTLKSGHYSTLNELTGELNLMFENAKKFNPADSR 138
                         NP   +  L+I K L    Y    +    L  M + +KK  P   +
Sbjct: 461 AKKRGRKSAAFIRDNPSLRKRFLSICKALTEYTYEDGRQPI--LMFMEKPSKKLYPEYYK 518

Query: 139 LYRDAVKLQKLMQR-KVQEFSL-NELTGELSLMFENAKKFNPADLRLYRDAVKLQKLMQR 196
           +  + + L ++    K ++++  ++L  +L LMF N +KFN  +  +Y+DA  L+K++  
Sbjct: 519 IIAEPIDLLQIQGNIKAEKYTTEDQLISDLKLMFSNCRKFNEENSVIYKDANNLEKVLND 578

Query: 197 KVQEV 201
           K++E+
Sbjct: 579 KLKEL 583




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|383852643|ref|XP_003701836.1| PREDICTED: protein polybromo-1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|322790256|gb|EFZ15255.1| hypothetical protein SINV_09840 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307180267|gb|EFN68300.1| Protein polybromo-1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|380016641|ref|XP_003692286.1| PREDICTED: protein polybromo-1-like [Apis florea] Back     alignment and taxonomy information
>gi|189234458|ref|XP_001808258.1| PREDICTED: similar to polybromo-1 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|328793686|ref|XP_625055.3| PREDICTED: protein polybromo-1 [Apis mellifera] Back     alignment and taxonomy information
>gi|350415036|ref|XP_003490512.1| PREDICTED: protein polybromo-1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|307207938|gb|EFN85497.1| Protein polybromo-1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|328719779|ref|XP_001944619.2| PREDICTED: protein polybromo-1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query256
ZFIN|ZDB-GENE-010501-3 1648 pbrm1l "polybromo 1, like" [Da 0.328 0.050 0.452 3.5e-27
UNIPROTKB|F1NLL8 1630 PBRM1 "Protein polybromo-1" [G 0.378 0.059 0.459 5.7e-23
UNIPROTKB|Q90941 1633 PBRM1 "Protein polybromo-1" [G 0.378 0.059 0.459 5.8e-23
UNIPROTKB|H0Y5B5 1085 PBRM1 "Protein polybromo-1" [H 0.378 0.089 0.459 1.4e-22
UNIPROTKB|E7EVG2 1461 PBRM1 "Protein polybromo-1" [H 0.378 0.066 0.459 3.1e-22
UNIPROTKB|Q86U86 1689 PBRM1 "Protein polybromo-1" [H 0.378 0.057 0.459 4.4e-22
MGI|MGI:1923998 1634 Pbrm1 "polybromo 1" [Mus muscu 0.378 0.059 0.459 6.5e-22
UNIPROTKB|E2RRR3 1635 PBRM1 "Uncharacterized protein 0.378 0.059 0.459 6.5e-22
UNIPROTKB|E2RRL7 1689 PBRM1 "Uncharacterized protein 0.378 0.057 0.459 7.1e-22
RGD|1565549 1704 Pbrm1 "polybromo 1" [Rattus no 0.378 0.056 0.459 7.2e-22
ZFIN|ZDB-GENE-010501-3 pbrm1l "polybromo 1, like" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 203 (76.5 bits), Expect = 3.5e-27, Sum P(3) = 3.5e-27
 Identities = 38/84 (45%), Positives = 61/84 (72%)

Query:     9 EGGNLSEPFLKLPAKRYNPDYYRIIKNPRSLLTIGKTLKSGHYSTLNELTGELNLMFENA 68
             +G  LSEPFL+LP++R  PDYY  IKNP SL  I + +K+G Y  + ++  +L++MFENA
Sbjct:   379 QGLLLSEPFLQLPSRREYPDYYHQIKNPISLQQIREKMKNGDYEAVEQIEADLSVMFENA 438

Query:    69 KKFNPADSRLYRDAVKLQKLMQRK 92
             +++N  +S +Y+ A +LQ +MQ++
Sbjct:   439 RRYNMPNSTIYKRAQRLQLIMQQQ 462


GO:0003677 "DNA binding" evidence=IEA
GO:0008150 "biological_process" evidence=ND
GO:0005575 "cellular_component" evidence=ND
UNIPROTKB|F1NLL8 PBRM1 "Protein polybromo-1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q90941 PBRM1 "Protein polybromo-1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|H0Y5B5 PBRM1 "Protein polybromo-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E7EVG2 PBRM1 "Protein polybromo-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q86U86 PBRM1 "Protein polybromo-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1923998 Pbrm1 "polybromo 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2RRR3 PBRM1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2RRL7 PBRM1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1565549 Pbrm1 "polybromo 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query256
cd05520103 cd05520, Bromo_polybromo_III, Bromodomain, polybro 3e-32
smart00297107 smart00297, BROMO, bromo domain 1e-23
cd0436999 cd04369, Bromodomain, Bromodomain 6e-23
cd05515105 cd05515, Bromo_polybromo_V, Bromodomain, polybromo 5e-22
cd05509101 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like s 2e-21
COG5076371 COG5076, COG5076, Transcription factor involved in 7e-20
cd05522104 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II i 1e-19
cd05520103 cd05520, Bromo_polybromo_III, Bromodomain, polybro 5e-18
cd05516107 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like su 1e-17
cd05519103 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfam 1e-17
cd05517103 cd05517, Bromo_polybromo_II, Bromodomain, polybrom 2e-17
cd05524113 cd05524, Bromo_polybromo_I, Bromodomain, polybromo 9e-17
pfam0043984 pfam00439, Bromodomain, Bromodomain 1e-16
cd05518103 cd05518, Bromo_polybromo_IV, Bromodomain, polybrom 5e-15
cd05525106 cd05525, Bromo_ASH1, Bromodomain; ASH1_like sub-fa 2e-14
cd05502109 cd05502, Bromo_tif1_like, Bromodomain; tif1_like s 2e-13
cd05509101 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like s 4e-13
cd05511112 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subf 5e-13
cd05521106 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in 8e-13
cd05510112 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like s 9e-13
cd05498102 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_lik 1e-12
cd05504115 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like o 1e-12
cd0436999 cd04369, Bromodomain, Bromodomain 2e-12
smart00297107 smart00297, BROMO, bromo domain 3e-12
cd05499102 cd05499, Bromo_BDF1_2_II, Bromodomain 1e-11
cd05500103 cd05500, Bromo_BDF1_2_I, Bromodomain 2e-11
cd05520103 cd05520, Bromo_polybromo_III, Bromodomain, polybro 7e-11
cd0550397 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BA 8e-11
cd05515105 cd05515, Bromo_polybromo_V, Bromodomain, polybromo 2e-10
COG5076371 COG5076, COG5076, Transcription factor involved in 6e-10
cd05495108 cd05495, Bromo_cbp_like, Bromodomain, cbp_like sub 6e-10
cd05496119 cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat I 9e-10
cd0550699 cd05506, Bromo_plant1, Bromodomain, uncharacterize 1e-09
cd05522104 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II i 2e-09
cd0551298 cd05512, Bromo_brd1_like, Bromodomain; brd1_like s 3e-09
cd05497107 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like 4e-09
pfam0043984 pfam00439, Bromodomain, Bromodomain 1e-08
cd05517103 cd05517, Bromo_polybromo_II, Bromodomain, polybrom 6e-08
cd05524113 cd05524, Bromo_polybromo_I, Bromodomain, polybromo 1e-07
cd05518103 cd05518, Bromo_polybromo_IV, Bromodomain, polybrom 3e-07
cd0550597 cd05505, Bromo_WSTF_like, Bromodomain; Williams sy 3e-07
cd05498102 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_lik 5e-07
cd0551398 cd05513, Bromo_brd7_like, Bromodomain, brd7_like s 5e-07
cd05502109 cd05502, Bromo_tif1_like, Bromodomain; tif1_like s 9e-07
cd05500103 cd05500, Bromo_BDF1_2_I, Bromodomain 1e-06
cd0550397 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BA 1e-06
cd05519103 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfam 2e-06
cd05528112 cd05528, Bromo_AAA, Bromodomain; sub-family co-occ 3e-06
cd05499102 cd05499, Bromo_BDF1_2_II, Bromodomain 4e-06
cd05496119 cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat I 4e-06
cd05509101 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like s 5e-06
cd05515105 cd05515, Bromo_polybromo_V, Bromodomain, polybromo 6e-06
cd05516107 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like su 6e-06
cd05497107 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like 1e-05
smart00297107 smart00297, BROMO, bromo domain 2e-05
cd0551298 cd05512, Bromo_brd1_like, Bromodomain; brd1_like s 3e-05
cd05507104 cd05507, Bromo_brd8_like, Bromodomain, brd8_like s 4e-05
cd0550699 cd05506, Bromo_plant1, Bromodomain, uncharacterize 5e-05
cd05504115 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like o 9e-05
cd0436999 cd04369, Bromodomain, Bromodomain 2e-04
cd05525106 cd05525, Bromo_ASH1, Bromodomain; ASH1_like sub-fa 2e-04
cd05511112 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subf 2e-04
cd05495108 cd05495, Bromo_cbp_like, Bromodomain, cbp_like sub 2e-04
cd05521106 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in 3e-04
cd05526110 cd05526, Bromo_polybromo_VI, Bromodomain, polybrom 7e-04
cd05522104 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II i 0.002
cd05524113 cd05524, Bromo_polybromo_I, Bromodomain, polybromo 0.002
cd05510112 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like s 0.002
cd05529128 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repe 0.002
cd05526110 cd05526, Bromo_polybromo_VI, Bromodomain, polybrom 0.003
>gnl|CDD|99951 cd05520, Bromo_polybromo_III, Bromodomain, polybromo repeat III Back     alignment and domain information
 Score =  113 bits (286), Expect = 3e-32
 Identities = 53/86 (61%), Positives = 64/86 (74%)

Query: 8   TEGGNLSEPFLKLPAKRYNPDYYRIIKNPRSLLTIGKTLKSGHYSTLNELTGELNLMFEN 67
            +G  L+EPFLKLP+KR  PDYY+ IKNP SL  I   LK+G Y TL EL  +LNLMFEN
Sbjct: 18  NQGQLLAEPFLKLPSKRKYPDYYQEIKNPISLQQIRTKLKNGEYETLEELEADLNLMFEN 77

Query: 68  AKKFNPADSRLYRDAVKLQKLMQRKV 93
           AK++N  +SR+Y+DA KLQKLMQ K 
Sbjct: 78  AKRYNVPNSRIYKDAEKLQKLMQAKK 103


Polybromo is a nuclear protein of unknown function, which contains 6 bromodomains. The human ortholog BAF180 is part of a SWI/SNF chromatin-remodeling complex, and it may carry out the functions of Yeast Rsc-1 and Rsc-2. It was shown that polybromo bromodomains bind to histone H3 at specific acetyl-lysine positions. Bromodomains are found in many chromatin-associated proteins and in nuclear histone acetyltransferases. They interact specifically with acetylated lysine, but not all the bromodomains in polybromo may bind to acetyl-lysine. Length = 103

>gnl|CDD|197636 smart00297, BROMO, bromo domain Back     alignment and domain information
>gnl|CDD|99922 cd04369, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|99946 cd05515, Bromo_polybromo_V, Bromodomain, polybromo repeat V Back     alignment and domain information
>gnl|CDD|99941 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like subfamily Back     alignment and domain information
>gnl|CDD|227408 COG5076, COG5076, Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>gnl|CDD|99953 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99951 cd05520, Bromo_polybromo_III, Bromodomain, polybromo repeat III Back     alignment and domain information
>gnl|CDD|99947 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like subfamily, specific to animals Back     alignment and domain information
>gnl|CDD|99950 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99948 cd05517, Bromo_polybromo_II, Bromodomain, polybromo repeat II Back     alignment and domain information
>gnl|CDD|99954 cd05524, Bromo_polybromo_I, Bromodomain, polybromo repeat I Back     alignment and domain information
>gnl|CDD|215921 pfam00439, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|99949 cd05518, Bromo_polybromo_IV, Bromodomain, polybromo repeat IV Back     alignment and domain information
>gnl|CDD|99955 cd05525, Bromo_ASH1, Bromodomain; ASH1_like sub-family Back     alignment and domain information
>gnl|CDD|99934 cd05502, Bromo_tif1_like, Bromodomain; tif1_like subfamily Back     alignment and domain information
>gnl|CDD|99941 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like subfamily Back     alignment and domain information
>gnl|CDD|99943 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subfamily Back     alignment and domain information
>gnl|CDD|99952 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99942 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like subfamily Back     alignment and domain information
>gnl|CDD|99930 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_like subfamily, repeat II Back     alignment and domain information
>gnl|CDD|99936 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like or BAZ1A_like subfamily Back     alignment and domain information
>gnl|CDD|99922 cd04369, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|197636 smart00297, BROMO, bromo domain Back     alignment and domain information
>gnl|CDD|99931 cd05499, Bromo_BDF1_2_II, Bromodomain Back     alignment and domain information
>gnl|CDD|99932 cd05500, Bromo_BDF1_2_I, Bromodomain Back     alignment and domain information
>gnl|CDD|99951 cd05520, Bromo_polybromo_III, Bromodomain, polybromo repeat III Back     alignment and domain information
>gnl|CDD|99935 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BAZ2B_like subfamily Back     alignment and domain information
>gnl|CDD|99946 cd05515, Bromo_polybromo_V, Bromodomain, polybromo repeat V Back     alignment and domain information
>gnl|CDD|227408 COG5076, COG5076, Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>gnl|CDD|99927 cd05495, Bromo_cbp_like, Bromodomain, cbp_like subfamily Back     alignment and domain information
>gnl|CDD|99928 cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat II_like subfamily Back     alignment and domain information
>gnl|CDD|99938 cd05506, Bromo_plant1, Bromodomain, uncharacterized subfamily specific to plants Back     alignment and domain information
>gnl|CDD|99953 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99944 cd05512, Bromo_brd1_like, Bromodomain; brd1_like subfamily Back     alignment and domain information
>gnl|CDD|99929 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information
>gnl|CDD|215921 pfam00439, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|99948 cd05517, Bromo_polybromo_II, Bromodomain, polybromo repeat II Back     alignment and domain information
>gnl|CDD|99954 cd05524, Bromo_polybromo_I, Bromodomain, polybromo repeat I Back     alignment and domain information
>gnl|CDD|99949 cd05518, Bromo_polybromo_IV, Bromodomain, polybromo repeat IV Back     alignment and domain information
>gnl|CDD|99937 cd05505, Bromo_WSTF_like, Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) Back     alignment and domain information
>gnl|CDD|99930 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_like subfamily, repeat II Back     alignment and domain information
>gnl|CDD|99945 cd05513, Bromo_brd7_like, Bromodomain, brd7_like subgroup Back     alignment and domain information
>gnl|CDD|99934 cd05502, Bromo_tif1_like, Bromodomain; tif1_like subfamily Back     alignment and domain information
>gnl|CDD|99932 cd05500, Bromo_BDF1_2_I, Bromodomain Back     alignment and domain information
>gnl|CDD|99935 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BAZ2B_like subfamily Back     alignment and domain information
>gnl|CDD|99950 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99957 cd05528, Bromo_AAA, Bromodomain; sub-family co-occurring with AAA domains Back     alignment and domain information
>gnl|CDD|99931 cd05499, Bromo_BDF1_2_II, Bromodomain Back     alignment and domain information
>gnl|CDD|99928 cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat II_like subfamily Back     alignment and domain information
>gnl|CDD|99941 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like subfamily Back     alignment and domain information
>gnl|CDD|99946 cd05515, Bromo_polybromo_V, Bromodomain, polybromo repeat V Back     alignment and domain information
>gnl|CDD|99947 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like subfamily, specific to animals Back     alignment and domain information
>gnl|CDD|99929 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information
>gnl|CDD|197636 smart00297, BROMO, bromo domain Back     alignment and domain information
>gnl|CDD|99944 cd05512, Bromo_brd1_like, Bromodomain; brd1_like subfamily Back     alignment and domain information
>gnl|CDD|99939 cd05507, Bromo_brd8_like, Bromodomain, brd8_like subgroup Back     alignment and domain information
>gnl|CDD|99938 cd05506, Bromo_plant1, Bromodomain, uncharacterized subfamily specific to plants Back     alignment and domain information
>gnl|CDD|99936 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like or BAZ1A_like subfamily Back     alignment and domain information
>gnl|CDD|99922 cd04369, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|99955 cd05525, Bromo_ASH1, Bromodomain; ASH1_like sub-family Back     alignment and domain information
>gnl|CDD|99943 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subfamily Back     alignment and domain information
>gnl|CDD|99927 cd05495, Bromo_cbp_like, Bromodomain, cbp_like subfamily Back     alignment and domain information
>gnl|CDD|99952 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99956 cd05526, Bromo_polybromo_VI, Bromodomain, polybromo repeat VI Back     alignment and domain information
>gnl|CDD|99953 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99954 cd05524, Bromo_polybromo_I, Bromodomain, polybromo repeat I Back     alignment and domain information
>gnl|CDD|99942 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like subfamily Back     alignment and domain information
>gnl|CDD|99958 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repeat I_like subfamily Back     alignment and domain information
>gnl|CDD|99956 cd05526, Bromo_polybromo_VI, Bromodomain, polybromo repeat VI Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 256
KOG1827|consensus 629 99.97
COG5076371 Transcription factor involved in chromatin remodel 99.96
cd05520103 Bromo_polybromo_III Bromodomain, polybromo repeat 99.93
cd05516107 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, s 99.93
cd05497107 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily 99.93
cd05525106 Bromo_ASH1 Bromodomain; ASH1_like sub-family. ASH1 99.93
cd0550597 Bromo_WSTF_like Bromodomain; Williams syndrome tra 99.93
cd05515105 Bromo_polybromo_V Bromodomain, polybromo repeat V. 99.93
cd05518103 Bromo_polybromo_IV Bromodomain, polybromo repeat I 99.93
cd05517103 Bromo_polybromo_II Bromodomain, polybromo repeat I 99.93
cd0550899 Bromo_RACK7 Bromodomain, RACK7_like subfamily. RAC 99.93
cd05496119 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like sub 99.93
cd05524113 Bromo_polybromo_I Bromodomain, polybromo repeat I. 99.92
cd05511112 Bromo_TFIID Bromodomain, TFIID-like subfamily. Hum 99.92
cd0550397 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like s 99.92
cd05507104 Bromo_brd8_like Bromodomain, brd8_like subgroup. I 99.92
cd05519103 Bromo_SNF2 Bromodomain, SNF2-like subfamily, speci 99.92
cd05504115 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_li 99.92
cd05510112 Bromo_SPT7_like Bromodomain; SPT7_like subfamily. 99.92
cd05509101 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily. 99.91
cd05522104 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_l 99.91
cd05495108 Bromo_cbp_like Bromodomain, cbp_like subfamily. Cb 99.91
cd0551298 Bromo_brd1_like Bromodomain; brd1_like subfamily. 99.91
cd05521106 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_lik 99.91
cd0551398 Bromo_brd7_like Bromodomain, brd7_like subgroup. T 99.9
cd05528112 Bromo_AAA Bromodomain; sub-family co-occurring wit 99.9
cd05499102 Bromo_BDF1_2_II Bromodomain. BDF1/BDF2 like subfam 99.9
cd05502109 Bromo_tif1_like Bromodomain; tif1_like subfamily. 99.89
cd05501102 Bromo_SP100C_like Bromodomain, SP100C_like subfami 99.89
cd05498102 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamil 99.89
cd0550699 Bromo_plant1 Bromodomain, uncharacterized subfamil 99.88
cd05500103 Bromo_BDF1_2_I Bromodomain. BDF1/BDF2 like subfami 99.88
smart00297107 BROMO bromo domain. 99.88
cd05529128 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like 99.88
cd05526110 Bromo_polybromo_VI Bromodomain, polybromo repeat V 99.86
PF0043984 Bromodomain: Bromodomain; InterPro: IPR001487 Brom 99.84
cd05492109 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family 99.83
KOG1474|consensus 640 99.83
cd0436999 Bromodomain Bromodomain. Bromodomains are found in 99.83
KOG1474|consensus 640 99.82
KOG1472|consensus 720 99.65
cd05497107 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily 99.63
cd0550597 Bromo_WSTF_like Bromodomain; Williams syndrome tra 99.63
KOG0008|consensus1563 99.62
cd05501102 Bromo_SP100C_like Bromodomain, SP100C_like subfami 99.62
cd05496119 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like sub 99.62
cd05495108 Bromo_cbp_like Bromodomain, cbp_like subfamily. Cb 99.61
cd05526110 Bromo_polybromo_VI Bromodomain, polybromo repeat V 99.6
cd05516107 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, s 99.6
cd05504115 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_li 99.59
cd0550397 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like s 99.59
cd05525106 Bromo_ASH1 Bromodomain; ASH1_like sub-family. ASH1 99.59
cd05518103 Bromo_polybromo_IV Bromodomain, polybromo repeat I 99.58
KOG1245|consensus1404 99.58
cd05524113 Bromo_polybromo_I Bromodomain, polybromo repeat I. 99.58
cd05520103 Bromo_polybromo_III Bromodomain, polybromo repeat 99.58
cd05515105 Bromo_polybromo_V Bromodomain, polybromo repeat V. 99.57
cd05509101 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily. 99.57
cd0550699 Bromo_plant1 Bromodomain, uncharacterized subfamil 99.56
cd0550899 Bromo_RACK7 Bromodomain, RACK7_like subfamily. RAC 99.56
cd05507104 Bromo_brd8_like Bromodomain, brd8_like subgroup. I 99.56
cd05517103 Bromo_polybromo_II Bromodomain, polybromo repeat I 99.54
cd05499102 Bromo_BDF1_2_II Bromodomain. BDF1/BDF2 like subfam 99.53
cd0551398 Bromo_brd7_like Bromodomain, brd7_like subgroup. T 99.53
cd05498102 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamil 99.53
cd05510112 Bromo_SPT7_like Bromodomain; SPT7_like subfamily. 99.52
cd05502109 Bromo_tif1_like Bromodomain; tif1_like subfamily. 99.51
cd05519103 Bromo_SNF2 Bromodomain, SNF2-like subfamily, speci 99.51
cd0551298 Bromo_brd1_like Bromodomain; brd1_like subfamily. 99.51
cd05528112 Bromo_AAA Bromodomain; sub-family co-occurring wit 99.5
cd05511112 Bromo_TFIID Bromodomain, TFIID-like subfamily. Hum 99.49
smart00297107 BROMO bromo domain. 99.49
cd05492109 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family 99.49
cd05521106 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_lik 99.48
cd05500103 Bromo_BDF1_2_I Bromodomain. BDF1/BDF2 like subfami 99.47
cd05529128 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like 99.46
cd05522104 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_l 99.46
KOG1472|consensus720 99.4
PF0043984 Bromodomain: Bromodomain; InterPro: IPR001487 Brom 99.37
cd04717121 BAH_polybromo BAH, or Bromo Adjacent Homology doma 99.36
cd0436999 Bromodomain Bromodomain. Bromodomains are found in 99.35
cd04718148 BAH_plant_2 BAH, or Bromo Adjacent Homology domain 99.28
KOG1828|consensus418 99.27
COG5076371 Transcription factor involved in chromatin remodel 99.24
KOG0386|consensus1157 99.23
cd04714121 BAH_BAHCC1 BAH, or Bromo Adjacent Homology domain, 99.18
KOG0008|consensus1563 99.17
KOG1827|consensus 629 99.17
cd05491119 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, 99.09
cd04715159 BAH_Orc1p_like BAH, or Bromo Adjacent Homology dom 99.07
cd05491119 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, 99.0
cd05494114 Bromodomain_1 Bromodomain; uncharacterized subfami 98.91
KOG0955|consensus 1051 98.83
cd04370123 BAH BAH, or Bromo Adjacent Homology domain (also c 98.77
smart00439120 BAH Bromo adjacent homology domain. 98.6
KOG1245|consensus1404 98.53
cd04713146 BAH_plant_3 BAH, or Bromo Adjacent Homology domain 98.33
cd04712130 BAH_DCM_I BAH, or Bromo Adjacent Homology domain, 98.31
cd04716122 BAH_plantDCM_I BAH, or Bromo Adjacent Homology dom 98.28
cd04760124 BAH_Dnmt1_I BAH, or Bromo Adjacent Homology domain 98.27
PF01426119 BAH: BAH domain; InterPro: IPR001025 The BAH (brom 98.22
cd04721130 BAH_plant_1 BAH, or Bromo Adjacent Homology domain 97.91
KOG1828|consensus418 97.64
cd04709164 BAH_MTA BAH, or Bromo Adjacent Homology domain, as 97.55
KOG0386|consensus1157 97.5
cd04708202 BAH_plantDCM_II BAH, or Bromo Adjacent Homology do 97.11
cd04719128 BAH_Orc1p_animal BAH, or Bromo Adjacent Homology d 97.01
KOG0955|consensus 1051 96.98
cd04711137 BAH_Dnmt1_II BAH, or Bromo Adjacent Homology domai 96.6
cd04710135 BAH_fungalPHD BAH, or Bromo Adjacent Homology doma 96.44
cd05493131 Bromo_ALL-1 Bromodomain, ALL-1 like proteins. ALL- 96.24
cd05493131 Bromo_ALL-1 Bromodomain, ALL-1 like proteins. ALL- 95.47
KOG0644|consensus1113 91.93
KOG1886|consensus 464 89.37
KOG0644|consensus1113 89.37
cd04720179 BAH_Orc1p_Yeast BAH, or Bromo Adjacent Homology do 89.27
cd05494114 Bromodomain_1 Bromodomain; uncharacterized subfami 81.01
>KOG1827|consensus Back     alignment and domain information
Probab=99.97  E-value=2.5e-33  Score=262.71  Aligned_cols=202  Identities=21%  Similarity=0.257  Sum_probs=165.7

Q ss_pred             ccccCCccccccccCCCCCCCcchhhhcCCcCcHHHHHHHHhcCCCCCHHHHHHHHHHHHHHHhhhCCCCchhHHHHHHH
Q psy1225           6 NQTEGGNLSEPFLKLPAKRYNPDYYRIIKNPRSLLTIGKTLKSGHYSTLNELTGELNLMFENAKKFNPADSRLYRDAVKL   85 (256)
Q Consensus         6 ~~~~~~~~s~~F~~~p~~~~~pdYy~~I~~PmdL~tI~~kl~~~~Y~~~~ef~~D~~li~~Na~~yN~~~S~i~~~A~~L   85 (256)
                      .+..|+.++..|.++|+++..|+||.+|.+||+|..|++|+.++.|.+.+.|..|+.+|+.||+.||.++|.+++++..|
T Consensus        68 ~d~~gk~~~d~feklp~~~~~p~yy~~i~~pisl~~ik~kv~k~~y~~~~~f~~D~~lm~ena~~~n~~ds~~~~~s~~l  147 (629)
T KOG1827|consen   68 KDDEGKQLFDKFEKLPSRKEFPEYYYVIQQPISLDQIKRKVKKGRYKRLSFFQLDFLLMTENARLYNRPDSLIYKDSGEL  147 (629)
T ss_pred             ccccCcccchhHhhccccccCCCcceeecCcccHHHHHHHHHhcccccHHHHHHHHHHHHHHHHHhcCcchhhhhhhhhh
Confidence            46789999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhcccccHHHHHHHhhcCCCCCHHHHHHHHHHHHHhhhhhCCCCCHHHHHHHHHHHHHHHHHhcCChhhhhch
Q psy1225          86 QKLMQRKVQENPRSLLTIGKTLKSGHYSTLNELTGELNLMFENAKKFNPADSRLYRDAVKLQKLMQRKVQEFSLNELTGE  165 (256)
Q Consensus        86 ~~~f~~~~~klP~dl~~I~~kl~~~~Y~s~~~f~~D~~lmf~Na~~yN~~~s~i~~~a~~L~~~~~~~~~~~~~~~~~~d  165 (256)
                      ++.|.....+. .|+               +....+...                             ++   .-.+-..
T Consensus       148 ~~~~~~~~~~~-~d~---------------e~s~~~~~~-----------------------------l~---~~~l~~~  179 (629)
T KOG1827|consen  148 EKYFISLEDEK-KDG---------------ELSMESNEE-----------------------------LK---AGGLHYH  179 (629)
T ss_pred             hcchhhhhccc-cch---------------hhccccccc-----------------------------cc---cCCCCcc
Confidence            98886644320 000               000000000                             00   0000000


Q ss_pred             hhh-hhccchhcCCccccccccHHH-----HHHHHHHHHHHhcCCCC-ccceeecccceeEe-------EEeecCccccc
Q psy1225         166 LSL-MFENAKKFNPADLRLYRDAVK-----LQKLMQRKVQEVMILDI-ECQVYLISDELTHY-------QVVLTGTAEQV  231 (256)
Q Consensus       166 ~~~-~~~n~~~yn~~~~~i~~~a~~-----l~~i~~~~~~~~g~~~~-~c~y~rpeqt~h~~-------ev~kt~~~~~~  231 (256)
                      ... +-.++-.|+.++|+...++++     +.+|++.|...+|.+|+ +||||||+||+|..       |||||++|++|
T Consensus       180 ~~~~~~i~~~~~~~gd~vlv~~~~d~~~p~v~~Ier~w~~~dg~k~~~~~w~~rP~~T~H~a~r~F~k~Evfkt~~~~~~  259 (629)
T KOG1827|consen  180 ELGPVEIDGTKYIVGDYVLVQNPADNLKPIVAQIERLWKLPDGEKWPQGCWIYRPEETVHRADRKFYKQEVFKTSLYRDD  259 (629)
T ss_pred             cCCCccccCcccccCceeeecCcccccCCceeeecccccCcccccccceeEeeCCccCccccccchhcccceeccccccc
Confidence            001 234778999999999888887     23599999999999999 69999999999995       99999999999


Q ss_pred             ccCCCCCCceeeeeecccccCCCC
Q psy1225         232 RLSGLPDGDWLAFTLPVVSGKASS  255 (256)
Q Consensus       232 ~~~~i~~~~~v~f~~~~~~g~~~~  255 (256)
                      +++.|+|+|+||++++|++|+|..
T Consensus       260 ~~q~l~g~c~v~~~~~yi~~~p~~  283 (629)
T KOG1827|consen  260 LVQRLLGKCYVMKPTEYISGDPEN  283 (629)
T ss_pred             HHHHhhcceEEeehhHhhhcCccc
Confidence            999999999999999999999974



>COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>cd05520 Bromo_polybromo_III Bromodomain, polybromo repeat III Back     alignment and domain information
>cd05516 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, specific to animals Back     alignment and domain information
>cd05497 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information
>cd05525 Bromo_ASH1 Bromodomain; ASH1_like sub-family Back     alignment and domain information
>cd05505 Bromo_WSTF_like Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) Back     alignment and domain information
>cd05515 Bromo_polybromo_V Bromodomain, polybromo repeat V Back     alignment and domain information
>cd05518 Bromo_polybromo_IV Bromodomain, polybromo repeat IV Back     alignment and domain information
>cd05517 Bromo_polybromo_II Bromodomain, polybromo repeat II Back     alignment and domain information
>cd05508 Bromo_RACK7 Bromodomain, RACK7_like subfamily Back     alignment and domain information
>cd05496 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like subfamily Back     alignment and domain information
>cd05524 Bromo_polybromo_I Bromodomain, polybromo repeat I Back     alignment and domain information
>cd05511 Bromo_TFIID Bromodomain, TFIID-like subfamily Back     alignment and domain information
>cd05503 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like subfamily Back     alignment and domain information
>cd05507 Bromo_brd8_like Bromodomain, brd8_like subgroup Back     alignment and domain information
>cd05519 Bromo_SNF2 Bromodomain, SNF2-like subfamily, specific to fungi Back     alignment and domain information
>cd05504 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_like subfamily Back     alignment and domain information
>cd05510 Bromo_SPT7_like Bromodomain; SPT7_like subfamily Back     alignment and domain information
>cd05509 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily Back     alignment and domain information
>cd05522 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>cd05495 Bromo_cbp_like Bromodomain, cbp_like subfamily Back     alignment and domain information
>cd05512 Bromo_brd1_like Bromodomain; brd1_like subfamily Back     alignment and domain information
>cd05521 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>cd05513 Bromo_brd7_like Bromodomain, brd7_like subgroup Back     alignment and domain information
>cd05528 Bromo_AAA Bromodomain; sub-family co-occurring with AAA domains Back     alignment and domain information
>cd05499 Bromo_BDF1_2_II Bromodomain Back     alignment and domain information
>cd05502 Bromo_tif1_like Bromodomain; tif1_like subfamily Back     alignment and domain information
>cd05501 Bromo_SP100C_like Bromodomain, SP100C_like subfamily Back     alignment and domain information
>cd05498 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamily, repeat II Back     alignment and domain information
>cd05506 Bromo_plant1 Bromodomain, uncharacterized subfamily specific to plants Back     alignment and domain information
>cd05500 Bromo_BDF1_2_I Bromodomain Back     alignment and domain information
>smart00297 BROMO bromo domain Back     alignment and domain information
>cd05529 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like subfamily Back     alignment and domain information
>cd05526 Bromo_polybromo_VI Bromodomain, polybromo repeat VI Back     alignment and domain information
>PF00439 Bromodomain: Bromodomain; InterPro: IPR001487 Bromodomains are found in a variety of mammalian, invertebrate and yeast DNA-binding proteins [] Back     alignment and domain information
>cd05492 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family Back     alignment and domain information
>KOG1474|consensus Back     alignment and domain information
>cd04369 Bromodomain Bromodomain Back     alignment and domain information
>KOG1474|consensus Back     alignment and domain information
>KOG1472|consensus Back     alignment and domain information
>cd05497 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information
>cd05505 Bromo_WSTF_like Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) Back     alignment and domain information
>KOG0008|consensus Back     alignment and domain information
>cd05501 Bromo_SP100C_like Bromodomain, SP100C_like subfamily Back     alignment and domain information
>cd05496 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like subfamily Back     alignment and domain information
>cd05495 Bromo_cbp_like Bromodomain, cbp_like subfamily Back     alignment and domain information
>cd05526 Bromo_polybromo_VI Bromodomain, polybromo repeat VI Back     alignment and domain information
>cd05516 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, specific to animals Back     alignment and domain information
>cd05504 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_like subfamily Back     alignment and domain information
>cd05503 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like subfamily Back     alignment and domain information
>cd05525 Bromo_ASH1 Bromodomain; ASH1_like sub-family Back     alignment and domain information
>cd05518 Bromo_polybromo_IV Bromodomain, polybromo repeat IV Back     alignment and domain information
>KOG1245|consensus Back     alignment and domain information
>cd05524 Bromo_polybromo_I Bromodomain, polybromo repeat I Back     alignment and domain information
>cd05520 Bromo_polybromo_III Bromodomain, polybromo repeat III Back     alignment and domain information
>cd05515 Bromo_polybromo_V Bromodomain, polybromo repeat V Back     alignment and domain information
>cd05509 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily Back     alignment and domain information
>cd05506 Bromo_plant1 Bromodomain, uncharacterized subfamily specific to plants Back     alignment and domain information
>cd05508 Bromo_RACK7 Bromodomain, RACK7_like subfamily Back     alignment and domain information
>cd05507 Bromo_brd8_like Bromodomain, brd8_like subgroup Back     alignment and domain information
>cd05517 Bromo_polybromo_II Bromodomain, polybromo repeat II Back     alignment and domain information
>cd05499 Bromo_BDF1_2_II Bromodomain Back     alignment and domain information
>cd05513 Bromo_brd7_like Bromodomain, brd7_like subgroup Back     alignment and domain information
>cd05498 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamily, repeat II Back     alignment and domain information
>cd05510 Bromo_SPT7_like Bromodomain; SPT7_like subfamily Back     alignment and domain information
>cd05502 Bromo_tif1_like Bromodomain; tif1_like subfamily Back     alignment and domain information
>cd05519 Bromo_SNF2 Bromodomain, SNF2-like subfamily, specific to fungi Back     alignment and domain information
>cd05512 Bromo_brd1_like Bromodomain; brd1_like subfamily Back     alignment and domain information
>cd05528 Bromo_AAA Bromodomain; sub-family co-occurring with AAA domains Back     alignment and domain information
>cd05511 Bromo_TFIID Bromodomain, TFIID-like subfamily Back     alignment and domain information
>smart00297 BROMO bromo domain Back     alignment and domain information
>cd05492 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family Back     alignment and domain information
>cd05521 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>cd05500 Bromo_BDF1_2_I Bromodomain Back     alignment and domain information
>cd05529 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like subfamily Back     alignment and domain information
>cd05522 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>KOG1472|consensus Back     alignment and domain information
>PF00439 Bromodomain: Bromodomain; InterPro: IPR001487 Bromodomains are found in a variety of mammalian, invertebrate and yeast DNA-binding proteins [] Back     alignment and domain information
>cd04717 BAH_polybromo BAH, or Bromo Adjacent Homology domain, as present in polybromo and yeast RSC1/2 Back     alignment and domain information
>cd04369 Bromodomain Bromodomain Back     alignment and domain information
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>KOG1828|consensus Back     alignment and domain information
>COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>cd04714 BAH_BAHCC1 BAH, or Bromo Adjacent Homology domain, as present in mammalian BAHCC1 and similar proteins Back     alignment and domain information
>KOG0008|consensus Back     alignment and domain information
>KOG1827|consensus Back     alignment and domain information
>cd05491 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, limited to fungi Back     alignment and domain information
>cd04715 BAH_Orc1p_like BAH, or Bromo Adjacent Homology domain, as present in the Schizosaccharomyces pombe homolog of Saccharomyces cerevisiae Orc1p and similar proteins Back     alignment and domain information
>cd05491 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, limited to fungi Back     alignment and domain information
>cd05494 Bromodomain_1 Bromodomain; uncharacterized subfamily Back     alignment and domain information
>KOG0955|consensus Back     alignment and domain information
>cd04370 BAH BAH, or Bromo Adjacent Homology domain (also called ELM1 and BAM for Bromo Adjacent Motif) Back     alignment and domain information
>smart00439 BAH Bromo adjacent homology domain Back     alignment and domain information
>KOG1245|consensus Back     alignment and domain information
>cd04713 BAH_plant_3 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>cd04712 BAH_DCM_I BAH, or Bromo Adjacent Homology domain, as present in DNA (Cytosine-5)-methyltransferases (DCM) 1 Back     alignment and domain information
>cd04716 BAH_plantDCM_I BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases (DCM) from plants Back     alignment and domain information
>cd04760 BAH_Dnmt1_I BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases from Bilateria, Dnmt1 and similar proteins Back     alignment and domain information
>PF01426 BAH: BAH domain; InterPro: IPR001025 The BAH (bromo-adjacent homology) family contains proteins such as eukaryotic DNA (cytosine-5) methyltransferases IPR001525 from INTERPRO, the origin recognition complex 1 (Orc1) proteins, as well as several proteins involved in transcriptional regulation Back     alignment and domain information
>cd04721 BAH_plant_1 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>KOG1828|consensus Back     alignment and domain information
>cd04709 BAH_MTA BAH, or Bromo Adjacent Homology domain, as present in MTA1 and similar proteins Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>cd04708 BAH_plantDCM_II BAH, or Bromo Adjacent Homology domain, second copy present in DNA (Cytosine-5)-methyltransferases (DCM) from plants Back     alignment and domain information
>cd04719 BAH_Orc1p_animal BAH, or Bromo Adjacent Homology domain, as present in animal homologs of Saccharomyces cerevisiae Orc1p Back     alignment and domain information
>KOG0955|consensus Back     alignment and domain information
>cd04711 BAH_Dnmt1_II BAH, or Bromo Adjacent Homology domain, second copy present in DNA (Cytosine-5)-methyltransferases from Bilateria, Dnmt1 and similar proteins Back     alignment and domain information
>cd04710 BAH_fungalPHD BAH, or Bromo Adjacent Homology domain, as present in fungal proteins containing PHD domains Back     alignment and domain information
>cd05493 Bromo_ALL-1 Bromodomain, ALL-1 like proteins Back     alignment and domain information
>cd05493 Bromo_ALL-1 Bromodomain, ALL-1 like proteins Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG1886|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>cd04720 BAH_Orc1p_Yeast BAH, or Bromo Adjacent Homology domain, as present in Orc1p, which again is part of the Saccharomyces cerevisiae Sir1-origin recognition complex, and as present in Sir3p Back     alignment and domain information
>cd05494 Bromodomain_1 Bromodomain; uncharacterized subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query256
3k2j_A130 Crystal Structure Of The 3rd Bromodomain Of Human P 6e-17
3k2j_A130 Crystal Structure Of The 3rd Bromodomain Of Human P 5e-09
3k2j_A130 Crystal Structure Of The 3rd Bromodomain Of Human P 2e-04
3ljw_A120 Crystal Structure Of The Second Bromodomain Of Huma 2e-11
3ljw_A120 Crystal Structure Of The Second Bromodomain Of Huma 2e-04
2ktb_B121 Solution Structure Of The Second Bromodomain Of Hum 2e-11
2ktb_B121 Solution Structure Of The Second Bromodomain Of Hum 2e-04
3hmf_A116 Crystal Structure Of The Second Bromodomain Of Huma 2e-11
3hmf_A116 Crystal Structure Of The Second Bromodomain Of Huma 3e-04
3iu5_A116 Crystal Structure Of The First Bromodomain Of Human 1e-10
3iu5_A116 Crystal Structure Of The First Bromodomain Of Human 1e-04
2h60_A128 Solution Structure Of Human Brg1 Bromodomain Length 3e-10
3uvd_A124 Crystal Structure Of The Bromodomain Of Human Trans 3e-10
2grc_A129 1.5 A Structure Of Bromodomain From Human Brg1 Prot 3e-10
2dat_A123 Solution Structure Of The Bromodomain Of Human SwiS 5e-10
2r0v_A346 Structure Of The Rsc4 Tandem Bromodomain Acetylated 3e-09
2r0v_A346 Structure Of The Rsc4 Tandem Bromodomain Acetylated 9e-04
3tlp_A150 Crystal Structure Of The Fourth Bromodomain Of Huma 3e-09
2r10_A361 Structure Of An Acetylated Rsc4 Tandem Bromodomain 3e-09
2yqd_A120 Solution Structure Of The Fifth Bromodomain From Mo 5e-09
3g0j_A124 Crystal Structure Of The Fifth Bromodomain Of Human 7e-09
2r0s_A285 Crystal Structure Of The Rsc4 Tandem Bromodomain Le 8e-09
3mqm_A126 Crystal Structure Of The Bromodomain Of Human Ash1l 8e-09
2r0y_A311 Structure Of The Rsc4 Tandem Bromodomain In Complex 9e-09
2ri7_A174 Crystal Structure Of Phd Finger-Linker-Bromodomain 2e-08
2ri7_A174 Crystal Structure Of Phd Finger-Linker-Bromodomain 4e-04
3uv2_A126 Crystal Structure Of The Bromodomain Of Human Nucle 2e-08
3uv2_A126 Crystal Structure Of The Bromodomain Of Human Nucle 6e-04
3qzs_A115 Crystal Structure Of Bptf Bromo In Complex With His 2e-08
3qzs_A115 Crystal Structure Of Bptf Bromo In Complex With His 3e-04
3qzv_A174 Crystal Structure Of Bptf Phd-Linker-Bromo In Compl 2e-08
3qzv_A174 Crystal Structure Of Bptf Phd-Linker-Bromo In Compl 4e-04
3qzt_A115 Crystal Structure Of Bptf Bromo In Complex With His 3e-08
3qzt_A115 Crystal Structure Of Bptf Bromo In Complex With His 5e-04
3nxb_A116 Crystal Structure Of The Bromodomain Of Human Cecr2 1e-07
1f68_A103 Nmr Solution Structure Of The Bromodomain From Huma 1e-07
2f6j_A174 Crystal Structure Of Phd Finger-Linker-Bromodomain 1e-07
3d7c_A112 Crystal Structure Of The Bromodomain Of Human Gcn5, 1e-07
3dwy_A119 Crystal Structure Of The Bromodomain Of Human Crebb 2e-07
1jsp_B121 Nmr Structure Of Cbp Bromodomain In Complex With P5 2e-07
3o33_A184 Crystal Structure Of Trim24 Phd-Bromo In The Free S 2e-07
1e6i_A121 Bromodomain From Gcn5 Complexed With Acetylated H4 2e-07
2rfj_A119 Crystal Structure Of The Bromo Domain 1 In Human Br 3e-07
3fkm_X166 Plasmodium Falciparum Bromodomain-Containing Protei 4e-07
2yyn_A135 Crystal Sturcture Of Human Bromodomain Protein Leng 4e-07
1n72_A118 Structure And Ligand Of A Histone Acetyltransferase 4e-07
3gg3_A119 Crystal Structure Of The Bromodomain Of Human Pcaf 4e-07
3i3j_A124 Crystal Structure Of The Bromodomain Of Human Ep300 6e-07
2l5e_A128 Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Lengt 8e-07
2l5e_A128 Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Lengt 8e-04
2nxb_A123 Crystal Structure Of Human Bromodomain Containing P 9e-07
3jvl_A120 Crystal Structure Of Bromodomain 2 Of Mouse Brd4 Le 1e-06
2yw5_A138 Solution Structure Of The Bromodomain From Human Br 1e-06
2yw5_A138 Solution Structure Of The Bromodomain From Human Br 8e-04
3rcw_A135 Crystal Structure Of The Bromodomain Of Human Brd1 1e-06
3rcw_A135 Crystal Structure Of The Bromodomain Of Human Brd1 5e-04
3mb3_A135 Crystal Structure Of The Second Bromodomain Of Plec 2e-06
3mb3_A135 Crystal Structure Of The Second Bromodomain Of Plec 8e-05
2wp2_A120 Structure Of Brdt Bromodomain Bd1 Bound To A Diacet 2e-06
4don_A145 Brd4 Bromodomain 1 Complex With A Fragment 3,4-dihy 2e-06
2g4a_A116 Solution Structure Of A Bromodomain From Ring3 Prot 2e-06
2lsp_B128 Solution Structures Of Brd4 Second Bromodomain With 2e-06
4hbw_A127 Crystal Structure Of The First Bromodomain Of Human 2e-06
2ouo_A130 Crystal Structure Of The Bromo Domain 2 In Human Br 2e-06
3jvj_A131 Crystal Structure Of The Bromodomain 1 In Mouse Brd 2e-06
2oss_A127 Crystal Structure Of The Bromo Domain 1 In Human Br 2e-06
2dvv_A112 Crystal Structure Of The Second Bromodomain Of The 2e-06
3oni_A114 Crystal Structure Of The Second Bromodomain Of Huma 2e-06
3hmh_A155 Crystal Structure Of The Second Bromodomain Of Huma 3e-06
3uv4_A158 Crystal Structure Of The Second Bromodomain Of Huma 3e-06
3aad_A292 Structure Of The Histone Chaperone Cia/asf1-double 3e-06
2dww_A114 Crystal Structure Of Bromodomain-Containing Protein 3e-06
3q2e_A123 Crystal Structure Of The Second Bromodomain Of Huma 6e-06
3q2e_A123 Crystal Structure Of The Second Bromodomain Of Huma 8e-05
2i8n_A114 Solution Structure Of The Second Bromodomain Of Brd 7e-06
3uv5_A265 Crystal Structure Of The Tandem Bromodomains Of Hum 8e-06
2ydw_A153 Crystal Structure Of The First Bromodomain Of Human 8e-06
2oo1_A113 Crystal Structure Of The Bromo Domain 2 Of Human Br 8e-06
3g0l_A117 Crystal Structure Of Human Bromodomain Adjacent To 8e-06
2e7o_A112 Solution Structure Of The Bromodomain From Human Br 8e-06
1eqf_A280 Crystal Structure Of The Double Bromodomain Module 9e-06
2e7n_A117 Solution Structure Of The Second Bromodomain From H 3e-05
4a9e_A154 N-Terminal Bromodomain Of Human Brd2 With 3-Methyl- 3e-05
2wp1_A126 Structure Of Brdt Bromodomain 2 Bound To An Acetyla 5e-05
2d9e_A121 Solution Structure Of The Bromodomain Of Peregrin L 6e-05
3u5m_A207 Crystal Structure Of Trim33 Phd-Bromo In The Free S 6e-05
1x0j_A122 Crystal Structure Analysis Of The N-Terminal Bromod 7e-05
3aqa_A128 Crystal Structure Of The Human Brd2 Bd1 Bromodomain 8e-05
>pdb|3K2J|A Chain A, Crystal Structure Of The 3rd Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 130 Back     alignment and structure

Iteration: 1

Score = 84.3 bits (207), Expect = 6e-17, Method: Compositional matrix adjust. Identities = 43/90 (47%), Positives = 61/90 (67%) Query: 9 EGGNLSEPFLKLPAKRYNPDYYRIIKNPRSLLTIGKTLKSGHYSTLNELTGELNLMFENA 68 +G ++EPF LP+K+ PDYY+ IK P SL I LK+ Y TL+ L +LNLMFENA Sbjct: 36 QGQLIAEPFYHLPSKKKYPDYYQQIKMPISLQQIRTKLKNQEYETLDHLECDLNLMFENA 95 Query: 69 KKFNPADSRLYRDAVKLQKLMQRKVQENPR 98 K++N +S +Y+ +KLQ++MQ K +E R Sbjct: 96 KRYNVPNSAIYKRVLKLQQVMQAKKKELAR 125
>pdb|3K2J|A Chain A, Crystal Structure Of The 3rd Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 130 Back     alignment and structure
>pdb|3K2J|A Chain A, Crystal Structure Of The 3rd Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 130 Back     alignment and structure
>pdb|3LJW|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Polybromo Length = 120 Back     alignment and structure
>pdb|3LJW|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Polybromo Length = 120 Back     alignment and structure
>pdb|2KTB|B Chain B, Solution Structure Of The Second Bromodomain Of Human Polybr Complex With An Acetylated Peptide From Histone 3 Length = 121 Back     alignment and structure
>pdb|2KTB|B Chain B, Solution Structure Of The Second Bromodomain Of Human Polybr Complex With An Acetylated Peptide From Histone 3 Length = 121 Back     alignment and structure
>pdb|3HMF|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 116 Back     alignment and structure
>pdb|3HMF|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 116 Back     alignment and structure
>pdb|3IU5|A Chain A, Crystal Structure Of The First Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 116 Back     alignment and structure
>pdb|3IU5|A Chain A, Crystal Structure Of The First Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 116 Back     alignment and structure
>pdb|2H60|A Chain A, Solution Structure Of Human Brg1 Bromodomain Length = 128 Back     alignment and structure
>pdb|3UVD|A Chain A, Crystal Structure Of The Bromodomain Of Human Transcription Activator Brg1 (Smarca4) In Complex With N-Methyl-2-Pyrrolidone Length = 124 Back     alignment and structure
>pdb|2GRC|A Chain A, 1.5 A Structure Of Bromodomain From Human Brg1 Protein, A Central Atpase Of SwiSNF REMODELING COMPLEX Length = 129 Back     alignment and structure
>pdb|2DAT|A Chain A, Solution Structure Of The Bromodomain Of Human SwiSNF Related Matrix Associated Actin Dependent Regulator Of Cromatin Subfamily A Member 2 Length = 123 Back     alignment and structure
>pdb|2R0V|A Chain A, Structure Of The Rsc4 Tandem Bromodomain Acetylated At K25 Length = 346 Back     alignment and structure
>pdb|2R0V|A Chain A, Structure Of The Rsc4 Tandem Bromodomain Acetylated At K25 Length = 346 Back     alignment and structure
>pdb|3TLP|A Chain A, Crystal Structure Of The Fourth Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 150 Back     alignment and structure
>pdb|2R10|A Chain A, Structure Of An Acetylated Rsc4 Tandem Bromodomain Histone Chimera Length = 361 Back     alignment and structure
>pdb|2YQD|A Chain A, Solution Structure Of The Fifth Bromodomain From Mouse Polybromo-1 Length = 120 Back     alignment and structure
>pdb|3G0J|A Chain A, Crystal Structure Of The Fifth Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 124 Back     alignment and structure
>pdb|2R0S|A Chain A, Crystal Structure Of The Rsc4 Tandem Bromodomain Length = 285 Back     alignment and structure
>pdb|3MQM|A Chain A, Crystal Structure Of The Bromodomain Of Human Ash1l Length = 126 Back     alignment and structure
>pdb|2R0Y|A Chain A, Structure Of The Rsc4 Tandem Bromodomain In Complex With An Acetylated H3 Peptide Length = 311 Back     alignment and structure
>pdb|2RI7|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Y17e Mutant From Human Bptf In The H3(1-9)k4me2 Bound State Length = 174 Back     alignment and structure
>pdb|2RI7|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Y17e Mutant From Human Bptf In The H3(1-9)k4me2 Bound State Length = 174 Back     alignment and structure
>pdb|3UV2|A Chain A, Crystal Structure Of The Bromodomain Of Human Nucleosome-Remodeling Factor Subunit Bptf Length = 126 Back     alignment and structure
>pdb|3UV2|A Chain A, Crystal Structure Of The Bromodomain Of Human Nucleosome-Remodeling Factor Subunit Bptf Length = 126 Back     alignment and structure
>pdb|3QZS|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form I Length = 115 Back     alignment and structure
>pdb|3QZS|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form I Length = 115 Back     alignment and structure
>pdb|3QZV|A Chain A, Crystal Structure Of Bptf Phd-Linker-Bromo In Complex With Histone H4k12ac Peptide Length = 174 Back     alignment and structure
>pdb|3QZV|A Chain A, Crystal Structure Of Bptf Phd-Linker-Bromo In Complex With Histone H4k12ac Peptide Length = 174 Back     alignment and structure
>pdb|3QZT|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form Ii Length = 115 Back     alignment and structure
>pdb|3QZT|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form Ii Length = 115 Back     alignment and structure
>pdb|3NXB|A Chain A, Crystal Structure Of The Bromodomain Of Human Cecr2 Length = 116 Back     alignment and structure
>pdb|1F68|A Chain A, Nmr Solution Structure Of The Bromodomain From Human Gcn5 Length = 103 Back     alignment and structure
>pdb|2F6J|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Fragment Of Human Bptf In The H3(1-15)k4me3 Bound State Length = 174 Back     alignment and structure
>pdb|3D7C|A Chain A, Crystal Structure Of The Bromodomain Of Human Gcn5, The General Control Of Amino-Acid Synthesis Protein 5-Like 2 Length = 112 Back     alignment and structure
>pdb|3DWY|A Chain A, Crystal Structure Of The Bromodomain Of Human Crebbp Length = 119 Back     alignment and structure
>pdb|1JSP|B Chain B, Nmr Structure Of Cbp Bromodomain In Complex With P53 Peptide Length = 121 Back     alignment and structure
>pdb|3O33|A Chain A, Crystal Structure Of Trim24 Phd-Bromo In The Free State Length = 184 Back     alignment and structure
>pdb|1E6I|A Chain A, Bromodomain From Gcn5 Complexed With Acetylated H4 Peptide Length = 121 Back     alignment and structure
>pdb|2RFJ|A Chain A, Crystal Structure Of The Bromo Domain 1 In Human Bromodomain Containing Protein, Testis Specific (Brdt) Length = 119 Back     alignment and structure
>pdb|3FKM|X Chain X, Plasmodium Falciparum Bromodomain-Containing Protein Pf10_0328 Length = 166 Back     alignment and structure
>pdb|2YYN|A Chain A, Crystal Sturcture Of Human Bromodomain Protein Length = 135 Back     alignment and structure
>pdb|1N72|A Chain A, Structure And Ligand Of A Histone Acetyltransferase Bromodomain Length = 118 Back     alignment and structure
>pdb|3GG3|A Chain A, Crystal Structure Of The Bromodomain Of Human Pcaf Length = 119 Back     alignment and structure
>pdb|3I3J|A Chain A, Crystal Structure Of The Bromodomain Of Human Ep300 Length = 124 Back     alignment and structure
>pdb|2L5E|A Chain A, Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Length = 128 Back     alignment and structure
>pdb|2L5E|A Chain A, Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Length = 128 Back     alignment and structure
>pdb|2NXB|A Chain A, Crystal Structure Of Human Bromodomain Containing Protein 3 (Brd3) Length = 123 Back     alignment and structure
>pdb|3JVL|A Chain A, Crystal Structure Of Bromodomain 2 Of Mouse Brd4 Length = 120 Back     alignment and structure
>pdb|2YW5|A Chain A, Solution Structure Of The Bromodomain From Human Bromodomain Containing Protein 3 Length = 138 Back     alignment and structure
>pdb|2YW5|A Chain A, Solution Structure Of The Bromodomain From Human Bromodomain Containing Protein 3 Length = 138 Back     alignment and structure
>pdb|3RCW|A Chain A, Crystal Structure Of The Bromodomain Of Human Brd1 Length = 135 Back     alignment and structure
>pdb|3RCW|A Chain A, Crystal Structure Of The Bromodomain Of Human Brd1 Length = 135 Back     alignment and structure
>pdb|3MB3|A Chain A, Crystal Structure Of The Second Bromodomain Of Pleckstrin Homology Domain Interacting Protein (Phip) Length = 135 Back     alignment and structure
>pdb|3MB3|A Chain A, Crystal Structure Of The Second Bromodomain Of Pleckstrin Homology Domain Interacting Protein (Phip) Length = 135 Back     alignment and structure
>pdb|2WP2|A Chain A, Structure Of Brdt Bromodomain Bd1 Bound To A Diacetylated Histone H4 Peptide. Length = 120 Back     alignment and structure
>pdb|4DON|A Chain A, Brd4 Bromodomain 1 Complex With A Fragment 3,4-dihydro-3-methyl-2(1h)- Quinazolinon Length = 145 Back     alignment and structure
>pdb|2G4A|A Chain A, Solution Structure Of A Bromodomain From Ring3 Protein Length = 116 Back     alignment and structure
>pdb|2LSP|B Chain B, Solution Structures Of Brd4 Second Bromodomain With Nf-Kb-K310ac Peptide Length = 128 Back     alignment and structure
>pdb|4HBW|A Chain A, Crystal Structure Of The First Bromodomain Of Human Brd4 In Complex With A Quinazoline Ligand Length = 127 Back     alignment and structure
>pdb|2OUO|A Chain A, Crystal Structure Of The Bromo Domain 2 In Human Bromodomain Containing Protein 4 (Brd4) Length = 130 Back     alignment and structure
>pdb|3JVJ|A Chain A, Crystal Structure Of The Bromodomain 1 In Mouse Brd4 Length = 131 Back     alignment and structure
>pdb|2OSS|A Chain A, Crystal Structure Of The Bromo Domain 1 In Human Bromodomain Containing Protein 4 (Brd4) Length = 127 Back     alignment and structure
>pdb|2DVV|A Chain A, Crystal Structure Of The Second Bromodomain Of The Human Brd2 Protein Length = 112 Back     alignment and structure
>pdb|3ONI|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Brd2 In Complex With The Inhibitor Jq1 Length = 114 Back     alignment and structure
>pdb|3HMH|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Tbp-Associated Factor Rna Polymerase 1-Like (Taf1l) Length = 155 Back     alignment and structure
>pdb|3UV4|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 158 Back     alignment and structure
>pdb|3AAD|A Chain A, Structure Of The Histone Chaperone Cia/asf1-double Bromodomain Complex Linking Histone Modifications And Site-specific Histone Eviction Length = 292 Back     alignment and structure
>pdb|2DWW|A Chain A, Crystal Structure Of Bromodomain-Containing Protein 4 Length = 114 Back     alignment and structure
>pdb|3Q2E|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Bromodomain And Wd Repeat-Containing Protein 1 Isoform A (Wdr9) Length = 123 Back     alignment and structure
>pdb|3Q2E|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Bromodomain And Wd Repeat-Containing Protein 1 Isoform A (Wdr9) Length = 123 Back     alignment and structure
>pdb|2I8N|A Chain A, Solution Structure Of The Second Bromodomain Of Brd4 Length = 114 Back     alignment and structure
>pdb|3UV5|A Chain A, Crystal Structure Of The Tandem Bromodomains Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 265 Back     alignment and structure
>pdb|2YDW|A Chain A, Crystal Structure Of The First Bromodomain Of Human Brd2 With The Inhibitor Gw841819x Length = 153 Back     alignment and structure
>pdb|2OO1|A Chain A, Crystal Structure Of The Bromo Domain 2 Of Human Bromodomain Containing Protein 3 (Brd3) Length = 113 Back     alignment and structure
>pdb|3G0L|A Chain A, Crystal Structure Of Human Bromodomain Adjacent To Zinc Finger Domain 2b (Baz2b) Length = 117 Back     alignment and structure
>pdb|2E7O|A Chain A, Solution Structure Of The Bromodomain From Human Bromodomain Adjacent To Zinc Finger Domain 2b Length = 112 Back     alignment and structure
>pdb|1EQF|A Chain A, Crystal Structure Of The Double Bromodomain Module From Human Tafii250 Length = 280 Back     alignment and structure
>pdb|2E7N|A Chain A, Solution Structure Of The Second Bromodomain From Human Bromodomain-Containing Protein 3 Length = 117 Back     alignment and structure
>pdb|4A9E|A Chain A, N-Terminal Bromodomain Of Human Brd2 With 3-Methyl-1,2,3,4- Tetrahydroquinazolin-2-One Length = 154 Back     alignment and structure
>pdb|2WP1|A Chain A, Structure Of Brdt Bromodomain 2 Bound To An Acetylated Histone H3 Peptide Length = 126 Back     alignment and structure
>pdb|2D9E|A Chain A, Solution Structure Of The Bromodomain Of Peregrin Length = 121 Back     alignment and structure
>pdb|3U5M|A Chain A, Crystal Structure Of Trim33 Phd-Bromo In The Free State Length = 207 Back     alignment and structure
>pdb|1X0J|A Chain A, Crystal Structure Analysis Of The N-Terminal Bromodomain Of Human Brd2 Length = 122 Back     alignment and structure
>pdb|3AQA|A Chain A, Crystal Structure Of The Human Brd2 Bd1 Bromodomain In Complex With A Brd2-Interactive Compound, Bic1 Length = 128 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query256
2dat_A123 Possible global transcription activator SNF2L2; br 7e-32
2dat_A123 Possible global transcription activator SNF2L2; br 2e-16
2dat_A123 Possible global transcription activator SNF2L2; br 1e-07
3k2j_A130 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 1e-31
3k2j_A130 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 3e-17
3k2j_A130 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 3e-08
3mqm_A126 Probable histone-lysine N-methyltransferase ASH1L; 4e-31
3mqm_A126 Probable histone-lysine N-methyltransferase ASH1L; 3e-17
3mqm_A126 Probable histone-lysine N-methyltransferase ASH1L; 2e-07
2r0y_A311 Chromatin structure-remodeling complex protein RSC 8e-31
2r0y_A311 Chromatin structure-remodeling complex protein RSC 8e-29
3iu5_A116 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 8e-31
3iu5_A116 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 2e-16
3iu5_A116 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 1e-08
2grc_A129 Probable global transcription activator SNF2L4; br 2e-30
2grc_A129 Probable global transcription activator SNF2L4; br 2e-15
2grc_A129 Probable global transcription activator SNF2L4; br 5e-08
3ljw_A120 Protein polybromo-1; alpha helix, alternative spli 2e-30
3ljw_A120 Protein polybromo-1; alpha helix, alternative spli 1e-16
3ljw_A120 Protein polybromo-1; alpha helix, alternative spli 1e-07
3mb4_A124 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 5e-30
3mb4_A124 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 5e-16
3mb4_A124 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 1e-07
3tlp_A150 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 3e-29
3tlp_A150 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 4e-15
3tlp_A150 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 5e-07
2r10_A361 Chromatin structure-remodeling complex protein RSC 5e-29
2r10_A361 Chromatin structure-remodeling complex protein RSC 7e-28
3aad_A292 Transcription initiation factor TFIID subunit 1; p 5e-29
3aad_A292 Transcription initiation factor TFIID subunit 1; p 5e-26
3aad_A292 Transcription initiation factor TFIID subunit 1; p 5e-15
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 6e-29
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 4e-26
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 2e-15
2d9e_A121 Peregrin; four-helix bundle, transcription activat 4e-23
2d9e_A121 Peregrin; four-helix bundle, transcription activat 1e-12
2d9e_A121 Peregrin; four-helix bundle, transcription activat 3e-06
3iu6_A147 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 3e-22
3iu6_A147 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 4e-16
3iu6_A147 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 9e-06
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 3e-22
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 1e-13
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 4e-06
3d7c_A112 General control of amino acid synthesis protein 5; 5e-22
3d7c_A112 General control of amino acid synthesis protein 5; 1e-13
3d7c_A112 General control of amino acid synthesis protein 5; 6e-07
3nxb_A116 CAT eye syndrome critical region protein 2; struct 1e-21
3nxb_A116 CAT eye syndrome critical region protein 2; struct 5e-12
3nxb_A116 CAT eye syndrome critical region protein 2; struct 4e-05
1e6i_A121 Transcriptional activator GCN5; gene regulation, b 3e-21
1e6i_A121 Transcriptional activator GCN5; gene regulation, b 2e-12
1e6i_A121 Transcriptional activator GCN5; gene regulation, b 1e-05
3uv4_A158 Second bromodomain of human transcription initiat 9e-21
3uv4_A158 Second bromodomain of human transcription initiat 1e-11
3uv4_A158 Second bromodomain of human transcription initiat 5e-05
3rcw_A135 Bromodomain-containing protein 1; transcription, s 1e-20
3rcw_A135 Bromodomain-containing protein 1; transcription, s 8e-12
3rcw_A135 Bromodomain-containing protein 1; transcription, s 5e-05
3p1f_A119 CREB-binding protein; structural genomics consorti 1e-20
3p1f_A119 CREB-binding protein; structural genomics consorti 5e-12
3p1f_A119 CREB-binding protein; structural genomics consorti 4e-05
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 3e-20
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 3e-05
2i7k_A117 Bromodomain-containing protein 7; helix, LEFT-hand 3e-20
2i7k_A117 Bromodomain-containing protein 7; helix, LEFT-hand 9e-13
2i7k_A117 Bromodomain-containing protein 7; helix, LEFT-hand 2e-05
2oss_A127 HUNK1 protein, bromodomain-containing protein 4; B 6e-20
2oss_A127 HUNK1 protein, bromodomain-containing protein 4; B 1e-11
2oss_A127 HUNK1 protein, bromodomain-containing protein 4; B 8e-05
3hme_A123 Bromodomain-containing protein 9; BRD9, bromodomai 2e-19
3hme_A123 Bromodomain-containing protein 9; BRD9, bromodomai 5e-13
3hme_A123 Bromodomain-containing protein 9; BRD9, bromodomai 4e-06
3g0l_A117 Hwalp4, bromodomain adjacent to zinc finger domain 2e-19
3g0l_A117 Hwalp4, bromodomain adjacent to zinc finger domain 3e-11
3g0l_A117 Hwalp4, bromodomain adjacent to zinc finger domain 8e-05
3fkm_X166 Signaling protein; bromodomain, malaria, structura 3e-19
3fkm_X166 Signaling protein; bromodomain, malaria, structura 2e-11
4alg_A154 Bromodomain-containing protein 2; signaling protei 3e-19
4alg_A154 Bromodomain-containing protein 2; signaling protei 6e-11
4alg_A154 Bromodomain-containing protein 2; signaling protei 9e-05
2yyn_A135 Transcription intermediary factor 1-alpha; bromo d 4e-19
2yyn_A135 Transcription intermediary factor 1-alpha; bromo d 6e-10
2yyn_A135 Transcription intermediary factor 1-alpha; bromo d 7e-05
2ouo_A130 HUNK1 protein, bromodomain-containing protein 4; B 7e-19
2ouo_A130 HUNK1 protein, bromodomain-containing protein 4; B 5e-11
2ouo_A130 HUNK1 protein, bromodomain-containing protein 4; B 4e-04
3jvl_A120 Bromodomain-containing protein 4; alpha helical, N 2e-18
3jvl_A120 Bromodomain-containing protein 4; alpha helical, N 6e-11
3jvl_A120 Bromodomain-containing protein 4; alpha helical, N 4e-04
3mb3_A135 PH-interacting protein; PHIP, pleckstrin homology 2e-18
3mb3_A135 PH-interacting protein; PHIP, pleckstrin homology 4e-10
3q2e_A123 Bromodomain and WD repeat-containing protein 1; st 4e-18
3q2e_A123 Bromodomain and WD repeat-containing protein 1; st 1e-10
3q2e_A123 Bromodomain and WD repeat-containing protein 1; st 3e-04
3dai_A130 ATPase family AAA domain-containing protein 2; anc 4e-16
3dai_A130 ATPase family AAA domain-containing protein 2; anc 5e-10
2dkw_A131 Hypothetical protein KIAA1240; bromodomain-like, f 6e-16
2dkw_A131 Hypothetical protein KIAA1240; bromodomain-like, f 8e-11
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 5e-14
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 1e-07
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 8e-12
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 2e-10
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 6e-05
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 5e-11
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-06
>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
 Score =  112 bits (283), Expect = 7e-32
 Identities = 29/93 (31%), Positives = 54/93 (58%)

Query: 7   QTEGGNLSEPFLKLPAKRYNPDYYRIIKNPRSLLTIGKTLKSGHYSTLNELTGELNLMFE 66
            + G  LSE F++LP+++  P+YY +I+ P     I + +++  Y +L +L  ++ L+  
Sbjct: 30  DSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLGDLEKDVMLLCH 89

Query: 67  NAKKFNPADSRLYRDAVKLQKLMQRKVQENPRS 99
           NA+ FN   S++Y D++ LQ + +   Q  P S
Sbjct: 90  NAQTFNLEGSQIYEDSIVLQSVFKSARQSGPSS 122


>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Length = 130 Back     alignment and structure
>3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Length = 130 Back     alignment and structure
>3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Length = 130 Back     alignment and structure
>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Length = 126 Back     alignment and structure
>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Length = 126 Back     alignment and structure
>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Length = 126 Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 Back     alignment and structure
>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Length = 116 Back     alignment and structure
>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Length = 116 Back     alignment and structure
>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Length = 116 Back     alignment and structure
>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Length = 129 Back     alignment and structure
>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Length = 129 Back     alignment and structure
>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Length = 129 Back     alignment and structure
>3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Length = 120 Back     alignment and structure
>3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Length = 120 Back     alignment and structure
>3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Length = 120 Back     alignment and structure
>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Length = 124 Back     alignment and structure
>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Length = 124 Back     alignment and structure
>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Length = 124 Back     alignment and structure
>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Length = 150 Back     alignment and structure
>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Length = 150 Back     alignment and structure
>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Length = 150 Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Length = 361 Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Length = 361 Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 Back     alignment and structure
>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Length = 147 Back     alignment and structure
>3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Length = 147 Back     alignment and structure
>3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Length = 147 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 Back     alignment and structure
>3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Length = 112 Back     alignment and structure
>3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Length = 112 Back     alignment and structure
>3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Length = 112 Back     alignment and structure
>3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} Length = 116 Back     alignment and structure
>3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} Length = 116 Back     alignment and structure
>3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} Length = 116 Back     alignment and structure
>1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Length = 121 Back     alignment and structure
>1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Length = 121 Back     alignment and structure
>1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Length = 121 Back     alignment and structure
>3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Length = 158 Back     alignment and structure
>3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Length = 158 Back     alignment and structure
>3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Length = 158 Back     alignment and structure
>3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Length = 135 Back     alignment and structure
>3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Length = 135 Back     alignment and structure
>3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Length = 135 Back     alignment and structure
>3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Length = 119 Back     alignment and structure
>3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Length = 119 Back     alignment and structure
>3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Length = 119 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 Back     alignment and structure
>2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Length = 127 Back     alignment and structure
>2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Length = 127 Back     alignment and structure
>2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Length = 127 Back     alignment and structure
>3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Length = 123 Back     alignment and structure
>3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Length = 123 Back     alignment and structure
>3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Length = 123 Back     alignment and structure
>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Length = 117 Back     alignment and structure
>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Length = 117 Back     alignment and structure
>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Length = 117 Back     alignment and structure
>3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Length = 166 Back     alignment and structure
>3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Length = 166 Back     alignment and structure
>4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Length = 154 Back     alignment and structure
>4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Length = 154 Back     alignment and structure
>4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Length = 154 Back     alignment and structure
>2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Length = 135 Back     alignment and structure
>2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Length = 135 Back     alignment and structure
>2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Length = 135 Back     alignment and structure
>2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Length = 130 Back     alignment and structure
>2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Length = 130 Back     alignment and structure
>2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Length = 130 Back     alignment and structure
>3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Length = 120 Back     alignment and structure
>3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Length = 120 Back     alignment and structure
>3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Length = 120 Back     alignment and structure
>3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Length = 135 Back     alignment and structure
>3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Length = 135 Back     alignment and structure
>3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Length = 123 Back     alignment and structure
>3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Length = 123 Back     alignment and structure
>3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Length = 123 Back     alignment and structure
>3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Length = 130 Back     alignment and structure
>3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Length = 130 Back     alignment and structure
>2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 131 Back     alignment and structure
>2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 131 Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Length = 183 Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Length = 183 Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Length = 183 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query256
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 100.0
3aad_A292 Transcription initiation factor TFIID subunit 1; p 100.0
2r0y_A311 Chromatin structure-remodeling complex protein RSC 100.0
2r10_A361 Chromatin structure-remodeling complex protein RSC 100.0
2dat_A123 Possible global transcription activator SNF2L2; br 99.94
3mb4_A124 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.94
3k2j_A130 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.94
3iu5_A116 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.94
3ljw_A120 Protein polybromo-1; alpha helix, alternative spli 99.94
3d7c_A112 General control of amino acid synthesis protein 5; 99.93
1e6i_A121 Transcriptional activator GCN5; gene regulation, b 99.93
3mqm_A126 Probable histone-lysine N-methyltransferase ASH1L; 99.93
2grc_A129 Probable global transcription activator SNF2L4; br 99.93
3g0l_A117 Hwalp4, bromodomain adjacent to zinc finger domain 99.93
2i7k_A117 Bromodomain-containing protein 7; helix, LEFT-hand 99.93
2d9e_A121 Peregrin; four-helix bundle, transcription activat 99.92
2oss_A127 HUNK1 protein, bromodomain-containing protein 4; B 99.92
3nxb_A116 CAT eye syndrome critical region protein 2; struct 99.92
3tlp_A150 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.92
3q2e_A123 Bromodomain and WD repeat-containing protein 1; st 99.92
4alg_A154 Bromodomain-containing protein 2; signaling protei 99.92
3hme_A123 Bromodomain-containing protein 9; BRD9, bromodomai 99.92
3uv4_A158 Second bromodomain of human transcription initiat 99.92
3rcw_A135 Bromodomain-containing protein 1; transcription, s 99.91
3mb3_A135 PH-interacting protein; PHIP, pleckstrin homology 99.91
2ouo_A130 HUNK1 protein, bromodomain-containing protein 4; B 99.91
3jvl_A120 Bromodomain-containing protein 4; alpha helical, N 99.91
3p1f_A119 CREB-binding protein; structural genomics consorti 99.91
2yyn_A135 Transcription intermediary factor 1-alpha; bromo d 99.9
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 99.9
3fkm_X166 Signaling protein; bromodomain, malaria, structura 99.9
3dai_A130 ATPase family AAA domain-containing protein 2; anc 99.9
2r0y_A311 Chromatin structure-remodeling complex protein RSC 99.87
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 99.87
2dkw_A131 Hypothetical protein KIAA1240; bromodomain-like, f 99.87
3iu6_A147 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.87
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 99.87
2r10_A361 Chromatin structure-remodeling complex protein RSC 99.86
3aad_A292 Transcription initiation factor TFIID subunit 1; p 99.86
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 99.85
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 99.84
3d7c_A112 General control of amino acid synthesis protein 5; 99.65
1e6i_A121 Transcriptional activator GCN5; gene regulation, b 99.65
2dat_A123 Possible global transcription activator SNF2L2; br 99.64
3k2j_A130 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.63
3g0l_A117 Hwalp4, bromodomain adjacent to zinc finger domain 99.63
3ljw_A120 Protein polybromo-1; alpha helix, alternative spli 99.63
3mb4_A124 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.63
3iu6_A147 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.62
2ouo_A130 HUNK1 protein, bromodomain-containing protein 4; B 99.62
3p1f_A119 CREB-binding protein; structural genomics consorti 99.62
2oss_A127 HUNK1 protein, bromodomain-containing protein 4; B 99.62
3iu5_A116 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.62
2i7k_A117 Bromodomain-containing protein 7; helix, LEFT-hand 99.61
3mqm_A126 Probable histone-lysine N-methyltransferase ASH1L; 99.61
3nxb_A116 CAT eye syndrome critical region protein 2; struct 99.61
3jvl_A120 Bromodomain-containing protein 4; alpha helical, N 99.61
2d9e_A121 Peregrin; four-helix bundle, transcription activat 99.6
2grc_A129 Probable global transcription activator SNF2L4; br 99.6
3fkm_X166 Signaling protein; bromodomain, malaria, structura 99.6
3uv4_A158 Second bromodomain of human transcription initiat 99.6
3q2e_A123 Bromodomain and WD repeat-containing protein 1; st 99.59
4alg_A154 Bromodomain-containing protein 2; signaling protei 99.58
3mb3_A135 PH-interacting protein; PHIP, pleckstrin homology 99.58
3tlp_A150 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.57
2yyn_A135 Transcription intermediary factor 1-alpha; bromo d 99.57
3hme_A123 Bromodomain-containing protein 9; BRD9, bromodomai 99.55
3rcw_A135 Bromodomain-containing protein 1; transcription, s 99.54
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 99.54
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 99.47
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 99.47
2dkw_A131 Hypothetical protein KIAA1240; bromodomain-like, f 99.46
3dai_A130 ATPase family AAA domain-containing protein 2; anc 99.45
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 99.38
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 99.33
1w4s_A174 Polybromo, polybromo 1 protein; BAH, bromo-associa 99.29
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 99.17
3av4_A 1330 DNA (cytosine-5)-methyltransferase 1; CXXC-type zi 97.59
3swr_A 1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 97.18
3av4_A 1330 DNA (cytosine-5)-methyltransferase 1; CXXC-type zi 97.04
3swr_A 1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 95.38
4ft4_B 784 DNA (cytosine-5)-methyltransferase 1; chromodomain 94.03
4dov_A163 ORC1, origin recognition complex subunit 1; DNA re 91.42
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Back     alignment and structure
Probab=100.00  E-value=6.2e-39  Score=279.40  Aligned_cols=156  Identities=22%  Similarity=0.393  Sum_probs=149.7

Q ss_pred             ccccccccCCccccccccCCCCCCCcchhhhcCCcCcHHHHHHHHhcCCCCCHHHHHHHHHHHHHHHhhhCCCCchhHHH
Q psy1225           2 RPQKNQTEGGNLSEPFLKLPAKRYNPDYYRIIKNPRSLLTIGKTLKSGHYSTLNELTGELNLMFENAKKFNPADSRLYRD   81 (256)
Q Consensus         2 ~~~~~~~~~~~~s~~F~~~p~~~~~pdYy~~I~~PmdL~tI~~kl~~~~Y~~~~ef~~D~~li~~Na~~yN~~~S~i~~~   81 (256)
                      +.+++....++.|++|..||+...+||||++|++||||+||++||++|.|.++++|.+|++|||.||..||+++|.++.+
T Consensus        20 ~~il~~l~~~~~~~~F~~pv~~~~~pdY~~iI~~PmdL~tI~~kl~~~~Y~~~~~f~~D~~li~~Na~~yN~~~s~i~~~   99 (265)
T 3uv5_A           20 ESIINDMRDLPNTYPFHTPVNAKVVKDYYKIITRPMDLQTLRENVRKRLYPSREEFREHLELIVKNSATYNGPKHSLTQI   99 (265)
T ss_dssp             HHHHHHHHTSTTCGGGTSCCCTTTSTTHHHHCSSCCCHHHHHHHHHTTCCSSHHHHHHHHHHHHHHHHHHHCTTCHHHHH
T ss_pred             HHHHHHHHcCCCchhhhCCCChhhcCCHHHHhCCCCcHHHHHHHHHcCCCCCHHHHHHHHHHHHhhhhhcCCCCChHHHH
Confidence            45778888999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHhcc--------------------------------------------------------------ccc
Q psy1225          82 AVKLQKLMQRKVQEN--------------------------------------------------------------PRS   99 (256)
Q Consensus        82 A~~L~~~f~~~~~kl--------------------------------------------------------------P~d   99 (256)
                      |..|.+.+.+.+.++                                                              |||
T Consensus       100 A~~l~~~~~~~~~~~~~~~~~~ek~i~p~~dd~~~~~~~~il~~i~~~~l~~~~~~~~F~~pv~~~~~pdY~~iIk~Pmd  179 (265)
T 3uv5_A          100 SQSMLDLCDEKLKEKEDKLARLEKAINPLLDDDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMD  179 (265)
T ss_dssp             HHHHHHHHHHHHHHTHHHHHHHHHHHSTTTTCHHHHHHHHHHHHHHHHTTTTSTTCGGGTSCCCTTTSTTHHHHCSSCCC
T ss_pred             HHHHHHHHHHHHHHHhhhhhhhhhhhhhccccchhhHHHHHHHHHHHHHHHhhhhhHHHhCCCChhHhCcHHHHhCCccc
Confidence            999999998877654                                                              999


Q ss_pred             HHHHHHHhhcCCCCCHHHHHHHHHHHHHhhhhhCCCCCHHHHHHHHHHHHHHHHHhcC
Q psy1225         100 LLTIGKTLKSGHYSTLNELTGELNLMFENAKKFNPADSRLYRDAVKLQKLMQRKVQEF  157 (256)
Q Consensus       100 l~~I~~kl~~~~Y~s~~~f~~D~~lmf~Na~~yN~~~s~i~~~a~~L~~~~~~~~~~~  157 (256)
                      |+||++|+++|.|.++++|..|+.|||.||+.||+++|.+|++|..|++.|.+.++++
T Consensus       180 l~tI~~kl~~~~Y~~~~~f~~D~~lif~Na~~yN~~~s~~~~~A~~l~~~~~~~~~~~  237 (265)
T 3uv5_A          180 LETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVCYQTLTEY  237 (265)
T ss_dssp             HHHHHHHHHTTCCSSHHHHHHHHHHHHHHHHHHTCTTCHHHHHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHhcCCCCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHH
Confidence            9999999999999999999999999999999999999999999999999999999876



>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Back     alignment and structure
>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Back     alignment and structure
>3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Back     alignment and structure
>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Back     alignment and structure
>3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Back     alignment and structure
>3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Back     alignment and structure
>1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Back     alignment and structure
>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Back     alignment and structure
>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Back     alignment and structure
>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Back     alignment and structure
>2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Back     alignment and structure
>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Back     alignment and structure
>3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} SCOP: a.29.2.0 Back     alignment and structure
>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Back     alignment and structure
>3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Back     alignment and structure
>4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Back     alignment and structure
>3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Back     alignment and structure
>3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Back     alignment and structure
>3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Back     alignment and structure
>3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Back     alignment and structure
>2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Back     alignment and structure
>3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Back     alignment and structure
>3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} SCOP: a.29.2.1 PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Back     alignment and structure
>2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Back     alignment and structure
>2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Back     alignment and structure
>1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Back     alignment and structure
>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Back     alignment and structure
>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Back     alignment and structure
>3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Back     alignment and structure
>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Back     alignment and structure
>3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Back     alignment and structure
>2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Back     alignment and structure
>3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} SCOP: a.29.2.1 PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Back     alignment and structure
>2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Back     alignment and structure
>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Back     alignment and structure
>2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Back     alignment and structure
>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Back     alignment and structure
>3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} SCOP: a.29.2.0 Back     alignment and structure
>3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Back     alignment and structure
>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Back     alignment and structure
>3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Back     alignment and structure
>3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Back     alignment and structure
>4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Back     alignment and structure
>3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Back     alignment and structure
>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Back     alignment and structure
>2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Back     alignment and structure
>3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Back     alignment and structure
>3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Back     alignment and structure
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Back     alignment and structure
>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Back     alignment and structure
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Back     alignment and structure
>4ft4_B DNA (cytosine-5)-methyltransferase 1; chromodomain, BAH domain, DNA methyltransferase domain, H3K9 binding, methylation, transferase; HET: DNA MLY SAH; 2.70A {Zea mays} PDB: 4ft2_A* 4fsx_A* Back     alignment and structure
>4dov_A ORC1, origin recognition complex subunit 1; DNA replication, replication; 1.70A {Mus musculus} PDB: 4dow_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 256
d1eqfa1139 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain 7e-22
d1eqfa1139 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain 3e-12
d1eqfa1139 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain 2e-05
d1eqfa2128 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain 3e-21
d1eqfa2128 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain 1e-11
d1eqfa2128 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain 4e-05
d3d7ca1102 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [T 1e-20
d3d7ca1102 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [T 4e-12
d3d7ca1102 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [T 3e-06
d1e6ia_111 a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces c 3e-20
d1e6ia_111 a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces c 3e-11
d1e6ia_111 a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces c 4e-05
d3dwya1114 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP { 1e-19
d3dwya1114 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP { 2e-11
d3dwya1114 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP { 7e-06
d1wuma1118 a.29.2.1 (A:715-832) P300/CAF histone acetyltransf 3e-19
d1wuma1118 a.29.2.1 (A:715-832) P300/CAF histone acetyltransf 2e-11
d1wuma1118 a.29.2.1 (A:715-832) P300/CAF histone acetyltransf 6e-06
>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure

class: All alpha proteins
fold: Bromodomain-like
superfamily: Bromodomain
family: Bromodomain
domain: TAFII250 double bromodomain module
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 86.2 bits (213), Expect = 7e-22
 Identities = 22/95 (23%), Positives = 41/95 (43%)

Query: 14  SEPFLKLPAKRYNPDYYRIIKNPRSLLTIGKTLKSGHYSTLNELTGELNLMFENAKKFNP 73
           + PF      +   DYY+II  P  L T+ + ++   Y +  E    L L+ +N+  +N 
Sbjct: 44  TYPFHTPVNAKVVKDYYKIITRPMDLQTLRENVRKRLYPSREEFREHLELIVKNSATYNG 103

Query: 74  ADSRLYRDAVKLQKLMQRKVQENPRSLLTIGKTLK 108
               L + +  +  L   K++E    L  + K + 
Sbjct: 104 PKHSLTQISQSMLDLCDEKLKEKEDKLARLEKAIN 138


>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 111 Back     information, alignment and structure
>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 111 Back     information, alignment and structure
>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 111 Back     information, alignment and structure
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query256
d3d7ca1102 GCN5 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1e6ia_111 GCN5 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.93
d1eqfa2128 TAFII250 double bromodomain module {Human (Homo sa 99.93
d1eqfa1139 TAFII250 double bromodomain module {Human (Homo sa 99.92
d1wuma1118 P300/CAF histone acetyltransferase bromodomain {Hu 99.92
d3dwya1114 CREB-binding protein, CBP {Human (Homo sapiens) [T 99.9
d3d7ca1102 GCN5 {Human (Homo sapiens) [TaxId: 9606]} 99.64
d3dwya1114 CREB-binding protein, CBP {Human (Homo sapiens) [T 99.6
d1e6ia_111 GCN5 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.59
d1wuma1118 P300/CAF histone acetyltransferase bromodomain {Hu 99.58
d1eqfa2128 TAFII250 double bromodomain module {Human (Homo sa 99.57
d1eqfa1139 TAFII250 double bromodomain module {Human (Homo sa 99.56
d1m4za_217 Origin-recognition complex protein 120kDa subunit, 94.46
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Bromodomain-like
superfamily: Bromodomain
family: Bromodomain
domain: GCN5
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.94  E-value=4.1e-27  Score=174.48  Aligned_cols=95  Identities=29%  Similarity=0.462  Sum_probs=90.4

Q ss_pred             CccccccccCCccccccccCCCCCCCcchhhhcCCcCcHHHHHHHHhcCCCCCHHHHHHHHHHHHHHHhhhCCCCchhHH
Q psy1225           1 MRPQKNQTEGGNLSEPFLKLPAKRYNPDYYRIIKNPRSLLTIGKTLKSGHYSTLNELTGELNLMFENAKKFNPADSRLYR   80 (256)
Q Consensus         1 l~~~~~~~~~~~~s~~F~~~p~~~~~pdYy~~I~~PmdL~tI~~kl~~~~Y~~~~ef~~D~~li~~Na~~yN~~~S~i~~   80 (256)
                      |+++++....++.|.+|..||+...+||||++|++||||+||++||++|.|.|+++|.+|+++||.||..||+++|.+++
T Consensus         7 l~~il~~l~~~~~s~~F~~pv~~~~~pdY~~~I~~PmdL~tI~~kl~~~~Y~s~~~f~~D~~li~~Na~~yN~~~s~~~~   86 (102)
T d3d7ca1           7 LKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCR   86 (102)
T ss_dssp             HHHHHHHHHHSGGGGGGSSCCCTTTSTTHHHHCSSCCCHHHHHHHHHTTCCCSHHHHHHHHHHHHHHHHHHSCTTSHHHH
T ss_pred             HHHHHHHHHhCCCCCccCCCCChhhCcCHHHHcCCccCHHHHHHHhccCccCCHHHHHHHHHHHHHHHHHHCCCCCHHHH
Confidence            35678888899999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHhc
Q psy1225          81 DAVKLQKLMQRKVQE   95 (256)
Q Consensus        81 ~A~~L~~~f~~~~~k   95 (256)
                      +|..|++.|.+++++
T Consensus        87 ~A~~l~~~f~~~~ke  101 (102)
T d3d7ca1          87 CASALEKFFYFKLKE  101 (102)
T ss_dssp             HHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHhc
Confidence            999999999988764



>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m4za_ b.34.12.1 (A:) Origin-recognition complex protein 120kDa subunit, Orc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure