Psyllid ID: psy12394
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1873 | ||||||
| 328722049 | 3586 | PREDICTED: laminin subunit alpha-like [A | 0.293 | 0.153 | 0.544 | 0.0 | |
| 332020404 | 3661 | Laminin subunit alpha [Acromyrmex echina | 0.313 | 0.160 | 0.518 | 1e-180 | |
| 307167492 | 3660 | Laminin subunit alpha [Camponotus florid | 0.305 | 0.156 | 0.520 | 1e-179 | |
| 328793738 | 3544 | PREDICTED: laminin subunit alpha, partia | 0.289 | 0.152 | 0.534 | 1e-179 | |
| 380019683 | 3670 | PREDICTED: laminin subunit alpha-like [A | 0.289 | 0.147 | 0.534 | 1e-178 | |
| 345495089 | 3648 | PREDICTED: laminin subunit alpha-like [N | 0.290 | 0.149 | 0.515 | 1e-175 | |
| 340715997 | 3666 | PREDICTED: laminin subunit alpha-like [B | 0.289 | 0.147 | 0.528 | 1e-175 | |
| 383866057 | 3680 | PREDICTED: laminin subunit alpha-like [M | 0.289 | 0.147 | 0.532 | 1e-175 | |
| 350408641 | 3666 | PREDICTED: laminin subunit alpha-like [B | 0.289 | 0.147 | 0.527 | 1e-175 | |
| 307199233 | 3663 | Laminin subunit alpha [Harpegnathos salt | 0.315 | 0.161 | 0.498 | 1e-174 |
| >gi|328722049|ref|XP_001949708.2| PREDICTED: laminin subunit alpha-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 654 bits (1686), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 305/560 (54%), Positives = 409/560 (73%), Gaps = 10/560 (1%)
Query: 852 INNLCNKDLSALNSEELPLLNKDQPKLRFDMRITKPGPHVLVLSYVTPGPHTQDSAVIQL 911
++NL K L L +LP++++ QP+L ++ I PGP+V++++Y+TP Q AVI++
Sbjct: 957 VDNL--KQLDILGVPKLPVISEAQPELDLELSIVNPGPYVILINYMTPS-SIQTKAVIEI 1013
Query: 912 EASSQTTVERGNVRLHDCPYTTPCRATVLDKQGKVSVFEFDTNYISVELTADENPTNNAS 971
E + + G L+ C +TT CR +D GKV++F+ + V L ++ ++
Sbjct: 1014 EVDEK--MNSGKAILYACHHTTLCRQAAVDATGKVALFDINKPVTKVILKGGKD---HSK 1068
Query: 972 AAIQKIVAIPEAKWSMDHIQPKTECVRKDGQCVQAMFPTSPETKKIEAESG-LGPLATQL 1030
I+ IVA+P KWS+D+I P CV+KDG+C+Q+ +PT P+TKK+E ++G L+T
Sbjct: 1069 VGIESIVALPLDKWSLDYINPNPSCVKKDGKCIQSFYPTPPDTKKVEFKTGNEARLSTTA 1128
Query: 1031 PGSLADNKTGLVYLDHKDAMVDIAGTVNNPGAYVFVVHFYQPDFPEFDMDVLIQNGQFYE 1090
P + DN T L+ LDHKD++VD+AG V PGAYVF+V FYQPDFP F+M+ LI NGQ YE
Sbjct: 1129 PKDIFDNTTALIILDHKDSIVDLAGKVPAPGAYVFIVQFYQPDFPAFEMNALIHNGQTYE 1188
Query: 1091 AQLPVKHCPARSGCRAVVQQTNGNRMFTLEKNIVATFKEPNHKSVWLDYILLIPANEFNE 1150
A LP+KHCP+ SGCR+VV+Q NGN F L +N + + KEPNHKSVWL+Y+L++PA E+++
Sbjct: 1189 AVLPIKHCPSNSGCRSVVKQANGNINFQLTENFLLSLKEPNHKSVWLEYVLVVPAQEYSD 1248
Query: 1151 NIINELPYSRAKEFIDVCGKNHFYLDNSTSEFCKKATFSMTISFLHEALPCQCDIDGSKS 1210
+I E P+ FI CG NHFY++ ST+ FCK+ATFS+T ++ ALPC C+ DGS S
Sbjct: 1249 SITVEQPFDYTGLFIANCGSNHFYINTSTTGFCKEATFSLTTAYNSGALPCNCNSDGSLS 1308
Query: 1211 FECEQFGGQCQCKPNVIGRRCEMCATGYYGFPDCHPCNCPFTAVCDSYTGECICAARVIG 1270
+ C+ +GGQCQCKPNVIGRRCE C TGY+GFPDC CNCP A C++ +GECIC RV+G
Sbjct: 1309 YVCDPYGGQCQCKPNVIGRRCEACKTGYFGFPDCKSCNCPSVATCETSSGECICPPRVVG 1368
Query: 1271 KKCDQCEPNTFGYDPIIGCEECNCHPHGV-NGTQQCDLFDGSCSCKENIVGRTCDHCVEG 1329
K CDQCEP T+G+DPIIGCEECNC+ GV + +QCDLF+GSC CKENIVGR+CDHC G
Sbjct: 1369 KNCDQCEPMTYGFDPIIGCEECNCNFFGVEDKNRQCDLFNGSCECKENIVGRSCDHCRSG 1428
Query: 1330 HWSFPYCVPCECDLRGTTIDICNQGTAECYCKKNVYGAACDVCKEGTFDIQADNVDGCTR 1389
HWSFP C C CD RGTT +ICNQ +EC+CK NVYG ACD+CKEGTF+IQ N +GC++
Sbjct: 1429 HWSFPRCYLCNCDYRGTTSEICNQNNSECFCKSNVYGQACDLCKEGTFNIQEKNDEGCSK 1488
Query: 1390 CFCFGKTTKCSSSNLYRSQL 1409
CFCFGKTT+C SSNLYR+++
Sbjct: 1489 CFCFGKTTRCQSSNLYRTEI 1508
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|332020404|gb|EGI60824.1| Laminin subunit alpha [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|307167492|gb|EFN61065.1| Laminin subunit alpha [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|328793738|ref|XP_396118.4| PREDICTED: laminin subunit alpha, partial [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|380019683|ref|XP_003693732.1| PREDICTED: laminin subunit alpha-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|345495089|ref|XP_001603629.2| PREDICTED: laminin subunit alpha-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|340715997|ref|XP_003396491.1| PREDICTED: laminin subunit alpha-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|383866057|ref|XP_003708488.1| PREDICTED: laminin subunit alpha-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|350408641|ref|XP_003488468.1| PREDICTED: laminin subunit alpha-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|307199233|gb|EFN79905.1| Laminin subunit alpha [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1873 | ||||||
| FB|FBgn0002526 | 3712 | LanA "Laminin A" [Drosophila m | 0.228 | 0.115 | 0.563 | 0.0 | |
| WB|WBGene00001328 | 3704 | epi-1 [Caenorhabditis elegans | 0.226 | 0.114 | 0.490 | 4.5e-285 | |
| ZFIN|ZDB-GENE-030131-9823 | 3664 | lama5 "laminin, alpha 5" [Dani | 0.227 | 0.116 | 0.427 | 6e-236 | |
| UNIPROTKB|F1NZZ2 | 3668 | LAMA5 "Uncharacterized protein | 0.202 | 0.103 | 0.415 | 6.1e-206 | |
| UNIPROTKB|F1MAN8 | 3719 | Lama5 "Protein Lama5" [Rattus | 0.222 | 0.112 | 0.385 | 1.5e-199 | |
| UNIPROTKB|E2RPP1 | 3337 | LAMA3 "Uncharacterized protein | 0.281 | 0.158 | 0.347 | 2.1e-192 | |
| MGI|MGI:105382 | 3718 | Lama5 "laminin, alpha 5" [Mus | 0.241 | 0.121 | 0.371 | 1.4e-189 | |
| UNIPROTKB|Q16787 | 3333 | LAMA3 "Laminin subunit alpha-3 | 0.281 | 0.158 | 0.354 | 2.9e-188 | |
| UNIPROTKB|F1NQ51 | 3356 | LAMA3 "Uncharacterized protein | 0.279 | 0.155 | 0.343 | 1.1e-186 | |
| UNIPROTKB|O15230 | 3695 | LAMA5 "Laminin subunit alpha-5 | 0.223 | 0.113 | 0.370 | 4.8e-186 |
| FB|FBgn0002526 LanA "Laminin A" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 1504 (534.5 bits), Expect = 0., Sum P(5) = 0.
Identities = 244/433 (56%), Positives = 308/433 (71%)
Query: 17 DNG-ITISLLDHRPSMKNFFNSTRLQEWTRATNVRLRLLRTKNLLGHLMSMADQDPTTTR 75
+NG I + LL+ RPS N+FNST LQEWTRATNVR+RLLRTKNLLGHLMS+A QDPT TR
Sbjct: 199 ENGEIPVMLLNERPSSTNYFNSTVLQEWTRATNVRIRLLRTKNLLGHLMSVARQDPTVTR 258
Query: 76 RYFYSIKDISIGGRCRCNGHADVCDILDPEDPYHRI-CRCQHNTCGHNCEVCCPGYEQKA 134
RYFYSIKDISIGGRC CNGHAD CD+ DP+ P + CRCQH+TCG C CCPG+EQK
Sbjct: 259 RYFYSIKDISIGGRCMCNGHADTCDVKDPKSPVRILACRCQHHTCGIQCNECCPGFEQKK 318
Query: 135 WRQSQSNKPFSCEPCNCHGHADKCVYDPMVDEKRLSVDIQGNYEGGGVCQECRDNTEGIN 194
WRQ+ + +PF+CEPCNCHGH+++C YD V+ K LS+DI G+Y+GGGVCQ C+ NT GIN
Sbjct: 319 WRQNTNARPFNCEPCNCHGHSNECKYDEEVNRKGLSLDIHGHYDGGGVCQNCQHNTVGIN 378
Query: 195 CHQRVAGYYRPYGKHLNETDVCQPCQCAFHYATGNCAEGTGKCECRPEYTKPDCNSCAFG 254
C++ YYRP GKH NETDVC PCQC + ++TG+C E TG CECR + P C+SCA+G
Sbjct: 379 CNKCKPKYYRPKGKHWNETDVCSPCQCDYFFSTGHCEEETGNCECRAAFQPPSCDSCAYG 438
Query: 255 YFGYPNCEPCKCHMNGTLDFYCEPASGQQCPCKENYAGDHCDTCAQGYYNFPTCSPCECN 314
Y+GYPNC C+C++NGT ++CE SGQQCPCK N+AG +C CA+GYY FP C CECN
Sbjct: 439 YYGYPNCRECECNLNGTNGYHCEAESGQQCPCKINFAGAYCKQCAEGYYGFPECKACECN 498
Query: 315 AVGSLSDLCEVDSGNCTCRNNFAGRTCDSCADGYYNYPRCTSCQCAFHYATGN-CAEGTG 373
+GS+++ C V +G C C NF G C+ C GY+NYP C+ C C C + +G
Sbjct: 499 KIGSITNDCNVTTGECKCLTNFGGDNCERCKHGYFNYPTCSYCDCDNQGTESEICNKQSG 558
Query: 374 KCECRPEYTKPDCNSCAFGYFGYPNCEPCKCHMNGTLDFYCEPASGQQCPCKENYAGDHC 433
+C CR + P C+ C G++ YP+C+PC C G+ C+ +C C N+AG C
Sbjct: 559 QCICREGFGGPRCDQCLPGFYNYPDCKPCNCSSTGSSAITCDNTG--KCNCLNNFAGKQC 616
Query: 434 DTCAQGYYNFPTC 446
C GYY++P C
Sbjct: 617 TLCTAGYYSYPDC 629
|
|
| WB|WBGene00001328 epi-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-9823 lama5 "laminin, alpha 5" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NZZ2 LAMA5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MAN8 Lama5 "Protein Lama5" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RPP1 LAMA3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:105382 Lama5 "laminin, alpha 5" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q16787 LAMA3 "Laminin subunit alpha-3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NQ51 LAMA3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O15230 LAMA5 "Laminin subunit alpha-5" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1873 | |||
| smart00136 | 238 | smart00136, LamNT, Laminin N-terminal domain (doma | 1e-21 | |
| pfam00055 | 237 | pfam00055, Laminin_N, Laminin N-terminal (Domain V | 3e-14 | |
| cd00055 | 50 | cd00055, EGF_Lam, Laminin-type epidermal growth fa | 9e-11 | |
| pfam00053 | 49 | pfam00053, Laminin_EGF, Laminin EGF-like (Domains | 9e-10 | |
| cd00055 | 50 | cd00055, EGF_Lam, Laminin-type epidermal growth fa | 2e-09 | |
| smart00180 | 46 | smart00180, EGF_Lam, Laminin-type epidermal growth | 3e-09 | |
| smart00180 | 46 | smart00180, EGF_Lam, Laminin-type epidermal growth | 8e-09 | |
| cd00055 | 50 | cd00055, EGF_Lam, Laminin-type epidermal growth fa | 1e-08 | |
| pfam00053 | 49 | pfam00053, Laminin_EGF, Laminin EGF-like (Domains | 2e-08 | |
| cd00055 | 50 | cd00055, EGF_Lam, Laminin-type epidermal growth fa | 4e-08 | |
| cd00055 | 50 | cd00055, EGF_Lam, Laminin-type epidermal growth fa | 4e-08 | |
| pfam00053 | 49 | pfam00053, Laminin_EGF, Laminin EGF-like (Domains | 3e-07 | |
| smart00180 | 46 | smart00180, EGF_Lam, Laminin-type epidermal growth | 3e-07 | |
| cd00055 | 50 | cd00055, EGF_Lam, Laminin-type epidermal growth fa | 5e-07 | |
| cd00055 | 50 | cd00055, EGF_Lam, Laminin-type epidermal growth fa | 5e-07 | |
| pfam00053 | 49 | pfam00053, Laminin_EGF, Laminin EGF-like (Domains | 5e-07 | |
| cd00055 | 50 | cd00055, EGF_Lam, Laminin-type epidermal growth fa | 7e-07 | |
| pfam00053 | 49 | pfam00053, Laminin_EGF, Laminin EGF-like (Domains | 1e-06 | |
| smart00180 | 46 | smart00180, EGF_Lam, Laminin-type epidermal growth | 1e-06 | |
| smart00180 | 46 | smart00180, EGF_Lam, Laminin-type epidermal growth | 1e-06 | |
| pfam00053 | 49 | pfam00053, Laminin_EGF, Laminin EGF-like (Domains | 2e-06 | |
| pfam00053 | 49 | pfam00053, Laminin_EGF, Laminin EGF-like (Domains | 5e-06 | |
| pfam00053 | 49 | pfam00053, Laminin_EGF, Laminin EGF-like (Domains | 1e-05 | |
| pfam00053 | 49 | pfam00053, Laminin_EGF, Laminin EGF-like (Domains | 1e-05 | |
| cd00055 | 50 | cd00055, EGF_Lam, Laminin-type epidermal growth fa | 3e-05 | |
| smart00180 | 46 | smart00180, EGF_Lam, Laminin-type epidermal growth | 4e-05 | |
| smart00180 | 46 | smart00180, EGF_Lam, Laminin-type epidermal growth | 4e-05 | |
| cd00055 | 50 | cd00055, EGF_Lam, Laminin-type epidermal growth fa | 5e-05 | |
| smart00180 | 46 | smart00180, EGF_Lam, Laminin-type epidermal growth | 6e-05 | |
| pfam00053 | 49 | pfam00053, Laminin_EGF, Laminin EGF-like (Domains | 1e-04 | |
| cd00055 | 50 | cd00055, EGF_Lam, Laminin-type epidermal growth fa | 2e-04 | |
| smart00180 | 46 | smart00180, EGF_Lam, Laminin-type epidermal growth | 2e-04 | |
| smart00180 | 46 | smart00180, EGF_Lam, Laminin-type epidermal growth | 5e-04 | |
| cd00055 | 50 | cd00055, EGF_Lam, Laminin-type epidermal growth fa | 7e-04 | |
| cd00055 | 50 | cd00055, EGF_Lam, Laminin-type epidermal growth fa | 7e-04 | |
| smart00180 | 46 | smart00180, EGF_Lam, Laminin-type epidermal growth | 0.002 | |
| cd00055 | 50 | cd00055, EGF_Lam, Laminin-type epidermal growth fa | 0.003 | |
| cd00055 | 50 | cd00055, EGF_Lam, Laminin-type epidermal growth fa | 0.003 | |
| pfam00053 | 49 | pfam00053, Laminin_EGF, Laminin EGF-like (Domains | 0.003 | |
| pfam00053 | 49 | pfam00053, Laminin_EGF, Laminin EGF-like (Domains | 0.003 | |
| pfam00053 | 49 | pfam00053, Laminin_EGF, Laminin EGF-like (Domains | 0.003 | |
| pfam00053 | 49 | pfam00053, Laminin_EGF, Laminin EGF-like (Domains | 0.003 | |
| smart00180 | 46 | smart00180, EGF_Lam, Laminin-type epidermal growth | 0.003 | |
| smart00180 | 46 | smart00180, EGF_Lam, Laminin-type epidermal growth | 0.004 |
| >gnl|CDD|214532 smart00136, LamNT, Laminin N-terminal domain (domain VI) | Back alignment and domain information |
|---|
Score = 95.9 bits (239), Expect = 1e-21
Identities = 35/78 (44%), Positives = 45/78 (57%), Gaps = 3/78 (3%)
Query: 11 ALERSADNGITISLLDHRPSMKNFFNSTRLQEWTRATNVRLRLLRTKNLLGHLMSMADQD 70
+ I SLL+ RPS +F NS LQEW ATN+R+RL R + L LM
Sbjct: 164 DIVPLEGGEIAFSLLEGRPSATDFDNSPVLQEWVTATNIRVRLTRLRTLGDELMDDR--- 220
Query: 71 PTTTRRYFYSIKDISIGG 88
P TRRY+Y+I DI++GG
Sbjct: 221 PEVTRRYYYAISDIAVGG 238
|
N-terminal domain of laminins and laminin-related protein such as Unc-6/ netrins. Length = 238 |
| >gnl|CDD|215682 pfam00055, Laminin_N, Laminin N-terminal (Domain VI) | Back alignment and domain information |
|---|
| >gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies | Back alignment and domain information |
|---|
| >gnl|CDD|215680 pfam00053, Laminin_EGF, Laminin EGF-like (Domains III and V) | Back alignment and domain information |
|---|
| >gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies | Back alignment and domain information |
|---|
| >gnl|CDD|214543 smart00180, EGF_Lam, Laminin-type epidermal growth factor-like domai | Back alignment and domain information |
|---|
| >gnl|CDD|214543 smart00180, EGF_Lam, Laminin-type epidermal growth factor-like domai | Back alignment and domain information |
|---|
| >gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies | Back alignment and domain information |
|---|
| >gnl|CDD|215680 pfam00053, Laminin_EGF, Laminin EGF-like (Domains III and V) | Back alignment and domain information |
|---|
| >gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies | Back alignment and domain information |
|---|
| >gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies | Back alignment and domain information |
|---|
| >gnl|CDD|215680 pfam00053, Laminin_EGF, Laminin EGF-like (Domains III and V) | Back alignment and domain information |
|---|
| >gnl|CDD|214543 smart00180, EGF_Lam, Laminin-type epidermal growth factor-like domai | Back alignment and domain information |
|---|
| >gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies | Back alignment and domain information |
|---|
| >gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies | Back alignment and domain information |
|---|
| >gnl|CDD|215680 pfam00053, Laminin_EGF, Laminin EGF-like (Domains III and V) | Back alignment and domain information |
|---|
| >gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies | Back alignment and domain information |
|---|
| >gnl|CDD|215680 pfam00053, Laminin_EGF, Laminin EGF-like (Domains III and V) | Back alignment and domain information |
|---|
| >gnl|CDD|214543 smart00180, EGF_Lam, Laminin-type epidermal growth factor-like domai | Back alignment and domain information |
|---|
| >gnl|CDD|214543 smart00180, EGF_Lam, Laminin-type epidermal growth factor-like domai | Back alignment and domain information |
|---|
| >gnl|CDD|215680 pfam00053, Laminin_EGF, Laminin EGF-like (Domains III and V) | Back alignment and domain information |
|---|
| >gnl|CDD|215680 pfam00053, Laminin_EGF, Laminin EGF-like (Domains III and V) | Back alignment and domain information |
|---|
| >gnl|CDD|215680 pfam00053, Laminin_EGF, Laminin EGF-like (Domains III and V) | Back alignment and domain information |
|---|
| >gnl|CDD|215680 pfam00053, Laminin_EGF, Laminin EGF-like (Domains III and V) | Back alignment and domain information |
|---|
| >gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies | Back alignment and domain information |
|---|
| >gnl|CDD|214543 smart00180, EGF_Lam, Laminin-type epidermal growth factor-like domai | Back alignment and domain information |
|---|
| >gnl|CDD|214543 smart00180, EGF_Lam, Laminin-type epidermal growth factor-like domai | Back alignment and domain information |
|---|
| >gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies | Back alignment and domain information |
|---|
| >gnl|CDD|214543 smart00180, EGF_Lam, Laminin-type epidermal growth factor-like domai | Back alignment and domain information |
|---|
| >gnl|CDD|215680 pfam00053, Laminin_EGF, Laminin EGF-like (Domains III and V) | Back alignment and domain information |
|---|
| >gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies | Back alignment and domain information |
|---|
| >gnl|CDD|214543 smart00180, EGF_Lam, Laminin-type epidermal growth factor-like domai | Back alignment and domain information |
|---|
| >gnl|CDD|214543 smart00180, EGF_Lam, Laminin-type epidermal growth factor-like domai | Back alignment and domain information |
|---|
| >gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies | Back alignment and domain information |
|---|
| >gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies | Back alignment and domain information |
|---|
| >gnl|CDD|214543 smart00180, EGF_Lam, Laminin-type epidermal growth factor-like domai | Back alignment and domain information |
|---|
| >gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies | Back alignment and domain information |
|---|
| >gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies | Back alignment and domain information |
|---|
| >gnl|CDD|215680 pfam00053, Laminin_EGF, Laminin EGF-like (Domains III and V) | Back alignment and domain information |
|---|
| >gnl|CDD|215680 pfam00053, Laminin_EGF, Laminin EGF-like (Domains III and V) | Back alignment and domain information |
|---|
| >gnl|CDD|215680 pfam00053, Laminin_EGF, Laminin EGF-like (Domains III and V) | Back alignment and domain information |
|---|
| >gnl|CDD|215680 pfam00053, Laminin_EGF, Laminin EGF-like (Domains III and V) | Back alignment and domain information |
|---|
| >gnl|CDD|214543 smart00180, EGF_Lam, Laminin-type epidermal growth factor-like domai | Back alignment and domain information |
|---|
| >gnl|CDD|214543 smart00180, EGF_Lam, Laminin-type epidermal growth factor-like domai | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1873 | |||
| KOG0994|consensus | 1758 | 100.0 | ||
| KOG1836|consensus | 1705 | 100.0 | ||
| KOG0994|consensus | 1758 | 100.0 | ||
| KOG1836|consensus | 1705 | 100.0 | ||
| KOG3512|consensus | 592 | 100.0 | ||
| KOG3512|consensus | 592 | 99.9 | ||
| KOG4289|consensus | 2531 | 99.82 | ||
| smart00136 | 238 | LamNT Laminin N-terminal domain (domain VI). N-ter | 99.81 | |
| KOG4289|consensus | 2531 | 99.81 | ||
| PF00055 | 237 | Laminin_N: Laminin N-terminal (Domain VI); InterPr | 99.81 | |
| KOG3509|consensus | 964 | 99.53 | ||
| KOG3509|consensus | 964 | 99.08 | ||
| KOG1225|consensus | 525 | 98.9 | ||
| KOG1225|consensus | 525 | 98.81 | ||
| KOG1219|consensus | 4289 | 98.7 | ||
| KOG1219|consensus | 4289 | 98.6 | ||
| KOG1217|consensus | 487 | 98.4 | ||
| smart00180 | 46 | EGF_Lam Laminin-type epidermal growth factor-like | 98.4 | |
| cd00055 | 50 | EGF_Lam Laminin-type epidermal growth factor-like | 98.39 | |
| PF00053 | 49 | Laminin_EGF: Laminin EGF-like (Domains III and V); | 98.37 | |
| cd00055 | 50 | EGF_Lam Laminin-type epidermal growth factor-like | 98.33 | |
| KOG1217|consensus | 487 | 98.33 | ||
| PF00053 | 49 | Laminin_EGF: Laminin EGF-like (Domains III and V); | 98.32 | |
| smart00180 | 46 | EGF_Lam Laminin-type epidermal growth factor-like | 98.27 | |
| KOG1226|consensus | 783 | 98.21 | ||
| KOG1226|consensus | 783 | 97.75 | ||
| KOG1218|consensus | 316 | 97.65 | ||
| KOG1218|consensus | 316 | 97.64 | ||
| KOG4260|consensus | 350 | 97.58 | ||
| KOG4260|consensus | 350 | 97.18 | ||
| KOG1388|consensus | 217 | 96.33 | ||
| KOG1214|consensus | 1289 | 96.29 | ||
| KOG1388|consensus | 217 | 96.23 | ||
| PF00008 | 32 | EGF: EGF-like domain This is a sub-family of the P | 95.58 | |
| KOG1214|consensus | 1289 | 95.46 | ||
| smart00051 | 63 | DSL delta serrate ligand. | 94.03 | |
| PF00008 | 32 | EGF: EGF-like domain This is a sub-family of the P | 93.79 | |
| smart00179 | 39 | EGF_CA Calcium-binding EGF-like domain. | 92.7 | |
| smart00051 | 63 | DSL delta serrate ligand. | 92.58 | |
| PF07974 | 32 | EGF_2: EGF-like domain; InterPro: IPR013111 A sequ | 92.56 | |
| PF07974 | 32 | EGF_2: EGF-like domain; InterPro: IPR013111 A sequ | 92.4 | |
| PF12661 | 13 | hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E | 92.01 | |
| PF12661 | 13 | hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E | 91.04 | |
| cd00054 | 38 | EGF_CA Calcium-binding EGF-like domain, present in | 90.99 | |
| PF03302 | 397 | VSP: Giardia variant-specific surface protein; Int | 89.99 | |
| smart00179 | 39 | EGF_CA Calcium-binding EGF-like domain. | 89.19 | |
| cd00054 | 38 | EGF_CA Calcium-binding EGF-like domain, present in | 86.1 | |
| cd00053 | 36 | EGF Epidermal growth factor domain, found in epide | 85.88 | |
| PF01414 | 63 | DSL: Delta serrate ligand; InterPro: IPR001774 Lig | 83.97 | |
| smart00181 | 35 | EGF Epidermal growth factor-like domain. | 80.73 |
| >KOG0994|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.1e-142 Score=1300.55 Aligned_cols=876 Identities=33% Similarity=0.759 Sum_probs=701.9
Q ss_pred CCCCCCceEEEeeccCC-----------------------------------------------eEEEccCCCCCCCCCC
Q psy12394 3 NSPRPAVWALERSADNG-----------------------------------------------ITISLLDHRPSMKNFF 35 (1873)
Q Consensus 3 ~sprp~~~~~ers~d~g-----------------------------------------------i~~s~~~~rp~~~~~~ 35 (1873)
.||||++|+||||.||| |+|++|... +...--
T Consensus 141 ktfRPAAMliERS~DFGkTW~vYrYFAyDC~asFPGv~~~~~kk~~DviCtSrYS~~~PstgGEVifrvl~P~-~~iedP 219 (1758)
T KOG0994|consen 141 KTFRPAAMLIERSSDFGKTWHVYRYFAYDCSATFPGVPTGPPKKWDDVICTSRYSDPEPSTGGEVIFRVLDPA-IDIEDP 219 (1758)
T ss_pred ccCCcceeeeeecccccccceeeeeeecccccCCCCCCCCCcccccceeeecccCCCCCCCCCeEEEEecCCC-CCCCCc
Confidence 68999999999999999 888888874 222223
Q ss_pred CchhhhhheeeeeeeEeeccccccccccccccCCCCCcceeeeEEeeeeeeeeeeccCCCCCcCccCCCCC---------
Q psy12394 36 NSTRLQEWTRATNVRLRLLRTKNLLGHLMSMADQDPTTTRRYFYSIKDISIGGRCRCNGHADVCDILDPED--------- 106 (1873)
Q Consensus 36 ~s~~l~~~~~at~ir~~~~~~~t~~~~~~~~~~~~~~~~~~~yYai~d~~v~grC~C~gHa~~C~~~~~~~--------- 106 (1873)
+|+++|+.+++|||||.|+|++||+++|++ ..+.+..+|||||+||.|.|+|+|||||++|.+.++..
T Consensus 220 Ys~~IQ~~LKITNLRvn~tklhtlgdnllD---~r~E~~ekyyYAiy~~vVrGsCfCyGHAs~C~P~~g~~s~~~~~ta~ 296 (1758)
T KOG0994|consen 220 YSAKIQELLKITNLRVNFTKLHTLGDNLLD---SREEIREKYYYAIYDLVVRGSCFCYGHASQCAPVDGARSAKAPGTAH 296 (1758)
T ss_pred hhHHHHHHhhhhheeeeeEeeccccccccc---cccccccchhheeeeeeeecceeecCchhhcccCCCCCcccCCCccc
Confidence 699999999999999999999999999875 34566789999999999999999999999999987543
Q ss_pred CccceeecCCCCCCCCCCCCCCCccCCcCCcCCCCCCCCccCCCCCCCCCccccCccccccCcccccCcCcCCCceeCCC
Q psy12394 107 PYHRICRCQHNTCGHNCEVCCPGYEQKAWRQSQSNKPFSCEPCNCHGHADKCVYDPMVDEKRLSVDIQGNYEGGGVCQEC 186 (1873)
Q Consensus 107 ~~~~~C~C~h~t~G~~Ce~c~p~~~~~p~~~~~~~~~~~C~~C~C~~~~~~C~~d~~~~~~~~s~~~~g~~~~GG~C~~C 186 (1873)
+++.+|.|.|||.|.|||.|.|+||+.||+|+...++|+|++|+||+|+.+|+||..++.. +|. ..||||.+|
T Consensus 297 mVHG~C~C~HNT~G~nCE~C~~fYnDlPWrpAeG~~~neCrkC~CNgHa~sCHFD~aV~~A------SG~-vSGGVCDdC 369 (1758)
T KOG0994|consen 297 MVHGRCMCKHNTAGLNCEHCAPFYNDLPWRPAEGKTSNECRKCECNGHADTCHFDMAVYEA------SGN-VSGGVCDDC 369 (1758)
T ss_pred eecceeEeccCCCCCChHHhhHhhcCCCCCccCCCCcccccccCCCCCcccccccHHHHhh------cCC-cccccCccc
Confidence 5689999999999999999999999999999999999999999999999999999999876 454 378999999
Q ss_pred CCCCCCCCCCCCCCCCccCCCCCCCCCCCCccCCCCCCCCCCeeecCCCceecCCCCcCCCCcccCCcccCCCCCCCCCC
Q psy12394 187 RDNTEGINCHQRVAGYYRPYGKHLNETDVCQPCQCAFHYATGNCAEGTGKCECRPEYTKPDCNSCAFGYFGYPNCEPCKC 266 (1873)
Q Consensus 187 ~~~~~G~~Ce~C~~g~~~~~~~~~~~~~~C~~C~C~~~~n~g~C~~~~g~C~C~~G~~G~~Ce~C~~g~~g~~~C~~c~C 266 (1873)
+|||+|.|||+|+|.|||++.++++++++|+||.|+|.++.
T Consensus 370 qHNT~G~~CE~CkP~fYRdprr~i~~p~vC~pC~CdP~GS~--------------------------------------- 410 (1758)
T KOG0994|consen 370 QHNTEGQNCERCKPFFYRDPRRDISDPDVCKPCECDPAGSQ--------------------------------------- 410 (1758)
T ss_pred cccccccchhhcCcccccCCCCCCCCccccccccCCCCcCc---------------------------------------
Confidence 99999999999999999999999999888888887632210
Q ss_pred CCCCCCCceecCCCCCcccCCCCCccCCCccCCCCCCCCCCCCCCCcCCCCCCCCcccCCCcccccCCCcccCCCccCCC
Q psy12394 267 HMNGTLDFYCEPASGQQCPCKENYAGDHCDTCAQGYYNFPTCSPCECNAVGSLSDLCEVDSGNCTCRNNFAGRTCDSCAD 346 (1873)
Q Consensus 267 ~~~gt~~~~C~~~~G~~C~C~~g~~G~~Ce~C~~Gf~g~~~C~~c~C~~~gs~~~~C~~~~g~C~C~~G~~G~~Ce~C~~ 346 (1873)
++ +.|+.
T Consensus 411 -------------~~---------------------------------------g~cds--------------------- 417 (1758)
T KOG0994|consen 411 -------------DG---------------------------------------GICDS--------------------- 417 (1758)
T ss_pred -------------CC---------------------------------------Ccccc---------------------
Confidence 00 00000
Q ss_pred CCcCCCCCCcCCCCCCCCCceecCCCCeeeeCCCccCCCCccCCCCccCCCCCCCCCCCCCcEeeeeccCCCCCeeeCCC
Q psy12394 347 GYYNYPRCTSCQCAFHYATGNCAEGTGKCECRPEYTKPDCNSCAFGYFGYPNCEPCKCHMNGTLDFYCEPASGQQCPCKE 426 (1873)
Q Consensus 347 G~~g~~~C~~C~c~~c~n~g~C~~~~g~C~C~~G~tG~~Ce~C~~g~~~~~~C~~~~C~n~gtc~~~cd~~~g~~C~C~~ 426 (1873)
.+|+.+|
T Consensus 418 ------------------------------------------------------------------~~Dp~~G------- 424 (1758)
T KOG0994|consen 418 ------------------------------------------------------------------FCDPSTG------- 424 (1758)
T ss_pred ------------------------------------------------------------------ccCcccc-------
Confidence 0000000
Q ss_pred CcccCCCCcCCCCcccCCCcccccCCCcceeeeeecccccceEEEEeeeeeeeeecceeEEEEEeeccccCCCcceeeee
Q psy12394 427 NYAGDHCDTCAQGYYNFPTCSQITLPDVPVIRVLMATITTHAVLLVNVTRLVLCLTCVKLILAIVRAEITLPDVPVIRVL 506 (1873)
Q Consensus 427 g~~G~~Ce~C~~g~~~~~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~ 506 (1873)
T Consensus 425 -------------------------------------------------------------------------------- 424 (1758)
T KOG0994|consen 425 -------------------------------------------------------------------------------- 424 (1758)
T ss_pred --------------------------------------------------------------------------------
Confidence
Q ss_pred eeeeeceeeEEeehhHHHHhhccccccCcccccccccccccccCCcccccCCCCCcccccccCCCceecCCCCCCCCCCc
Q psy12394 507 MATITTHAVLFVIVTSEVQRLVSVIKPMDHVYVRKDTRALAVTNARQVCNCDIRGTEAGICDKTNGSCLCKEGYTGARCD 586 (1873)
Q Consensus 507 ~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~C~C~~~gt~~~~C~~~~g~C~C~~G~~G~~Ce 586 (1873)
T Consensus 425 -------------------------------------------------------------------------------- 424 (1758)
T KOG0994|consen 425 -------------------------------------------------------------------------------- 424 (1758)
T ss_pred --------------------------------------------------------------------------------
Confidence
Q ss_pred cCCCCccCCCCCcccCCCCCCcCCccCCCCCcccCCCCccCCCCCCCCCCcCCCCCCccCCCCCCCCCCcccCCCcceec
Q psy12394 587 QCKAGYYGYPDCKLCGCSAVGSSSTACDVSGKCPCLVNFGGKTCSQCSPGFYQYPQCKACNCDSHGNIGVSCDDDGKCQC 666 (1873)
Q Consensus 587 ~C~~g~~~~~~C~~c~C~~~Gt~~~~C~~~g~C~C~~G~~G~~Ce~C~~g~~g~~~C~~c~C~~~~~~gg~C~~~g~C~C 666 (1873)
T Consensus 425 -------------------------------------------------------------------------------- 424 (1758)
T KOG0994|consen 425 -------------------------------------------------------------------------------- 424 (1758)
T ss_pred --------------------------------------------------------------------------------
Confidence
Q ss_pred CCCCCCCCCcccCCCccCCCCcccCCCCCCCCCCcccCCCCceeeCCCcccCCCCcCCCCCccCCCCcCCCCCCCCCccC
Q psy12394 667 EKNFGGDRCERCKEGLYNFPICEACNCDSHGNIGVSCDDDGKCQCEKNFGGDRCERCKEGLYNFPICEECNCNPEGVLKT 746 (1873)
Q Consensus 667 ~~g~~G~~Ce~C~~g~~g~~~C~~C~C~~~g~~~~~C~~~g~C~C~~g~~G~~Ce~C~~g~~g~p~C~~C~C~~~Gs~~~ 746 (1873)
T Consensus 425 -------------------------------------------------------------------------------- 424 (1758)
T KOG0994|consen 425 -------------------------------------------------------------------------------- 424 (1758)
T ss_pred --------------------------------------------------------------------------------
Confidence
Q ss_pred ccccccCCCCCceecCCCcccCCccccCCCCcCCCCCCCCCCCcCcCCCCCcccCCcccCCCCCceecCCCCccCCCCCC
Q psy12394 747 FAGCGSLPAGELCECKPKVQGRICDECRPLYWNLKASNPDGCEDCDCYTLGTIGGIKNCNPKSGQCVCKATAMNRKCDAC 826 (1873)
Q Consensus 747 ~~~C~~~~~~g~C~C~~g~~G~~C~~C~~g~~g~~~~~~~~C~~c~C~~~Gt~~~~~~C~~~tg~C~C~~g~~G~~C~~C 826 (1873)
-..|+|.||+++.|++|++|++|||||+..|+.||.+|.|++.||..+.+ ||+.||.|.||+.++|..|++|
T Consensus 425 -------lvaGqC~CK~~V~G~RCd~Ck~Gywgl~~~dp~GC~~C~CN~lGT~~~s~-CD~~TG~C~ckrlvTg~~cdqc 496 (1758)
T KOG0994|consen 425 -------LVAGQCRCKEHVAGRRCDRCKDGYWGLTSADPYGCRPCDCNPLGTRNGSG-CDPETGDCYCKRLVTGIDCDQC 496 (1758)
T ss_pred -------ccccccccccCcCccccchhccCcccCccCCCCCccccccccccccCCCC-CCCCCCceEeeccccCCCcccc
Confidence 01267889999999999999999999999999999999999999998866 9999999999999999999999
Q ss_pred CCCCccCcCCCCCCCccCcCCCCCcccccccCCCCCCCCCccccccCCCCceeeeeeeecCCCeeEEEEeecCCCCCCCC
Q psy12394 827 MDGTYALQDNNLFGCTECACDIGGSINNLCNKDLSALNSEELPLLNKDQPKLRFDMRITKPGPHVLVLSYVTPGPHTQDS 906 (1873)
Q Consensus 827 ~~g~~g~~~~~~~gC~~C~C~~gg~~~~~C~~~~~~~~~~~~~~~~~~q~~~~~~~~~~~~g~y~~~l~y~~~~~~~~~~ 906 (1873)
+|.+|||+ +.++||++|+||+||++.+.|+..+|++ +++++|.||+ +..+.+++|..+|+.+.++++..+.
T Consensus 497 lPeh~gLs-~~~~gc~~cdcd~GGs~d~sc~~~sGqC--~CRe~~~GR~------c~~~~~~yy~~~l~h~i~eAe~~~~ 567 (1758)
T KOG0994|consen 497 LPEHWGLS-NDLEGCRPCDCDQGGSYDNSCDLHSGQC--ECREHMLGRR------CEQVCPGYYSPVLDHYIYEAEDAGT 567 (1758)
T ss_pred CccccccC-CCCCCCcccccCCCCCCCcccccccCcc--cccccccccc------ccccCCcccccccchhhhhhhhccc
Confidence 99999998 5789999999999999999999999998 6777888875 4588999999999988777764310
Q ss_pred ceEEEeecccccccccceEeecCCCCCCcceeeecCCCceEEEEeccCceEEEEeccCCCCCCccceEEEEEeeccCccc
Q psy12394 907 AVIQLEASSQTTVERGNVRLHDCPYTTPCRATVLDKQGKVSVFEFDTNYISVELTADENPTNNASAAIQKIVAIPEAKWS 986 (1873)
Q Consensus 907 ~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~P~~~~~ 986 (1873)
.+ .+.+.. ...+.+. +
T Consensus 568 ~~-~~~v~~-----------------------------------------r~~~~~~-----------------~----- 583 (1758)
T KOG0994|consen 568 GV-EVNVKE-----------------------------------------RKVLKST-----------------K----- 583 (1758)
T ss_pred cc-eeeeee-----------------------------------------eeecccC-----------------C-----
Confidence 00 000000 0000000 0
Q ss_pred ccccCcceeeeecCCccccccCCCCCCcceEEeecCCCCccccCCCcccCCCCceEEecCCCceEEEeeccCCCccEEEE
Q psy12394 987 MDHIQPKTECVRKDGQCVQAMFPTSPETKKIEAESGLGPLATQLPGSLADNKTGLVYLDHKDAMVDIAGTVNNPGAYVFV 1066 (1873)
Q Consensus 987 ~~~~~~~~~~~~~~g~c~~~~~~~~p~~~~~~~~~~~~~~~~~lp~~~~~~~~~~v~l~~~~~~~~~~~~v~~~g~Yv~v 1066 (1873)
+| +|+ +.+|+++......+.+...||..+.|.++
T Consensus 584 -------------------------------------------~~-sft--G~gf~r~~e~~~l~f~~~~ip~sm~Ydv~ 617 (1758)
T KOG0994|consen 584 -------------------------------------------LP-SFT--GKGFVRVPEGTTLEFTVPIIPPSMEYDVL 617 (1758)
T ss_pred -------------------------------------------Cc-ccc--ccceeecCCCceeeeecCCCCcccccchh
Confidence 00 111 22334443222222233568888999999
Q ss_pred EEeecCCCCCcc--ceEEEec-CeeeeeccccccCCCCCCcceeEecCCCc--------------eeeeecc--ceEEEE
Q psy12394 1067 VHFYQPDFPEFD--MDVLIQN-GQFYEAQLPVKHCPARSGCRAVVQQTNGN--------------RMFTLEK--NIVATF 1127 (1873)
Q Consensus 1067 i~y~~~~~~~~~--~~v~~~~-~~~~~g~~~~~~c~~~~~Cr~vv~~~~~~--------------~~~~l~~--~~~~~l 1127 (1873)
|+|. +..+..+ +.++|+. ++ |....|...+..++.+ ..+-|+. .++++|
T Consensus 618 ir~~-~~~~~~wen~~itvqrp~~-----------p~~g~c~~~~~~dd~~~~sl~p~sRyvv~~~~vClE~G~~Yklri 685 (1758)
T KOG0994|consen 618 IRYD-PRTPKLWENAKITVQRPGQ-----------PSLGRCGMAIPKDDRIPFSLPPGSRYVVAPNPVCLEAGKVYKLRI 685 (1758)
T ss_pred eecc-CCCcchhhhheEEeecCCC-----------CcccccccccccccccccccCCCceeeecCCchhhccCcceEEEE
Confidence 9986 4444322 4444442 11 2334444444432210 1122222 334444
Q ss_pred eCCC------CceeEEEEEEEeeCcccchhhccccccchhhHHH-hhcCCCcccccCCcchhcccccccceeeccCCCcC
Q psy12394 1128 KEPN------HKSVWLDYILLIPANEFNENIINELPYSRAKEFI-DVCGKNHFYLDNSTSEFCKKATFSMTISFLHEALP 1200 (1873)
Q Consensus 1128 ~~~~------~~~~~ld~v~lip~~~~~~~~l~~~~~~~~~~f~-~~C~~~~~~i~~~~~~~c~~~~~~~~~~~~~~~~~ 1200 (1873)
..+. +...+||+|+|+|..+-...|- ...+....+|. .+|....+..+..+++.|....+++++.+++++.+
T Consensus 686 ~~~~~~~~~esp~aLiDSl~L~P~~~~l~iFq-g~~~a~~~~yerYqC~~sl~~~k~~~~e~C~~l~~~lsa~l~n~a~~ 764 (1758)
T KOG0994|consen 686 YFERKSHDVESPYALIDSLVLIPRIDVLPIFQ-GSVLADKKTYERYQCESSLSDMKTKSDEVCQNLDNSLSALLHNGASM 764 (1758)
T ss_pred EeccccCCcccchhhhhhhhhccccccccccc-cchhhhhHHHHHhhhhhcccccccCcchhhhhhhhhHHHHHhcCccc
Confidence 3321 1234899999999865443332 22222244555 37833333345566889999999999999999999
Q ss_pred ccccCCCCcceeecccCceecCCCCcccCCCCCCCCCccCCC--CCcCCCCCC----CccccCCCceEEecCCccCCCCC
Q psy12394 1201 CQCDIDGSKSFECEQFGGQCQCKPNVIGRRCEMCATGYYGFP--DCHPCNCPF----TAVCDSYTGECICAARVIGKKCD 1274 (1873)
Q Consensus 1201 c~c~~~gs~~~~c~~~~~~C~C~~~~~G~~C~~C~~g~~~~~--~C~~C~C~~----~~~C~~~tg~C~C~~~~~G~~C~ 1274 (1873)
|+|+++||+|.+|++.+|||+|+|||+||+|++||||+|||. +|++|+|+. ...||+.||+|+|.+|+.|++|+
T Consensus 765 CnCnptGSlS~vCn~~GGqCqCkPnVVGR~CdqCApGtyGFGPsGCk~CdC~~~Gs~~~~Cd~~tGQC~C~~g~ygrqCn 844 (1758)
T KOG0994|consen 765 CNCNPTGSLSSVCNPNGGQCQCKPNVVGRRCDQCAPGTYGFGPSGCKACDCNSIGSLDKYCDKITGQCQCRPGTYGRQCN 844 (1758)
T ss_pred cccCCCccccccccCCCceecccCccccccccccCCcccCcCCccCccccccccccccccccccccceeeccccchhhcc
Confidence 999999999999999999999999999999999999999995 899999986 35899999999999999999999
Q ss_pred cCCCCCcCCCCCCCCccccCCCCCCCCCCcccCCCcee-eccCCcccCCCcccCCCcccCC------CCCCccccCCCc-
Q psy12394 1275 QCEPNTFGYDPIIGCEECNCHPHGVNGTQQCDLFDGSC-SCKENIVGRTCDHCVEGHWSFP------YCVPCECDLRGT- 1346 (1873)
Q Consensus 1275 ~C~~g~~g~~~~~~C~~C~C~~~gs~~~~~C~~~~G~C-~C~~~~~G~~C~~C~~G~~g~p------~C~~C~C~~~gs- 1346 (1873)
+|+|||||| ..|+||+||.|. ..||+.+|.| .|+..++|..||+|..||||+| .|+||+|+.+-.
T Consensus 845 qCqpG~WgF---PeCr~CqCNgHA----~~Cd~~tGaCi~CqD~T~G~~CdrCl~GyyGdP~lg~g~~CrPCpCP~gp~S 917 (1758)
T KOG0994|consen 845 QCQPGYWGF---PECRPCQCNGHA----DTCDPITGACIDCQDSTTGHSCDRCLDGYYGDPRLGSGIGCRPCPCPDGPAS 917 (1758)
T ss_pred ccCCCccCC---CcCccccccCcc----cccCccccccccccccccccchhhhhccccCCcccCCCCCCCCCCCCCCCcc
Confidence 999999998 479999999986 5999999999 6999999999999999999999 499999997532
Q ss_pred ---cccccCCC----CceeeccCccccCCCCcCCCCccccCCCCCCCCccccccCCCcccccCccccccccccccccccC
Q psy12394 1347 ---TIDICNQG----TAECYCKKNVYGAACDVCKEGTFDIQADNVDGCTRCFCFGKTTKCSSSNLYRSQLVYCKPCECSG 1419 (1873)
Q Consensus 1347 ---~~~~Cd~~----~G~C~C~~~~~G~~Cd~C~~g~~g~~~~~~~gC~~C~C~g~~~~C~~~~~~~~~~~~~~~~~~~~ 1419 (1873)
.++.|... .-.|.|++||.|.+|+.|+++|||.+.. -..|.+|.| ++
T Consensus 918 g~~~A~sC~~d~~t~~ivC~C~~GY~G~RCe~CA~~~fGnP~~-GGtCq~CeC-------------------------~~ 971 (1758)
T KOG0994|consen 918 GRQHADSCYLDTRTQQIVCHCQEGYSGSRCEICADNHFGNPSE-GGTCQKCEC-------------------------SN 971 (1758)
T ss_pred chhccccccccccccceeeecccCccccchhhhcccccCCccc-CCccccccc-------------------------cC
Confidence 24566443 5689999999999999999999998754 444665555 68
Q ss_pred CCCCCCCCCccCCCCceeccccCCCCCccEEcCCCCCcCCCCCCCcccCCCCCCcccCccccCCCCCCCcccccCCCccc
Q psy12394 1420 NINRTDPGSCDSVTGECTGCLFNSAGDSCQYCAPGYYGNAVSLKNCVKCNCNPEGVLKTFAGCGSLPAGELCECKPKVQG 1499 (1873)
Q Consensus 1420 ~~~~~~~~~cd~~tG~C~~c~~nt~G~~c~~c~pg~yG~~~~~~~c~~c~c~~~~~~~~~~~~~~~~~~~~c~C~~~v~G 1499 (1873)
||+..+|++||+.||+||+|+|+|+|++|+.|++|||||++ ..+|+.|.|+-.|++.+ ++|+ ..+|||+|++||+|
T Consensus 972 NiD~~d~~aCD~~TG~CLkCL~hTeG~hCe~Ck~Gf~GdA~-~q~CqrC~Cn~LGTn~~-~~CD--r~tGQCpClpNv~G 1047 (1758)
T KOG0994|consen 972 NIDLYDPGACDVATGACLKCLYHTEGDHCEHCKDGFYGDAL-RQNCQRCVCNFLGTNST-CHCD--RFTGQCPCLPNVQG 1047 (1758)
T ss_pred CcCccCCCccchhhchhhhhhhcccccchhhccccchhHHH-HhhhhhheccccccCCc-cccc--cccCcCCCCccccc
Confidence 99999999999999999999999999999999999999998 56899999999999877 8888 78899999999999
Q ss_pred ccccccCCCCcCCCCCCCCCCccCCCCCCCCcCCcccccCCCCcccccCCCCcCCccccCCCccccCCCCcCCccccccC
Q psy12394 1500 RICDECRPLYWNLKASNPDGCEDCDCYTLGTIGGIKNCNPKSGQCVCKATAMNRKCDACVDGTYALQDNNLFGCTECACD 1579 (1873)
Q Consensus 1500 ~~Cd~C~~~y~~~~~~~~~~C~~C~C~~~~s~~g~~~c~~~tgqC~C~~g~~g~~Cd~C~~g~~~~~~~~~~gc~~c~C~ 1579 (1873)
.+||+|++++|++.. ++||++|+||+.+ + .+|+.+||||+|||||.||.|++|++-||++|++ +|.+|+|+
T Consensus 1048 ~~CDqCA~N~w~laS--G~GCe~C~Cd~~~---~-pqCN~ftGQCqCkpGfGGR~C~qCqel~WGdP~~---~C~aCdCd 1118 (1758)
T KOG0994|consen 1048 VRCDQCAENHWNLAS--GEGCEPCNCDPIG---G-PQCNEFTGQCQCKPGFGGRTCSQCQELYWGDPNE---KCRACDCD 1118 (1758)
T ss_pred ccccccccchhcccc--CCCCCccCCCccC---C-ccccccccceeccCCCCCcchhHHHHhhcCCCCC---CceecCCC
Confidence 999999999999964 8999999997632 2 5899999999999999999999999999999975 67777665
Q ss_pred C
Q psy12394 1580 I 1580 (1873)
Q Consensus 1580 ~ 1580 (1873)
+
T Consensus 1119 ~ 1119 (1758)
T KOG0994|consen 1119 P 1119 (1758)
T ss_pred C
Confidence 4
|
|
| >KOG1836|consensus | Back alignment and domain information |
|---|
| >KOG0994|consensus | Back alignment and domain information |
|---|
| >KOG1836|consensus | Back alignment and domain information |
|---|
| >KOG3512|consensus | Back alignment and domain information |
|---|
| >KOG3512|consensus | Back alignment and domain information |
|---|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >smart00136 LamNT Laminin N-terminal domain (domain VI) | Back alignment and domain information |
|---|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >PF00055 Laminin_N: Laminin N-terminal (Domain VI); InterPro: IPR008211 Laminin is a large molecular weight glycoprotein present only in basement membranes in almost every animal tissue | Back alignment and domain information |
|---|
| >KOG3509|consensus | Back alignment and domain information |
|---|
| >KOG3509|consensus | Back alignment and domain information |
|---|
| >KOG1225|consensus | Back alignment and domain information |
|---|
| >KOG1225|consensus | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >KOG1217|consensus | Back alignment and domain information |
|---|
| >smart00180 EGF_Lam Laminin-type epidermal growth factor-like domai | Back alignment and domain information |
|---|
| >cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies | Back alignment and domain information |
|---|
| >PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation | Back alignment and domain information |
|---|
| >cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies | Back alignment and domain information |
|---|
| >KOG1217|consensus | Back alignment and domain information |
|---|
| >PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation | Back alignment and domain information |
|---|
| >smart00180 EGF_Lam Laminin-type epidermal growth factor-like domai | Back alignment and domain information |
|---|
| >KOG1226|consensus | Back alignment and domain information |
|---|
| >KOG1226|consensus | Back alignment and domain information |
|---|
| >KOG1218|consensus | Back alignment and domain information |
|---|
| >KOG1218|consensus | Back alignment and domain information |
|---|
| >KOG4260|consensus | Back alignment and domain information |
|---|
| >KOG4260|consensus | Back alignment and domain information |
|---|
| >KOG1388|consensus | Back alignment and domain information |
|---|
| >KOG1214|consensus | Back alignment and domain information |
|---|
| >KOG1388|consensus | Back alignment and domain information |
|---|
| >PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >KOG1214|consensus | Back alignment and domain information |
|---|
| >smart00051 DSL delta serrate ligand | Back alignment and domain information |
|---|
| >PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >smart00179 EGF_CA Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >smart00051 DSL delta serrate ligand | Back alignment and domain information |
|---|
| >PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A | Back alignment and domain information |
|---|
| >PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A | Back alignment and domain information |
|---|
| >cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >PF03302 VSP: Giardia variant-specific surface protein; InterPro: IPR005127 During infection, the intestinal protozoan parasite Giardia lamblia virus undergoes continuous antigenic variation which is determined by diversification of the parasite's major surface antigen, named VSP (variant surface protein) | Back alignment and domain information |
|---|
| >smart00179 EGF_CA Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >PF01414 DSL: Delta serrate ligand; InterPro: IPR001774 Ligands of the Delta/Serrate/lag-2 (DSL) family and their receptors, members of the lin-12/Notch family, mediate cell-cell interactions that specify cell fate in invertebrates and vertebrates | Back alignment and domain information |
|---|
| >smart00181 EGF Epidermal growth factor-like domain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 1873 | ||||
| 2y38_A | 403 | Laminin Alpha5 Chain N-Terminal Fragment Length = 4 | 6e-59 | ||
| 2y38_A | 403 | Laminin Alpha5 Chain N-Terminal Fragment Length = 4 | 2e-13 | ||
| 4aqs_A | 525 | Laminin Beta1 Ln-Le1-4 Structure Length = 525 | 3e-33 | ||
| 4aqs_A | 525 | Laminin Beta1 Ln-Le1-4 Structure Length = 525 | 7e-23 | ||
| 4aqs_A | 525 | Laminin Beta1 Ln-Le1-4 Structure Length = 525 | 6e-21 | ||
| 4aqs_A | 525 | Laminin Beta1 Ln-Le1-4 Structure Length = 525 | 5e-06 | ||
| 4aqt_A | 375 | Laminin Gamma1 Ln-Le1-2 Structure Length = 375 | 4e-29 | ||
| 1klo_A | 162 | Crystal Structure Of Three Consecutive Laminin-Type | 5e-14 | ||
| 1klo_A | 162 | Crystal Structure Of Three Consecutive Laminin-Type | 3e-09 | ||
| 1npe_B | 164 | Crystal Structure Of Nidogen/laminin Complex Length | 6e-14 | ||
| 1npe_B | 164 | Crystal Structure Of Nidogen/laminin Complex Length | 3e-09 | ||
| 3zyj_B | 426 | Netring1 In Complex With Ngl1 Length = 426 | 4e-10 | ||
| 3tbd_A | 338 | Crystal Structure Of Domain Vi And Le1 Of Human Net | 3e-08 | ||
| 3zyg_A | 353 | Netring2 Lam And Egf1 Domains Length = 353 | 3e-08 | ||
| 1tle_A | 58 | Le (Laminin-Type Egf-Like) Module Giii4 In Solution | 2e-05 | ||
| 2ygq_A | 324 | Wif Domain-Epidermal Growth Factor (Egf)-Like Domai | 1e-04 |
| >pdb|2Y38|A Chain A, Laminin Alpha5 Chain N-Terminal Fragment Length = 403 | Back alignment and structure |
|
| >pdb|2Y38|A Chain A, Laminin Alpha5 Chain N-Terminal Fragment Length = 403 | Back alignment and structure |
| >pdb|4AQS|A Chain A, Laminin Beta1 Ln-Le1-4 Structure Length = 525 | Back alignment and structure |
| >pdb|4AQS|A Chain A, Laminin Beta1 Ln-Le1-4 Structure Length = 525 | Back alignment and structure |
| >pdb|4AQS|A Chain A, Laminin Beta1 Ln-Le1-4 Structure Length = 525 | Back alignment and structure |
| >pdb|4AQS|A Chain A, Laminin Beta1 Ln-Le1-4 Structure Length = 525 | Back alignment and structure |
| >pdb|4AQT|A Chain A, Laminin Gamma1 Ln-Le1-2 Structure Length = 375 | Back alignment and structure |
| >pdb|1KLO|A Chain A, Crystal Structure Of Three Consecutive Laminin-Type Epidermal Growth Factor-Like (Le) Modules Of Laminin Gamma1 Chain Harboring The Nidogen Binding Site Length = 162 | Back alignment and structure |
| >pdb|1KLO|A Chain A, Crystal Structure Of Three Consecutive Laminin-Type Epidermal Growth Factor-Like (Le) Modules Of Laminin Gamma1 Chain Harboring The Nidogen Binding Site Length = 162 | Back alignment and structure |
| >pdb|1NPE|B Chain B, Crystal Structure Of Nidogen/laminin Complex Length = 164 | Back alignment and structure |
| >pdb|1NPE|B Chain B, Crystal Structure Of Nidogen/laminin Complex Length = 164 | Back alignment and structure |
| >pdb|3ZYJ|B Chain B, Netring1 In Complex With Ngl1 Length = 426 | Back alignment and structure |
| >pdb|3TBD|A Chain A, Crystal Structure Of Domain Vi And Le1 Of Human Netrin-G2 Length = 338 | Back alignment and structure |
| >pdb|3ZYG|A Chain A, Netring2 Lam And Egf1 Domains Length = 353 | Back alignment and structure |
| >pdb|1TLE|A Chain A, Le (Laminin-Type Egf-Like) Module Giii4 In Solution At Ph 3.5 And 290 K, Nmr, 14 Structures Length = 58 | Back alignment and structure |
| >pdb|2YGQ|A Chain A, Wif Domain-Epidermal Growth Factor (Egf)-Like Domains 1-3 Of Human Wnt Inhibitory Factor 1 In Complex With 1,2-Dipalmitoylphosphatidylcholine Length = 324 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1873 | |||
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 2e-66 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 2e-29 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 7e-29 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 4e-28 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 4e-27 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 9e-27 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 1e-26 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 3e-24 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 2e-20 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 1e-13 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 6e-13 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 2e-11 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 4e-06 | |
| 2y38_A | 403 | Laminin subunit alpha-5; structural protein, cell | 5e-49 | |
| 2y38_A | 403 | Laminin subunit alpha-5; structural protein, cell | 4e-16 | |
| 2y38_A | 403 | Laminin subunit alpha-5; structural protein, cell | 1e-11 | |
| 2y38_A | 403 | Laminin subunit alpha-5; structural protein, cell | 4e-11 | |
| 2y38_A | 403 | Laminin subunit alpha-5; structural protein, cell | 6e-11 | |
| 2y38_A | 403 | Laminin subunit alpha-5; structural protein, cell | 3e-09 | |
| 2y38_A | 403 | Laminin subunit alpha-5; structural protein, cell | 6e-09 | |
| 2y38_A | 403 | Laminin subunit alpha-5; structural protein, cell | 7e-09 | |
| 2y38_A | 403 | Laminin subunit alpha-5; structural protein, cell | 2e-08 | |
| 2y38_A | 403 | Laminin subunit alpha-5; structural protein, cell | 7e-08 | |
| 2y38_A | 403 | Laminin subunit alpha-5; structural protein, cell | 3e-07 | |
| 2y38_A | 403 | Laminin subunit alpha-5; structural protein, cell | 8e-05 | |
| 2y38_A | 403 | Laminin subunit alpha-5; structural protein, cell | 3e-04 | |
| 2y38_A | 403 | Laminin subunit alpha-5; structural protein, cell | 3e-04 | |
| 4aqt_A | 375 | Laminin subunit gamma-1; cell adhesion; HET: NAG B | 8e-37 | |
| 4aqt_A | 375 | Laminin subunit gamma-1; cell adhesion; HET: NAG B | 9e-14 | |
| 4aqt_A | 375 | Laminin subunit gamma-1; cell adhesion; HET: NAG B | 1e-13 | |
| 4aqt_A | 375 | Laminin subunit gamma-1; cell adhesion; HET: NAG B | 2e-13 | |
| 4aqt_A | 375 | Laminin subunit gamma-1; cell adhesion; HET: NAG B | 7e-13 | |
| 4aqt_A | 375 | Laminin subunit gamma-1; cell adhesion; HET: NAG B | 2e-12 | |
| 4aqt_A | 375 | Laminin subunit gamma-1; cell adhesion; HET: NAG B | 2e-12 | |
| 4aqt_A | 375 | Laminin subunit gamma-1; cell adhesion; HET: NAG B | 5e-12 | |
| 4aqt_A | 375 | Laminin subunit gamma-1; cell adhesion; HET: NAG B | 2e-11 | |
| 4aqt_A | 375 | Laminin subunit gamma-1; cell adhesion; HET: NAG B | 2e-11 | |
| 4aqt_A | 375 | Laminin subunit gamma-1; cell adhesion; HET: NAG B | 5e-10 | |
| 4aqt_A | 375 | Laminin subunit gamma-1; cell adhesion; HET: NAG B | 2e-09 | |
| 4aqt_A | 375 | Laminin subunit gamma-1; cell adhesion; HET: NAG B | 1e-06 | |
| 4aqt_A | 375 | Laminin subunit gamma-1; cell adhesion; HET: NAG B | 4e-06 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 1e-25 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 2e-25 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 3e-24 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 2e-23 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 2e-23 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 3e-23 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 3e-21 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 9e-21 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 5e-19 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 5e-18 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 2e-14 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 8e-11 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 7e-10 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 8e-10 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 4e-09 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 9e-09 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 2e-08 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 1e-06 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 3e-04 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 7e-04 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 3e-25 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 3e-12 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 7e-12 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 1e-11 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 2e-10 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 4e-09 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 2e-08 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 2e-07 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 1e-06 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 4e-05 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 2e-04 | |
| 3tbd_A | 338 | Netrin-G2, laminet-2; laminin N-terminal domain, d | 8e-22 | |
| 3tbd_A | 338 | Netrin-G2, laminet-2; laminin N-terminal domain, d | 7e-08 | |
| 3tbd_A | 338 | Netrin-G2, laminet-2; laminin N-terminal domain, d | 2e-07 | |
| 3tbd_A | 338 | Netrin-G2, laminet-2; laminin N-terminal domain, d | 3e-07 | |
| 3tbd_A | 338 | Netrin-G2, laminet-2; laminin N-terminal domain, d | 4e-07 | |
| 3tbd_A | 338 | Netrin-G2, laminet-2; laminin N-terminal domain, d | 1e-06 | |
| 3tbd_A | 338 | Netrin-G2, laminet-2; laminin N-terminal domain, d | 2e-06 | |
| 3tbd_A | 338 | Netrin-G2, laminet-2; laminin N-terminal domain, d | 1e-05 | |
| 3tbd_A | 338 | Netrin-G2, laminet-2; laminin N-terminal domain, d | 1e-04 | |
| 3tbd_A | 338 | Netrin-G2, laminet-2; laminin N-terminal domain, d | 1e-04 | |
| 3tbd_A | 338 | Netrin-G2, laminet-2; laminin N-terminal domain, d | 3e-04 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 3e-18 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 1e-17 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 4e-14 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 6e-14 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 8e-14 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 5e-10 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 4e-08 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 3e-06 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 9e-14 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 1e-11 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 9e-11 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 3e-09 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 5e-08 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 7e-08 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 1e-06 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 5e-05 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 5e-13 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 2e-11 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 7e-11 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 1e-10 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 1e-09 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 1e-09 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 2e-09 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 4e-08 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 2e-07 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 2e-06 | |
| 1skz_A | 119 | Antistasin; factor XA inhibitor, serine protease i | 9e-10 | |
| 1skz_A | 119 | Antistasin; factor XA inhibitor, serine protease i | 8e-09 | |
| 1skz_A | 119 | Antistasin; factor XA inhibitor, serine protease i | 3e-08 | |
| 1skz_A | 119 | Antistasin; factor XA inhibitor, serine protease i | 1e-06 | |
| 1skz_A | 119 | Antistasin; factor XA inhibitor, serine protease i | 1e-06 | |
| 1skz_A | 119 | Antistasin; factor XA inhibitor, serine protease i | 2e-06 | |
| 1skz_A | 119 | Antistasin; factor XA inhibitor, serine protease i | 2e-06 | |
| 1skz_A | 119 | Antistasin; factor XA inhibitor, serine protease i | 4e-06 | |
| 1skz_A | 119 | Antistasin; factor XA inhibitor, serine protease i | 3e-05 | |
| 1skz_A | 119 | Antistasin; factor XA inhibitor, serine protease i | 3e-05 | |
| 1skz_A | 119 | Antistasin; factor XA inhibitor, serine protease i | 5e-05 | |
| 1skz_A | 119 | Antistasin; factor XA inhibitor, serine protease i | 8e-05 | |
| 1skz_A | 119 | Antistasin; factor XA inhibitor, serine protease i | 1e-04 | |
| 1skz_A | 119 | Antistasin; factor XA inhibitor, serine protease i | 8e-04 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 3e-09 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 7e-06 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 2e-05 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 7e-05 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 8e-08 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 7e-07 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 2e-06 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 8e-05 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 7e-04 | |
| 2ygo_A | 188 | WIF-1, WNT inhibitory factor 1; signaling protein, | 1e-04 | |
| 2ygo_A | 188 | WIF-1, WNT inhibitory factor 1; signaling protein, | 2e-04 | |
| 2dtg_E | 897 | Insulin receptor; IR ectodomain, X-RAY crystallogr | 2e-04 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 4e-04 | |
| 1yy9_A | 624 | Epidermal growth factor receptor; cell surface rec | 6e-04 | |
| 1igr_A | 478 | Insulin-like growth factor receptor 1; hormone rec | 7e-04 |
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 | Back alignment and structure |
|---|
Score = 234 bits (598), Expect = 2e-66
Identities = 99/357 (27%), Positives = 160/357 (44%), Gaps = 38/357 (10%)
Query: 12 LERSADNGITISLLDHRPSMKNFFNSTRLQEWTRATNVRLRLLRTKNLLGHLMSMADQDP 71
+E S + + LD + S R+Q + TN+R++ ++ L +L+ D
Sbjct: 180 IEPSTEGEVIFRALDPAFKI-EDPYSPRIQNLLKITNLRIKFVKLHTLGDNLL---DSRM 235
Query: 72 TTTRRYFYSIKDISIGGRCRCNGHADVCDILDP-----EDPYHRICRCQHNTCGHNCEVC 126
+Y+Y++ D+ + G C C GHA C +D E H C C+HNT G NCE+C
Sbjct: 236 EIREKYYYAVYDMVVRGNCFCYGHASECAPVDGVNEEVEGMVHGHCMCRHNTKGLNCELC 295
Query: 127 CPGYEQKAWRQSQSNKPFSCEPCNCHGHADKCVYDPMVDEKRLSVDIQGNYEGGGVCQEC 186
Y WR ++ +C+ CNC+ H+ C +D +V + GGVC C
Sbjct: 296 MDFYHDLPWRPAEGRNSNACKKCNCNEHSSSCHFDM-------AVFLATGNVSGGVCDNC 348
Query: 187 RDNTEGINCHQRVAGYYRPYGKHLNETDVCQPCQCAFH----------YATGNCAEGTGK 236
+ NT G NC Q Y++ + + + ++C+PC C Y + G+
Sbjct: 349 QHNTMGRNCEQCKPFYFQHPERDIRDPNLCEPCTCDPAGSENGGICDGYTDFSVGLIAGQ 408
Query: 237 CECRPEYTKPDCNSCAFGYFGYP-----NCEPCKCHMNGTLDFY--CEPASGQQCPCKEN 289
C C+ C+ C G++ C+ C C+ GT+ C+ +G C CK
Sbjct: 409 CRCKLHVEGERCDVCKEGFYDLSAEDPYGCKSCACNPLGTIPGGNPCDSETG-YCYCKRL 467
Query: 290 YAGDHCDTCAQGYYNFPT----CSPCECNAVGSLSDLCEVDSGNCTCRNNFAGRTCD 342
G CD C ++ C PC+C+ G+L++ C DSG C+C + GR C+
Sbjct: 468 VTGQRCDQCLPQHWGLSNDLDGCRPCDCDLGGALNNSCSEDSGQCSCLPHMIGRQCN 524
|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 | Back alignment and structure |
|---|
| >2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Length = 403 | Back alignment and structure |
|---|
| >2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Length = 403 | Back alignment and structure |
|---|
| >2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Length = 403 | Back alignment and structure |
|---|
| >2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Length = 403 | Back alignment and structure |
|---|
| >2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Length = 403 | Back alignment and structure |
|---|
| >2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Length = 403 | Back alignment and structure |
|---|
| >2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Length = 403 | Back alignment and structure |
|---|
| >2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Length = 403 | Back alignment and structure |
|---|
| >2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Length = 403 | Back alignment and structure |
|---|
| >2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Length = 403 | Back alignment and structure |
|---|
| >2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Length = 403 | Back alignment and structure |
|---|
| >2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Length = 403 | Back alignment and structure |
|---|
| >2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Length = 403 | Back alignment and structure |
|---|
| >2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Length = 403 | Back alignment and structure |
|---|
| >4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 | Back alignment and structure |
|---|
| >4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 | Back alignment and structure |
|---|
| >4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 | Back alignment and structure |
|---|
| >4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 | Back alignment and structure |
|---|
| >4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 | Back alignment and structure |
|---|
| >4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 | Back alignment and structure |
|---|
| >4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 | Back alignment and structure |
|---|
| >4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 | Back alignment and structure |
|---|
| >4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 | Back alignment and structure |
|---|
| >4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 | Back alignment and structure |
|---|
| >4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 | Back alignment and structure |
|---|
| >4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 | Back alignment and structure |
|---|
| >4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 | Back alignment and structure |
|---|
| >4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 | Back alignment and structure |
|---|
| >3tbd_A Netrin-G2, laminet-2; laminin N-terminal domain, domain VI, LE-domain, N neuronal cell adhesion molecule, netrin G ligand 2, nervous system; HET: NAG; 1.80A {Homo sapiens} PDB: 3zyg_A* 3zyi_B* Length = 338 | Back alignment and structure |
|---|
| >3tbd_A Netrin-G2, laminet-2; laminin N-terminal domain, domain VI, LE-domain, N neuronal cell adhesion molecule, netrin G ligand 2, nervous system; HET: NAG; 1.80A {Homo sapiens} PDB: 3zyg_A* 3zyi_B* Length = 338 | Back alignment and structure |
|---|
| >3tbd_A Netrin-G2, laminet-2; laminin N-terminal domain, domain VI, LE-domain, N neuronal cell adhesion molecule, netrin G ligand 2, nervous system; HET: NAG; 1.80A {Homo sapiens} PDB: 3zyg_A* 3zyi_B* Length = 338 | Back alignment and structure |
|---|
| >3tbd_A Netrin-G2, laminet-2; laminin N-terminal domain, domain VI, LE-domain, N neuronal cell adhesion molecule, netrin G ligand 2, nervous system; HET: NAG; 1.80A {Homo sapiens} PDB: 3zyg_A* 3zyi_B* Length = 338 | Back alignment and structure |
|---|
| >3tbd_A Netrin-G2, laminet-2; laminin N-terminal domain, domain VI, LE-domain, N neuronal cell adhesion molecule, netrin G ligand 2, nervous system; HET: NAG; 1.80A {Homo sapiens} PDB: 3zyg_A* 3zyi_B* Length = 338 | Back alignment and structure |
|---|
| >3tbd_A Netrin-G2, laminet-2; laminin N-terminal domain, domain VI, LE-domain, N neuronal cell adhesion molecule, netrin G ligand 2, nervous system; HET: NAG; 1.80A {Homo sapiens} PDB: 3zyg_A* 3zyi_B* Length = 338 | Back alignment and structure |
|---|
| >3tbd_A Netrin-G2, laminet-2; laminin N-terminal domain, domain VI, LE-domain, N neuronal cell adhesion molecule, netrin G ligand 2, nervous system; HET: NAG; 1.80A {Homo sapiens} PDB: 3zyg_A* 3zyi_B* Length = 338 | Back alignment and structure |
|---|
| >3tbd_A Netrin-G2, laminet-2; laminin N-terminal domain, domain VI, LE-domain, N neuronal cell adhesion molecule, netrin G ligand 2, nervous system; HET: NAG; 1.80A {Homo sapiens} PDB: 3zyg_A* 3zyi_B* Length = 338 | Back alignment and structure |
|---|
| >3tbd_A Netrin-G2, laminet-2; laminin N-terminal domain, domain VI, LE-domain, N neuronal cell adhesion molecule, netrin G ligand 2, nervous system; HET: NAG; 1.80A {Homo sapiens} PDB: 3zyg_A* 3zyi_B* Length = 338 | Back alignment and structure |
|---|
| >3tbd_A Netrin-G2, laminet-2; laminin N-terminal domain, domain VI, LE-domain, N neuronal cell adhesion molecule, netrin G ligand 2, nervous system; HET: NAG; 1.80A {Homo sapiens} PDB: 3zyg_A* 3zyi_B* Length = 338 | Back alignment and structure |
|---|
| >3tbd_A Netrin-G2, laminet-2; laminin N-terminal domain, domain VI, LE-domain, N neuronal cell adhesion molecule, netrin G ligand 2, nervous system; HET: NAG; 1.80A {Homo sapiens} PDB: 3zyg_A* 3zyi_B* Length = 338 | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 | Back alignment and structure |
|---|
| >1skz_A Antistasin; factor XA inhibitor, serine protease inhibitor, thrombosis; 1.90A {Haementeria officinalis} SCOP: g.3.15.1 g.3.15.1 Length = 119 | Back alignment and structure |
|---|
| >1skz_A Antistasin; factor XA inhibitor, serine protease inhibitor, thrombosis; 1.90A {Haementeria officinalis} SCOP: g.3.15.1 g.3.15.1 Length = 119 | Back alignment and structure |
|---|
| >1skz_A Antistasin; factor XA inhibitor, serine protease inhibitor, thrombosis; 1.90A {Haementeria officinalis} SCOP: g.3.15.1 g.3.15.1 Length = 119 | Back alignment and structure |
|---|
| >1skz_A Antistasin; factor XA inhibitor, serine protease inhibitor, thrombosis; 1.90A {Haementeria officinalis} SCOP: g.3.15.1 g.3.15.1 Length = 119 | Back alignment and structure |
|---|
| >1skz_A Antistasin; factor XA inhibitor, serine protease inhibitor, thrombosis; 1.90A {Haementeria officinalis} SCOP: g.3.15.1 g.3.15.1 Length = 119 | Back alignment and structure |
|---|
| >1skz_A Antistasin; factor XA inhibitor, serine protease inhibitor, thrombosis; 1.90A {Haementeria officinalis} SCOP: g.3.15.1 g.3.15.1 Length = 119 | Back alignment and structure |
|---|
| >1skz_A Antistasin; factor XA inhibitor, serine protease inhibitor, thrombosis; 1.90A {Haementeria officinalis} SCOP: g.3.15.1 g.3.15.1 Length = 119 | Back alignment and structure |
|---|
| >1skz_A Antistasin; factor XA inhibitor, serine protease inhibitor, thrombosis; 1.90A {Haementeria officinalis} SCOP: g.3.15.1 g.3.15.1 Length = 119 | Back alignment and structure |
|---|
| >1skz_A Antistasin; factor XA inhibitor, serine protease inhibitor, thrombosis; 1.90A {Haementeria officinalis} SCOP: g.3.15.1 g.3.15.1 Length = 119 | Back alignment and structure |
|---|
| >1skz_A Antistasin; factor XA inhibitor, serine protease inhibitor, thrombosis; 1.90A {Haementeria officinalis} SCOP: g.3.15.1 g.3.15.1 Length = 119 | Back alignment and structure |
|---|
| >1skz_A Antistasin; factor XA inhibitor, serine protease inhibitor, thrombosis; 1.90A {Haementeria officinalis} SCOP: g.3.15.1 g.3.15.1 Length = 119 | Back alignment and structure |
|---|
| >1skz_A Antistasin; factor XA inhibitor, serine protease inhibitor, thrombosis; 1.90A {Haementeria officinalis} SCOP: g.3.15.1 g.3.15.1 Length = 119 | Back alignment and structure |
|---|
| >1skz_A Antistasin; factor XA inhibitor, serine protease inhibitor, thrombosis; 1.90A {Haementeria officinalis} SCOP: g.3.15.1 g.3.15.1 Length = 119 | Back alignment and structure |
|---|
| >1skz_A Antistasin; factor XA inhibitor, serine protease inhibitor, thrombosis; 1.90A {Haementeria officinalis} SCOP: g.3.15.1 g.3.15.1 Length = 119 | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 | Back alignment and structure |
|---|
| >2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Length = 188 | Back alignment and structure |
|---|
| >2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Length = 188 | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Length = 217 | Back alignment and structure |
|---|
| >1yy9_A Epidermal growth factor receptor; cell surface receptor, tyrosine kinase, glycoprotein, antigen:antibody complex, FAB fragment, antitumor, drug; HET: NDG NAG BMA MAN; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 PDB: 3qwq_A* 1nql_A* 3b2v_A* 1ivo_A* 3njp_A* Length = 624 | Back alignment and structure |
|---|
| >1igr_A Insulin-like growth factor receptor 1; hormone receptor, insulin receptor family; HET: NAG FUC BMA MAN; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 Length = 478 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1873 | |||
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 100.0 | |
| 2y38_A | 403 | Laminin subunit alpha-5; structural protein, cell | 100.0 | |
| 4aqt_A | 375 | Laminin subunit gamma-1; cell adhesion; HET: NAG B | 100.0 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 100.0 | |
| 3tbd_A | 338 | Netrin-G2, laminet-2; laminin N-terminal domain, d | 99.95 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 99.85 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 99.79 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 99.79 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 99.58 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 99.57 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 99.56 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 99.53 | |
| 2y38_A | 403 | Laminin subunit alpha-5; structural protein, cell | 99.52 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 99.47 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 99.4 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 99.38 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 99.3 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 99.29 | |
| 4aqt_A | 375 | Laminin subunit gamma-1; cell adhesion; HET: NAG B | 99.25 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 99.23 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 99.23 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 99.19 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 99.03 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 99.0 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 98.97 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 98.87 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 98.82 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 98.78 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 98.75 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 98.59 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 98.35 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 98.14 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 98.08 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 98.04 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 97.98 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 97.96 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 97.87 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 97.84 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 97.81 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 97.79 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 97.69 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 97.59 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 97.58 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 97.57 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 97.5 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 97.37 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 97.27 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 97.19 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 97.15 | |
| 3tbd_A | 338 | Netrin-G2, laminet-2; laminin N-terminal domain, d | 97.09 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 97.05 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 97.04 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 96.98 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 96.95 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 96.94 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 96.93 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 96.85 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 96.79 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 96.79 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 96.79 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 96.78 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 96.78 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 96.73 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 96.62 | |
| 3ca7_A | 52 | Protein spitz; argos, EGF, developmental protein, | 96.39 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 96.27 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 96.24 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 96.22 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 96.16 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 96.04 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 96.03 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 96.02 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 95.96 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 95.76 | |
| 3ca7_A | 52 | Protein spitz; argos, EGF, developmental protein, | 95.43 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 95.39 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 95.27 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 95.17 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 95.16 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 95.01 | |
| 1nql_B | 53 | Epidermal growth factor; cell surface receptor, ty | 94.85 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 94.81 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 94.24 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 94.2 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 94.09 | |
| 1nql_B | 53 | Epidermal growth factor; cell surface receptor, ty | 93.95 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 92.92 | |
| 2fd6_A | 122 | Urokinase-type plasminogen activator; UPAR, ATF, A | 92.12 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 92.03 | |
| 3ltf_D | 58 | Protein spitz; receptor-ligand complex ectodomain | 91.94 | |
| 2fd6_A | 122 | Urokinase-type plasminogen activator; UPAR, ATF, A | 91.88 | |
| 3ltf_D | 58 | Protein spitz; receptor-ligand complex ectodomain | 91.64 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 90.91 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 90.81 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 89.98 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 88.4 | |
| 2ddu_A | 387 | Reelin; beta-jelly-roll, signaling protein; 2.05A | 88.05 | |
| 1q4g_A | 553 | Prostaglandin G/H synthase 1; cyclooxygenase, non- | 87.32 | |
| 3nt1_A | 587 | Prostaglandin-endoperoxide synthase 2; prostagland | 85.77 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 85.59 | |
| 2i9a_A | 145 | Urokinase-type plasminogen activator; growth facto | 82.53 | |
| 1iox_A | 50 | Betacellulin; EGF-like fold, hormone/growth factor | 82.01 | |
| 3e50_C | 50 | Protransforming growth factor alpha; IDE, TGF-alph | 81.96 | |
| 2ygo_A | 188 | WIF-1, WNT inhibitory factor 1; signaling protein, | 81.56 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 80.88 |
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} | Back alignment and structure |
|---|
Probab=100.00 E-value=2.5e-53 Score=546.39 Aligned_cols=329 Identities=32% Similarity=0.765 Sum_probs=249.7
Q ss_pred CCCCCCceEEEeeccCC-----------------------------------------------eEEEccCCCCCCCCCC
Q psy12394 3 NSPRPAVWALERSADNG-----------------------------------------------ITISLLDHRPSMKNFF 35 (1873)
Q Consensus 3 ~sprp~~~~~ers~d~g-----------------------------------------------i~~s~~~~rp~~~~~~ 35 (1873)
+||||++||||||+|+| |+|++|++||++.+ .
T Consensus 124 ~s~rP~~~~ieks~d~g~tw~p~qy~a~~C~~~f~~~~~~~~~~~~~v~Ct~~~s~~~p~~~g~v~~~~~~~~~~~~~-~ 202 (525)
T 4aqs_A 124 KTFRPAAMLIERSSDFGKAWGVYRYFAYDCESSFPGISTGPMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIED-P 202 (525)
T ss_dssp SSCCCSEEEEEEESSTTSSCEEEEEEESSTTTTSSSSCCSCCSSTTCCCEECTTCCSCSTTTCEEEEESSCSSSCCSC-T
T ss_pred ECCCCCeEEEEEecCCCCCCcceeeehhhhhhhcCCCCCCCCCCCCcceecccCCCCCCCCCCeEEEEecCCCcccCC-C
Confidence 79999999999999988 99999999999865 5
Q ss_pred CchhhhhheeeeeeeEeeccccccccccccccCCCCCcceeeeEEeeeeeeeeeeccCCCCCcCccCCC-----CCCccc
Q psy12394 36 NSTRLQEWTRATNVRLRLLRTKNLLGHLMSMADQDPTTTRRYFYSIKDISIGGRCRCNGHADVCDILDP-----EDPYHR 110 (1873)
Q Consensus 36 ~s~~l~~~~~at~ir~~~~~~~t~~~~~~~~~~~~~~~~~~~yYai~d~~v~grC~C~gHa~~C~~~~~-----~~~~~~ 110 (1873)
+|++||||++||||||||+|++||++++|+ .++.++++|||||+||+|+|||+|||||++|++.+. .+..++
T Consensus 203 ~s~~l~~~~~~t~iri~~~~~~~~~~~~~~---~~~~~~~~~~Yai~di~v~grC~CnGHa~~C~p~~g~~~~~~g~~~g 279 (525)
T 4aqs_A 203 YSPRIQNLLKITNLRIKFVKLHTLGDNLLD---SRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGVNEEVEGMVHG 279 (525)
T ss_dssp TSHHHHHHHEEEEEEEEEEECCCTTCCCTT---CCHHHHTTCCCEEEEEEEEEECCCTTBCSCEECC------CCSCCCC
T ss_pred CChhhhhhhhhhhhhhheeccccccccccc---ccccccccccEEEEeeEECeEeccCCccccCCCcCCcccCCCCCcCc
Confidence 699999999999999999999999999875 567788999999999999999999999999987542 345678
Q ss_pred eeecCCCCCCCCCCCCCCCccCCcCCcCCCCCCCCccCCCCCCCCCccccCccccccCcccccCcCcCCCceeCCCCCCC
Q psy12394 111 ICRCQHNTCGHNCEVCCPGYEQKAWRQSQSNKPFSCEPCNCHGHADKCVYDPMVDEKRLSVDIQGNYEGGGVCQECRDNT 190 (1873)
Q Consensus 111 ~C~C~h~t~G~~Ce~c~p~~~~~p~~~~~~~~~~~C~~C~C~~~~~~C~~d~~~~~~~~s~~~~g~~~~GG~C~~C~~~~ 190 (1873)
+|+|+|||+|++||+|+|+|++.||++++....+.+..|+|++|+..|.++...... ..+.+||+|.+|.++|
T Consensus 280 ~C~C~~G~~G~~Ce~C~~g~~~~p~~~~~c~~~~~~~~C~C~~~~~~C~~d~~~c~~-------~~~~~gg~C~~C~~g~ 352 (525)
T 4aqs_A 280 HCMCRHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSSSCHFDMAVFLA-------TGNVSGGVCDNCQHNT 352 (525)
T ss_dssp EECCCTTEESSSSCEECTTCCSSCCCCCBTTBCCCCCCCCCTTSCSEEEECHHHHHH-------TTSSCCEEEESCCTTE
T ss_pred cccCcCCCcCCCCcCCCCccCCCccCCCcccCCCcccccccCCCCCCCCCCcccccc-------cCccCCCcccCCCCCC
Confidence 999999999999999999999999999999899999999999999999998876543 3456899999999999
Q ss_pred CCCCCCCCCCCCccCCCCCCCCCCCCccCCCCCCC--CCCeeec--------CCCceecCCCCcCCCCcccCCcccCCC-
Q psy12394 191 EGINCHQRVAGYYRPYGKHLNETDVCQPCQCAFHY--ATGNCAE--------GTGKCECRPEYTKPDCNSCAFGYFGYP- 259 (1873)
Q Consensus 191 ~G~~Ce~C~~g~~~~~~~~~~~~~~C~~C~C~~~~--n~g~C~~--------~~g~C~C~~G~~G~~Ce~C~~g~~g~~- 259 (1873)
+|.+|++|.++|++.+.......+.+.+|.|++.. ++..|.. ..+.|.|+++|.|.+|++|++||++.+
T Consensus 353 ~G~~Ce~C~~g~~~~~~~~~~~~~~~~~C~C~~~~~~~~~~C~~~~~~~~~~~~~~C~C~~g~~G~~C~~C~~Gy~G~~c 432 (525)
T 4aqs_A 353 MGRNCEQCKPFYFQHPERDIRDPNLCEPCTCDPAGSENGGICDGYTDFSVGLIAGQCRCKLHVEGERCDVCKEGFYDLSA 432 (525)
T ss_dssp ESTTSCEECTTEEECSSSCTTCTTCEEECCCCTTTBSGGGCCCCSCBGGGTBCSSCCCBCTTEETTTTCEECTTEECCCT
T ss_pred CCCCcccccCcccccCCCCCCCCCCCcCCCCCCCCCCCCccccCCCCCCcCCCCCccCCCCCCCCCcccCCCCCCcCCCC
Confidence 99999999999999998888888888899887654 2344432 346899999999999999999999865
Q ss_pred ----CCCCCCCCCCCCC--CceecCCCCCcccCCCCCccCCCccCCCCCCCC----CCCCCCCcCCCCCCCCcccCCCcc
Q psy12394 260 ----NCEPCKCHMNGTL--DFYCEPASGQQCPCKENYAGDHCDTCAQGYYNF----PTCSPCECNAVGSLSDLCEVDSGN 329 (1873)
Q Consensus 260 ----~C~~c~C~~~gt~--~~~C~~~~G~~C~C~~g~~G~~Ce~C~~Gf~g~----~~C~~c~C~~~gs~~~~C~~~~g~ 329 (1873)
.|.+++|++.|+. ++.|+..+| +|.|++||+|.+||+|++||+++ ..|++|+|+++|+.+..|+..+|+
T Consensus 433 ~~~~~C~~C~C~~~gtc~~~~~Cd~~tg-~C~C~~g~~G~~Ce~C~~G~~g~~~~~~~C~~C~C~~~gs~~~~C~~~tG~ 511 (525)
T 4aqs_A 433 EDPYGCKSCACNPLGTIPGGNPCDSETG-YCYCKRLVTGQRCDQCLPQHWGLSNDLDGCRPCDCDLGGALNNSCSEDSGQ 511 (525)
T ss_dssp TSTTSSEECCCCTTTBCCSSCCBCTTTC-CBCBCTTCCSTTTCC------------------------------------
T ss_pred CCCCCCccCCCCCCceecCCCcccCCCC-EEECCCCCcCCCcccCCCCccCCCCCCCCCcCCCCCCCCccCCccCCCCCe
Confidence 4888999988764 457888778 99999999999999999999986 349999999999999999999999
Q ss_pred cccCCCcccCCCcc
Q psy12394 330 CTCRNNFAGRTCDS 343 (1873)
Q Consensus 330 C~C~~G~~G~~Ce~ 343 (1873)
|.|++||+|.+||+
T Consensus 512 C~C~~G~~G~~Ceq 525 (525)
T 4aqs_A 512 CSCLPHMIGRQCNE 525 (525)
T ss_dssp --------------
T ss_pred eECCCCCcCCCCCC
Confidence 99999999999984
|
| >2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3tbd_A Netrin-G2, laminet-2; laminin N-terminal domain, domain VI, LE-domain, N neuronal cell adhesion molecule, netrin G ligand 2, nervous system; HET: NAG; 1.80A {Homo sapiens} PDB: 3zyg_A* 3zyi_B* | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >3tbd_A Netrin-G2, laminet-2; laminin N-terminal domain, domain VI, LE-domain, N neuronal cell adhesion molecule, netrin G ligand 2, nervous system; HET: NAG; 1.80A {Homo sapiens} PDB: 3zyg_A* 3zyi_B* | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A | Back alignment and structure |
|---|
| >3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ddu_A Reelin; beta-jelly-roll, signaling protein; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... | Back alignment and structure |
|---|
| >3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A | Back alignment and structure |
|---|
| >2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* | Back alignment and structure |
|---|
| >1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A | Back alignment and structure |
|---|
| >3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A | Back alignment and structure |
|---|
| >2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 1873 | ||||
| d1kloa2 | 56 | g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (M | 4e-10 | |
| d1kloa2 | 56 | g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (M | 8e-06 | |
| d1kloa2 | 56 | g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (M | 1e-05 | |
| d1kloa2 | 56 | g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (M | 4e-05 | |
| d1kloa2 | 56 | g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (M | 1e-04 | |
| d1kloa2 | 56 | g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (M | 7e-04 | |
| d1kloa2 | 56 | g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (M | 0.001 | |
| d1kloa2 | 56 | g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (M | 0.003 | |
| d1kloa2 | 56 | g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (M | 0.003 | |
| d1kloa3 | 51 | g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( | 6e-09 | |
| d1kloa3 | 51 | g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( | 4e-08 | |
| d1kloa3 | 51 | g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( | 7e-08 | |
| d1kloa3 | 51 | g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( | 8e-08 | |
| d1kloa3 | 51 | g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( | 1e-07 | |
| d1kloa3 | 51 | g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( | 2e-06 | |
| d1kloa3 | 51 | g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( | 2e-06 | |
| d1kloa3 | 51 | g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( | 4e-06 | |
| d1kloa3 | 51 | g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( | 6e-06 | |
| d1kloa3 | 51 | g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( | 2e-05 | |
| d1kloa3 | 51 | g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( | 2e-05 | |
| d1kloa3 | 51 | g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( | 3e-05 | |
| d1kloa3 | 51 | g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( | 7e-05 | |
| d1kloa3 | 51 | g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( | 7e-05 | |
| d1kloa3 | 51 | g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( | 4e-04 | |
| d1kloa3 | 51 | g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( | 4e-04 | |
| d1kloa3 | 51 | g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( | 0.001 | |
| d1kloa3 | 51 | g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( | 0.002 |
| >d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 56 | Back information, alignment and structure |
|---|
class: Small proteins fold: Knottins (small inhibitors, toxins, lectins) superfamily: EGF/Laminin family: Laminin-type module domain: Laminin gamma1 chain species: Mouse (Mus musculus) [TaxId: 10090]
Score = 54.9 bits (132), Expect = 4e-10
Identities = 21/54 (38%), Positives = 34/54 (62%)
Query: 1415 CECSGNINRTDPGSCDSVTGECTGCLFNSAGDSCQYCAPGYYGNAVSLKNCVKC 1468
C+C+ NI+ G+C+ +TGEC C++N+AG C C G++GN ++ KC
Sbjct: 1 CQCNDNIDPNAVGNCNRLTGECLKCIYNTAGFYCDRCKEGFFGNPLAPNPADKC 54
|
| >d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 56 | Back information, alignment and structure |
|---|
| >d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 56 | Back information, alignment and structure |
|---|
| >d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 56 | Back information, alignment and structure |
|---|
| >d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 56 | Back information, alignment and structure |
|---|
| >d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 56 | Back information, alignment and structure |
|---|
| >d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 56 | Back information, alignment and structure |
|---|
| >d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 56 | Back information, alignment and structure |
|---|
| >d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 56 | Back information, alignment and structure |
|---|
| >d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 | Back information, alignment and structure |
|---|
| >d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 | Back information, alignment and structure |
|---|
| >d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 | Back information, alignment and structure |
|---|
| >d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 | Back information, alignment and structure |
|---|
| >d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 | Back information, alignment and structure |
|---|
| >d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 | Back information, alignment and structure |
|---|
| >d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 | Back information, alignment and structure |
|---|
| >d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 | Back information, alignment and structure |
|---|
| >d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 | Back information, alignment and structure |
|---|
| >d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 | Back information, alignment and structure |
|---|
| >d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 | Back information, alignment and structure |
|---|
| >d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 | Back information, alignment and structure |
|---|
| >d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 | Back information, alignment and structure |
|---|
| >d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 | Back information, alignment and structure |
|---|
| >d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 | Back information, alignment and structure |
|---|
| >d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 | Back information, alignment and structure |
|---|
| >d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 | Back information, alignment and structure |
|---|
| >d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1873 | |||
| d1kloa3 | 51 | Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: | 98.81 | |
| d1kloa2 | 56 | Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: | 98.77 | |
| d1kloa2 | 56 | Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: | 98.54 | |
| d1kloa3 | 51 | Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: | 98.53 | |
| d1kloa1 | 55 | Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: | 98.05 | |
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 97.72 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 97.68 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 97.65 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 97.65 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 97.64 | |
| d1kloa1 | 55 | Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: | 97.42 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 97.18 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 97.18 | |
| d1tpga1 | 41 | Plasminogen activator (tissue-type), t-PA {Human ( | 97.18 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 97.18 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 97.15 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 97.1 | |
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 96.99 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 96.9 | |
| d1q4ga2 | 42 | Prostaglandin H2 synthase-1, EGF-like module {Shee | 96.74 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 96.72 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 96.71 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 96.61 | |
| d1tpga1 | 41 | Plasminogen activator (tissue-type), t-PA {Human ( | 96.58 | |
| d1cvua2 | 41 | Prostaglandin H2 synthase-1, EGF-like module {Mous | 96.49 | |
| d3egfa_ | 53 | Epidermal growth factor, EGF {Mouse (Mus musculus) | 96.32 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 96.32 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 96.26 | |
| d1haea_ | 63 | Heregulin-alpha, EGF-like domain {Human (Homo sapi | 96.01 | |
| d1nqlb_ | 48 | Epidermal growth factor, EGF {Human (Homo sapiens) | 95.87 | |
| d3egfa_ | 53 | Epidermal growth factor, EGF {Mouse (Mus musculus) | 95.69 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 95.6 | |
| d1nqlb_ | 48 | Epidermal growth factor, EGF {Human (Homo sapiens) | 95.35 | |
| d1haea_ | 63 | Heregulin-alpha, EGF-like domain {Human (Homo sapi | 95.02 | |
| d1q4ga2 | 42 | Prostaglandin H2 synthase-1, EGF-like module {Shee | 94.95 | |
| d1cvua2 | 41 | Prostaglandin H2 synthase-1, EGF-like module {Mous | 94.19 | |
| d2i9aa1 | 40 | Plasminogen activator (urokinase-type) {Human (Hom | 92.82 | |
| d2i9aa1 | 40 | Plasminogen activator (urokinase-type) {Human (Hom | 92.42 | |
| d1k36a_ | 46 | Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI | 90.63 | |
| d1k36a_ | 46 | Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI | 90.27 | |
| d1ioxa_ | 50 | Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] | 89.86 | |
| d1ioxa_ | 50 | Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] | 87.55 | |
| d1moxc_ | 49 | Transforming growth factor alpha {Human (Homo sapi | 87.2 | |
| d1moxc_ | 49 | Transforming growth factor alpha {Human (Homo sapi | 86.21 |
| >d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Knottins (small inhibitors, toxins, lectins) superfamily: EGF/Laminin family: Laminin-type module domain: Laminin gamma1 chain species: Mouse (Mus musculus) [TaxId: 10090]
Probab=98.81 E-value=6.9e-10 Score=93.36 Aligned_cols=48 Identities=29% Similarity=0.845 Sum_probs=42.0
Q ss_pred ccCCCCCCC-CCCcccCCCceeeccCCcccCCCcccCCCcccCCCCCCc
Q psy12394 1292 CNCHPHGVN-GTQQCDLFDGSCSCKENIVGRTCDHCVEGHWSFPYCVPC 1339 (1873)
Q Consensus 1292 C~C~~~gs~-~~~~C~~~~G~C~C~~~~~G~~C~~C~~G~~g~p~C~~C 1339 (1873)
|+|++.|+. ....||+.+|||.||++|+|++||+|++|||+++.+..|
T Consensus 1 C~C~~~Gs~~~~~~Cd~~tGqC~Ck~~v~G~~Cd~C~~g~~~~~~~~gC 49 (51)
T d1kloa3 1 CACNPYGTVQQQSSCNPVTGQCQCLPHVSGRDCGTCDPGYYNLQSGQGC 49 (51)
T ss_dssp CCCCTTTBGGGCCCCCTTTCCCCBCTTEESTTCCEECTTCBCGGGSSCC
T ss_pred CcCCCCcccCCCCccCCCCCeecCCCCCcCCCcccccccccCCCCCCCC
Confidence 789999974 234799999999999999999999999999999876654
|
| >d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|