Psyllid ID: psy12394


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400------1410------1420------1430------1440------1450------1460------1470------1480------1490------1500------1510------1520------1530------1540------1550------1560------1570------1580------1590------1600------1610------1620------1630------1640------1650------1660------1670------1680------1690------1700------1710------1720------1730------1740------1750------1760------1770------1780------1790------1800------1810------1820------1830------1840------1850------1860------1870---
MGNSPRPAVWALERSADNGITISLLDHRPSMKNFFNSTRLQEWTRATNVRLRLLRTKNLLGHLMSMADQDPTTTRRYFYSIKDISIGGRCRCNGHADVCDILDPEDPYHRICRCQHNTCGHNCEVCCPGYEQKAWRQSQSNKPFSCEPCNCHGHADKCVYDPMVDEKRLSVDIQGNYEGGGVCQECRDNTEGINCHQRVAGYYRPYGKHLNETDVCQPCQCAFHYATGNCAEGTGKCECRPEYTKPDCNSCAFGYFGYPNCEPCKCHMNGTLDFYCEPASGQQCPCKENYAGDHCDTCAQGYYNFPTCSPCECNAVGSLSDLCEVDSGNCTCRNNFAGRTCDSCADGYYNYPRCTSCQCAFHYATGNCAEGTGKCECRPEYTKPDCNSCAFGYFGYPNCEPCKCHMNGTLDFYCEPASGQQCPCKENYAGDHCDTCAQGYYNFPTCSQITLPDVPVIRVLMATITTHAVLLVNVTRLVLCLTCVKLILAIVRAEITLPDVPVIRVLMATITTHAVLFVIVTSEVQRLVSVIKPMDHVYVRKDTRALAVTNARQVCNCDIRGTEAGICDKTNGSCLCKEGYTGARCDQCKAGYYGYPDCKLCGCSAVGSSSTACDVSGKCPCLVNFGGKTCSQCSPGFYQYPQCKACNCDSHGNIGVSCDDDGKCQCEKNFGGDRCERCKEGLYNFPICEACNCDSHGNIGVSCDDDGKCQCEKNFGGDRCERCKEGLYNFPICEECNCNPEGVLKTFAGCGSLPAGELCECKPKVQGRICDECRPLYWNLKASNPDGCEDCDCYTLGTIGGIKNCNPKSGQCVCKATAMNRKCDACMDGTYALQDNNLFGCTECACDIGGSINNLCNKDLSALNSEELPLLNKDQPKLRFDMRITKPGPHVLVLSYVTPGPHTQDSAVIQLEASSQTTVERGNVRLHDCPYTTPCRATVLDKQGKVSVFEFDTNYISVELTADENPTNNASAAIQKIVAIPEAKWSMDHIQPKTECVRKDGQCVQAMFPTSPETKKIEAESGLGPLATQLPGSLADNKTGLVYLDHKDAMVDIAGTVNNPGAYVFVVHFYQPDFPEFDMDVLIQNGQFYEAQLPVKHCPARSGCRAVVQQTNGNRMFTLEKNIVATFKEPNHKSVWLDYILLIPANEFNENIINELPYSRAKEFIDVCGKNHFYLDNSTSEFCKKATFSMTISFLHEALPCQCDIDGSKSFECEQFGGQCQCKPNVIGRRCEMCATGYYGFPDCHPCNCPFTAVCDSYTGECICAARVIGKKCDQCEPNTFGYDPIIGCEECNCHPHGVNGTQQCDLFDGSCSCKENIVGRTCDHCVEGHWSFPYCVPCECDLRGTTIDICNQGTAECYCKKNVYGAACDVCKEGTFDIQADNVDGCTRCFCFGKTTKCSSSNLYRSQLVYCKPCECSGNINRTDPGSCDSVTGECTGCLFNSAGDSCQYCAPGYYGNAVSLKNCVKCNCNPEGVLKTFAGCGSLPAGELCECKPKVQGRICDECRPLYWNLKASNPDGCEDCDCYTLGTIGGIKNCNPKSGQCVCKATAMNRKCDACVDGTYALQDNNLFGCTECACDIGGSINNLCNKSLIWMSSFRMVSFTKLSSQSNIVLPGLVVEQFLNLCPTEFDMDVLIQNGQFYEAQLPDCQHNTLGDQCEQCQPGYHGNATQGTMADCLICACPLPITSNNFASGCDVSEDGCHMNGTLNFYCEPTSGQQCPCKENYAGDHCDTCAQACNCHGHADKCVYDPMVDEKRLSVDIQGNYEGGGVCQECRDNTEGINCHQCVAGYYRPYGKHLNETDVCQRQCLCQPRVTGQTCNQPLQAHYYPTLHHYQFEIEDGHTPAFSPSEIIQEVNIQEPSIYQLILFIFIY
ccccccccccEEcccccccEEEEccccccccccccccHHHHHHHHHHcEEEccccccccccccccccccccccccEEEEEEEccEEEEcccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccEEcEEEEccccccccccccccEEEcccccccccccccccccccccccccccEEEEccccccccccccccccccEEcccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccEEEEEcccccccccccEEccccccccccEEEEccccccEEEEEccccccEEEEEEcccccccccccEEEEEEEcccccccccccccEEEEEccccEEEcccccccccEEEEccccccccccccccccccccccEEEEcccccEEEEEccccccccEEEEEEEccccccccccEEEEEcccEEEccccccccccccccccEEEEccccEEEcccccEEEEEcccccccEEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccEEEEEEEEEEc
cccccccccccEccccccEEEEEEcccccccccccccHHHHHHHHHHEEEEEEHHHccccccccccccccccEEEEEEEEEEEEEEccEcccccccccccccccccccccEEEcccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccHcccccccccccccccccccccccccccccccccEcccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEccccccccccHcccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccEEEccccccccccHcccccccccccccccccccccccccccccccEEEccccccccccHccccccccccccccccccccccccccccccccccccEEEccccccccccHcccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccEEEEccccccccccccccEcccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccHccccccccccccccccccccccccccccccccccccccccEEEccccccccccHcccccccccccccccccccccccccccccccccccccccEEEccccccccccHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccHccccccccccccccccccccccccEcccccccccccccccccccccccccEEEEccccccccccEEEEEccccccccEEEEEEEEEEc
MGNSPRPAVWALERsadngitislldhrpsmknffnstrlQEWTRATNVRLRLLRTKNLLGHlmsmadqdptttrryfysikdisiggrcrcnghadvcdildpedpyhricrcqhntcghncevccpgyeqkawrqsqsnkpfscepcnchghadkcvydpmvdekrlsvdiqgnyegggvcqecrdnteginchqrvagyyrpygkhlnetdvcqpcqcafhyatgncaegtgkcecrpeytkpdcnscafgyfgypncepckchmngtldfycepasgqqcpckenyagdhcdtcaqgyynfptcspcecnavgslsdlcevdsgnctcrnnfagrtcdscadgyynyprctscqcafhyatgncaegtgkcecrpeytkpdcnscafgyfgypncepckchmngtldfycepasgqqcpckenyagdhcdtcaqgyynfptcsqitlpdvpVIRVLMATITTHAVLLVNVTRLVLCLTCVKLILAIVRAeitlpdvpVIRVLMATITTHAVLFVIVTSEVQRLVSVIkpmdhvyvrkdtrALAVTNARQvcncdirgteagicdktngsclckegytgarcdqckagyygypdcklcgcsavgssstacdvsgkcpclvnfggktcsqcspgfyqypqckacncdshgnigvscdddgkcqceknfggdrcerckeglynfpiceacncdshgnigvscdddgkcqceknfggdrcerckeglynfpiceecncnpegvlktfagcgslpagelceckpkvqgricdecrplywnlkasnpdgcedcdcytlgtiggikncnpksgqcvckatamnrkcdacmdgtyalqdnnlfgctecacdiggsinnlcnkdlsalnseelpllnkdqpklrfdmritkpgphvlvlsyvtpgphtqdsaVIQLEAssqttvergnvrlhdcpyttpcratvldkqgkvsvfefdtNYISVEltadenptnnaSAAIQKIVAipeakwsmdhiqpktecvrkdgqcvqamfptspetkkieaesglgplatqlpgsladnktglvyldHKDAMVDIagtvnnpgAYVFVVHFyqpdfpefdmdVLIQNgqfyeaqlpvkhcparsgcraVVQQTNGNRMFTLEKNIVAtfkepnhksvWLDYILLIpanefneniinelpysrAKEFIDVcgknhfyldnstsefckKATFSMTISFLHealpcqcdidgsksfeceqfggqcqckpnvigrrcemcatgyygfpdchpcncpftavcdsytgECICAARvigkkcdqcepntfgydpiigceecnchphgvngtqqcdlfdgscsckenivgrtcdhcveghwsfpycvpcecdlrgttidicnqgtaecyckknvygaacdvckegtfdiqadnvdgctrcfcfgkttkcsssnlyrsqlvyckpcecsgninrtdpgscdsvtgectgclfnsagdscqycapgyygnavslkncvkcncnpegvlktfagcgslpagelceckpkvqgricdecrplywnlkasnpdgcedcdcytlgtiggikncnpksgqcvckatamnrkcdacvdgtyalqdnnlfgctecacdiggsinnLCNKSLIWMSSFRMVSFTKlssqsnivlpglVVEQFLnlcptefdMDVLIQNgqfyeaqlpdcqhntlgdqceqcqpgyhgnatqgtmadclicacplpitsnnfasgcdvsedgchmngtlnfyceptsgqqcpckenyagdhcdtcaqacnchghadkcvydpmvdekrlsvdiqgnyegggvcqecrdnteginchqcvagyyrpygkhlnetdvcqrqclcqprvtgqtcnqplqahyyptlhhyqfeiedghtpafspseiiqevniqepsiYQLILFIFIY
MGNSPRPAVWALERSADNGITISLLDHRPSMKNffnstrlqewtraTNVRLRLLRTKNLlghlmsmadqdptttRRYFYSIKDISIGGRCRCNGHADVCDILDPEDPYHRICRCQHNTCGHNCEVCCPGYEQKAWRQSQSNKPFSCEPCNCHGHADKCVYDPMVDEKRLSVDIQGNYEGGGVCQECRDNTEGINCHQRVAGYYRPYGKHLNETDVCQPCQCAFHYATGNCAEGTGKCECRPEYTKPDCNSCAFGYFGYPNCEPCKCHMNGTLDFYCEPASGQQCPCKENYAGDHCDTCAQGYYNFPTCSPCECNAVGSLSDLCEVDSGNCTCRNNFAGRTCDSCADGYYNYPRCTSCQCAFHYATGNCAEGTGKCECRPEYTKPDCNSCAFGYFGYPNCEPCKCHMNGTLDFYCEPASGQQCPCKENYAGDHCDTCAQGYYNFPTCSQITLPDVPVIRVLMATITTHAVLLVNVTRLVLCLTCVKLILAIVraeitlpdvPVIRVLMATITTHAVLFVIVTSEVQRLVSvikpmdhvyvrkdtralavtnarqvcncdirgteagicdktngscLCKEGYTGARCDQCKAGYYGYPDCKLCGCSAVGSSSTACDVSGKCPCLVNFGGKTCSQCSPGFYQYPQCKACNCDSHGNIGVSCDDDGKCQCEKNFGGDRCERCKEGLYNFPICEACNCDSHGNIGVSCDDDGKCQCEKNFGGDRCERCKEGLYNFPICEECNCNPEGVLKTFAGCGSLPAGELCECKPKVQGRICDECRPLYWNLKASNPDGCEDCDCYTLGTIGGIKNCNPKSGQCVCKATAMNRKCDACMDGTYALQDNNLFGCTECACDIGGSINNLCNKDLSALNSEELPLLNKDQPKLRFDMRITKPGPHVLVLSYVTPGPHTQDSAVIQLEASSQTTVERGNVRLHDCPYTTPCRATVLDKQGKVSVFEFDTNYISVEltadenptnnASAAIQKIVAIPEAKWSMDHIQPKTECVRKDGQCVQAMFPTSPETKKIEAESGLGPLATQLPGSLADNKTGLVYLDHKDAMVDIAGTVNNPGAYVFVVHFYQPDFPEFDMDVLIQNGQFYEAQLPVKHCPARSGCRAVVQQTNGNRMFTLEKNIVATFKEPNHKSVWLDYILLIPANEFNENIINELPYSRAKEFIDVCGKNHFYLDNSTSEFCKKATFSMTISFLHEALPCQCDIDGSKSFECEQFGGQCQCKPNVIGRRCEMCATGYYGFPDCHPCNCPFTAVCDSYTGECICAARVigkkcdqcePNTFGYDPIIGCEECNCHPHGVNGTQQCDLFDGSCSCKENIVGRTCDHCVEGHWSFPYCVPCECDLRGTTIDICNQGTAECYCKKNVYGAACDVCKEGTFDIQADNVDGCTRCFCFGkttkcsssnlyrSQLVYCKPCECSGNINRTDPGSCDSVTGECTGCLFNSAGDSCQYCAPGYYGNAVSLKNCVKCNCNPEGVLKTFAGCGSLPAGELCECKPKVQGRICDECRPLYWNLKASNPDGCEDCDCYTLGTIGGIKNCNPKSGQCVCKATAMNRKCDACVDGTYALQDNNLFGCTECACDIGGSINNLCNKSLIWMSSFRMVSFTKLSSQSNIVLPGLVVEQFLNLCPTEFDMDVLIQNGQFYEAQLPDCQHNTLGDQCEQCQPGYHGNATQGTMADCLICACPLPITSNNFASGCDVSEDGCHMNGTLNFYCEPTSGQQCPCKENYAGDHCDTCAQACNCHGHADKCVYDPMVDEKRLSVDIQGNYEGGGVCQECRDNTEGINCHQCVAGYYRPYGKHLNETDVCQRQCLCQPRVTGQTCNQPLQAHYYPTLHHYQFEIEDGHTPAFSPSEIIQEVNIQEPSIYQLILFIFIY
MGNSPRPAVWALERSADNGITISLLDHRPSMKNFFNSTRLQEWTRATNVRLRLLRTKNLLGHLMSMADQDPTTTRRYFYSIKDISIGGRCRCNGHADVCDILDPEDPYHRICRCQHNTCGHNCEVCCPGYEQKAWRQSQSNKPFSCEPCNCHGHADKCVYDPMVDEKRLSVDIQGNYEGGGVCQECRDNTEGINCHQRVAGYYRPYGKHLNETDVCQPCQCAFHYATGNCAEGTGKCECRPEYTKPDCNSCAFGYFGYPNCEPCKCHMNGTLDFYCEPASGQQCPCKENYAGDHCDTCAQGYYNFPTCSPCECNAVGSLSDLCEVDSGNCTCRNNFAGRTCDSCADGYYNYPRCTSCQCAFHYATGNCAEGTGKCECRPEYTKPDCNSCAFGYFGYPNCEPCKCHMNGTLDFYCEPASGQQCPCKENYAGDHCDTCAQGYYNFPTCSQITLPDVPVIRVLMATITTHAVLLVNVTRLVLCLTCVKLILAIVRAEITLPDVPVIRVLMATITTHAVLFVIVTSEVQRLVSVIKPMDHVYVRKDTRALAVTNARQVCNCDIRGTEAGICDKTNGSCLCKEGYTGARCDQCKAGYYGYPDCKLCGCSAVGSSSTACDVSGKCPCLVNFGGKTCSQCSPGFYQYPQCKACNCDSHGNIGVSCDDDGKCQCEKNFGGDRCERCKEGLYNFPICEACNCDSHGNIGVSCDDDGKCQCEKNFGGDRCERCKEGLYNFPICEECNCNPEGVLKTFAGCGSLPAGELCECKPKVQGRICDECRPLYWNLKASNPDGCEDCDCYTLGTIGGIKNCNPKSGQCVCKATAMNRKCDACMDGTYALQDNNLFGCTECACDIGGSINNLCNKDLSALNSEELPLLNKDQPKLRFDMRITKPGPHVLVLSYVTPGPHTQDSAVIQLEASSQTTVERGNVRLHDCPYTTPCRATVLDKQGKVSVFEFDTNYISVELTADENPTNNASAAIQKIVAIPEAKWSMDHIQPKTECVRKDGQCVQAMFPTSPETKKIEAESGLGPLATQLPGSLADNKTGLVYLDHKDAMVDIAGTVNNPGAYVFVVHFYQPDFPEFDMDVLIQNGQFYEAQLPVKHCPARSGCRAVVQQTNGNRMFTLEKNIVATFKEPNHKSVWLDYILLIPANEFNENIINELPYSRAKEFIDVCGKNHFYLDNSTSEFCKKATFSMTISFLHEALPCQCDIDGSKSFECEQFGGQCQCKPNVIGRRCEMCATGYYGFPDCHPCNCPFTAVCDSYTGECICAARVIGKKCDQCEPNTFGYDPIIGCEECNCHPHGVNGTQQCDLFDGSCSCKENIVGRTCDHCVEGHWSFPYCVPCECDLRGTTIDICNQGTAECYCKKNVYGAACDVCKEGTFDIQADNVDGCTRCFCFGKTTKCSSSNLYRSQLVYCKPCECSGNINRTDPGSCDSVTGECTGCLFNSAGDSCQYCAPGYYGNAVSLKNCVKCNCNPEGVLKTFAGCGSLPAGELCECKPKVQGRICDECRPLYWNLKASNPDGCEDCDCYTLGTIGGIKNCNPKSGQCVCKATAMNRKCDACVDGTYALQDNNLFGCTECACDIGGSINNLCNKSLIWMSSFRMVSFTKLSSQSNIVLPGLVVEQFLNLCPTEFDMDVLIQNGQFYEAQLPDCQHNTLGDQCEQCQPGYHGNATQGTMADCLICACPLPITSNNFASGCDVSEDGCHMNGTLNFYCEPTSGQQCPCKENYAGDHCDTCAQACNCHGHADKCVYDPMVDEKRLSVDIQGNYEGGGVCQECRDNTEGINCHQCVAGYYRPYGKHLNETDVCQRQCLCQPRVTGQTCNQPLQAHYYPTLHHYQFEIEDGHTPAFSPSEIIQEVNIQEPSIYQLILFIFIY
********VWALERSADNGITISLLDHRPSMKNFFNSTRLQEWTRATNVRLRLLRTKNLLGHLMSMADQDPTTTRRYFYSIKDISIGGRCRCNGHADVCDILDPEDPYHRICRCQHNTCGHNCEVCCPGYEQKAWRQS**NKPFSCEPCNCHGHADKCVYDPMVDEKRLSVDIQGNYEGGGVCQECRDNTEGINCHQRVAGYYRPYGKHLNETDVCQPCQCAFHYATGNCAEGTGKCECRPEYTKPDCNSCAFGYFGYPNCEPCKCHMNGTLDFYCEPASGQQCPCKENYAGDHCDTCAQGYYNFPTCSPCECNAVGSLSDLCEVDSGNCTCRNNFAGRTCDSCADGYYNYPRCTSCQCAFHYATGNCAEGTGKCECRPEYTKPDCNSCAFGYFGYPNCEPCKCHMNGTLDFYCEPASGQQCPCKENYAGDHCDTCAQGYYNFPTCSQITLPDVPVIRVLMATITTHAVLLVNVTRLVLCLTCVKLILAIVRAEITLPDVPVIRVLMATITTHAVLFVIVTSEVQRLVSVIKPMDHVYVRKDTRALAVTNARQVCNCDIRGTEAGICDKTNGSCLCKEGYTGARCDQCKAGYYGYPDCKLCGCSAVGSSSTACDVSGKCPCLVNFGGKTCSQCSPGFYQYPQCKACNCDSHGNIGVSCDDDGKCQCEKNFGGDRCERCKEGLYNFPICEACNCDSHGNIGVSCDDDGKCQCEKNFGGDRCERCKEGLYNFPICEECNCNPEGVLKTFAGCGSLPAGELCECKPKVQGRICDECRPLYWNLKASNPDGCEDCDCYTLGTIGGIKNCNPKSGQCVCKATAMNRKCDACMDGTYALQDNNLFGCTECACDIGGSINNLCNKDLSALNS**LPLL*****KLRFDMRITKPGPHVLVLSYVTPGPH****AVIQL******TVERGNVRLHDCPYTTPCRATVLDKQGKVSVFEFDTNYISVELTADE****NASAAIQKIVAIPEAKWSMDHIQPKTECVRKDGQCVQA***************************LADNKTGLVYLDHKDAMVDIAGTVNNPGAYVFVVHFYQPDFPEFDMDVLIQNGQFYEAQLPVKHCPARSGCRAVVQQTNGNRMFTLEKNIVATFKEPNHKSVWLDYILLIPANEFNENIINELPYSRAKEFIDVCGKNHFYLDNSTSEFCKKATFSMTISFLHEALPCQCDIDGSKSFECEQFGGQCQCKPNVIGRRCEMCATGYYGFPDCHPCNCPFTAVCDSYTGECICAARVIGKKCDQCEPNTFGYDPIIGCEECNCHPHGVNGTQQCDLFDGSCSCKENIVGRTCDHCVEGHWSFPYCVPCECDLRGTTIDICNQGTAECYCKKNVYGAACDVCKEGTFDIQADNVDGCTRCFCFGKTTKCSSSNLYRSQLVYCKPCECSGNINRTDPGSCDSVTGECTGCLFNSAGDSCQYCAPGYYGNAVSLKNCVKCNCNPEGVLKTFAGCGSLPAGELCECKPKVQGRICDECRPLYWNLKASNPDGCEDCDCYTLGTIGGIKNCNPKSGQCVCKATAMNRKCDACVDGTYALQDNNLFGCTECACDIGGSINNLCNKSLIWMSSFRMVSFTKLSSQSNIVLPGLVVEQFLNLCPTEFDMDVLIQNGQFYEAQLPDCQHNTLGDQCEQCQPGYHGNATQGTMADCLICACPLPITSNNFASGCDVSEDGCHMNGTLNFYCEPTSGQQCPCKENYAGDHCDTCAQACNCHGHADKCVYDPMVDEKRLSVDIQGNYEGGGVCQECRDNTEGINCHQCVAGYYRPYGKHLNETDVCQRQCLCQPRVTGQTCNQPLQAHYYPTLHHYQFEIEDGHTPAFSPSEIIQEVNIQEPSIYQLILFIFI*
MGNSPRPAVWALERSADNGITISLLDHRPSMKNFFNSTRLQEWTRATNVRLRLLRTKNLLGHLMSMADQDPTTTRRYFYSIKDISIGGRCRCNGHADVCDILDPEDPYHRICRCQHNTCGHNCEVCCPGYEQKAWRQSQSNKPFSCEPCNCHGHADKCVYDPMVDEKRLSVDIQGNYEGGGVCQECRDNTEGINCHQRVAGYYRPYGKHLNETDVCQPCQCAFHYATGNCAEGTGKCECRPEYTKPDCNSCAFGYFGYPNCEPCKCHMNGTLDFYCEPASGQQCPCKENYAGDHCDTCAQGYYNFPTCSPCECNAVGSLSDLCEVDSGNCTCRNNFAGRTCDSCADGYYNYPRCTSCQCAFHYATGNCAEGTGKCECRPEYTKPDCNSCAFGYFGYPNCEPCKCHMNGTLDFYCEPASGQQCPCKENYAGDHCDTCAQGYYNFPTCSQITLPDVPVIRVLMATITTHAVLLVNVTRLVLCLTCVKLILAIVRAEITLPDVPVIRVLMATITTHAVLFVIVTSEVQRLVSVIKPMDHVYVRKDTRALAVTNARQVCNCDIRGTEAGICDKTNGSCLCKEGYTGARCDQCKAGYYGYPDCKLCGCSAVGSSSTACDVSGKCPCLVNFGGKTCSQCSPGFYQYPQCKACNCDSHGNIGVSCDDDGKCQCEKNFGGDRCERCKEGLYNFPICEACNCDSHGNIGVSCDDDGKCQCEKNFGGDRCERCKEGLYNFPICEECNCNPEGVLKTFAGCGSLPAGELCECKPKVQGRICDECRPLYWNLKASNPDGCEDCDCYTLGTIGGIKNCNPKSGQCVCKATAMNRKCDACMDGTYALQDNNLFGCTECACDIGGSINNLCNKDLSALNSEELPLLNKDQPKLRFDMRITKPGPHVLVLSYVTPGPHTQDSAVIQLEASSQTTVERGNVRLHDCPYTTPCRATVLDKQGKVSVFEFDTNYISVELTADENPTNNASAAIQKIVAIPEAKWSMDHIQPKTECVRKDGQCVQAMFPTSPETKKIEAESGLGPLATQLPGSLADNKTGLVYLDHKDAMVDIAGTVNNPGAYVFVVHFYQPDFPEFDMDVLIQNGQFYEAQLPVKHCPARSGCRAVVQQTNGNRMFTLEKNIVATFKEPNHKSVWLDYILLIPANEFNENIINELPYSRAKEFIDVCGKNHFYLDNSTSEFCKKATFSMTISFLHEALPCQCDIDGSKSFECEQFGGQCQCKPNVIGRRCEMCATGYYGFPDCHPCNCPFTAVCDSYTGECICAARVIGKKCDQCEPNTFGYDPIIGCEECNCHPHGVNGTQQCDLFDGSCSCKENIVGRTCDHCVEGHWSFPYCVPCECDLRGTTIDICNQGTAECYCKKNVYGAACDVCKEGTFDIQADNVDGCTRCFCFGKTTKCSSSNLYRSQLVYCKPCECSGNINRTDPGSCDSVTGECTGCLFNSAGDSCQYCAPGYYGNAVSLKNCVKCNCNPEGVLKTFAGCGSLPAGELCECKPKVQGRICDECRPLYWNLKASNPDGCEDCDCYTLGTIGGIKNCNPKSGQCVCKATAMNRKCDACVDGTYALQDNNLFGCTECACDIGGSINNLCNKSLIWMSSFRMVSFTKLSSQSNIVLPGLVVEQFLNLCPTEFDMDVLIQNGQFYEAQLPDCQHNTLGDQCEQCQPGYHGNATQGTMADCLICACPLPITSNNFASGCDVSEDGCHMNGTLNFYCEPTSGQQCPCKENYAGDHCDTCAQACNCHGHADKCVYDPMVDEKRLSVDIQGNYEGGGVCQECRDNTEGINCHQCVAGYYRPYGKHLNETDVCQRQCLCQPRVTGQTCNQPLQAHYYPTLHHYQFEIEDGHTPAFSPSEIIQEVNIQEPSIYQLILFIFIY
********VWALERSADNGITISLLDHRPSMKNFFNSTRLQEWTRATNVRLRLLRTKNLLGHLMSMADQDPTTTRRYFYSIKDISIGGRCRCNGHADVCDILDPEDPYHRICRCQHNTCGHNCEVCCPGYEQKAWRQSQSNKPFSCEPCNCHGHADKCVYDPMVDEKRLSVDIQGNYEGGGVCQECRDNTEGINCHQRVAGYYRPYGKHLNETDVCQPCQCAFHYATGNCAEGTGKCECRPEYTKPDCNSCAFGYFGYPNCEPCKCHMNGTLDFYCEPASGQQCPCKENYAGDHCDTCAQGYYNFPTCSPCECNAVGSLSDLCEVDSGNCTCRNNFAGRTCDSCADGYYNYPRCTSCQCAFHYATGNCAEGTGKCECRPEYTKPDCNSCAFGYFGYPNCEPCKCHMNGTLDFYCEPASGQQCPCKENYAGDHCDTCAQGYYNFPTCSQITLPDVPVIRVLMATITTHAVLLVNVTRLVLCLTCVKLILAIVRAEITLPDVPVIRVLMATITTHAVLFVIVTSEVQRLVSVIKPMDHVYVRKDTRALAVTNARQVCNCDIRGTEAGICDKTNGSCLCKEGYTGARCDQCKAGYYGYPDCKLCGCSA*********VSGKCPCLVNFGGKTCSQCSPGFYQYPQCKACNCDSHGNIGVSCDDDGKCQCEKNFGGDRCERCKEGLYNFPICEACNCDSHGNIGVSCDDDGKCQCEKNFGGDRCERCKEGLYNFPICEECNCNPEGVLKTFAGCGSLPAGELCECKPKVQGRICDECRPLYWNLKASNPDGCEDCDCYTLGTIGGIKNCNPKSGQCVCKATAMNRKCDACMDGTYALQDNNLFGCTECACDIGGSINNLCNKDLSALNSEELPLLNKDQPKLRFDMRITKPGPHVLVLSYVTPGPHTQDSAVIQLEASSQTTVERGNVRLHDCPYTTPCRATVLDKQGKVSVFEFDTNYISVELTADENPTNNASAAIQKIVAIPEAKWSMDHIQPKTECVRKDGQCVQAMFPTSPETKKIEAESGLGPLATQLPGSLADNKTGLVYLDHKDAMVDIAGTVNNPGAYVFVVHFYQPDFPEFDMDVLIQNGQFYEAQLPVKHCPARSGCRAVVQQTNGNRMFTLEKNIVATFKEPNHKSVWLDYILLIPANEFNENIINELPYSRAKEFIDVCGKNHFYLDNSTSEFCKKATFSMTISFLHEALPCQCDIDGSKSFECEQFGGQCQCKPNVIGRRCEMCATGYYGFPDCHPCNCPFTAVCDSYTGECICAARVIGKKCDQCEPNTFGYDPIIGCEECNCHPHGVNGTQQCDLFDGSCSCKENIVGRTCDHCVEGHWSFPYCVPCECDLRGTTIDICNQGTAECYCKKNVYGAACDVCKEGTFDIQADNVDGCTRCFCFGKTTKCSSSNLYRSQLVYCKPCECSGNINRTDPGSCDSVTGECTGCLFNSAGDSCQYCAPGYYGNAVSLKNCVKCNCNPEGVLKTFAGCGSLPAGELCECKPKVQGRICDECRPLYWNLKASNPDGCEDCDCYTLGTIGGIKNCNPKSGQCVCKATAMNRKCDACVDGTYALQDNNLFGCTECACDIGGSINNLCNKSLIWMSSFRMVSFTKLSSQSNIVLPGLVVEQFLNLCPTEFDMDVLIQNGQFYEAQLPDCQHNTLGDQCEQCQPGYHGNATQGTMADCLICACPLPITSNNFASGCDVSEDGCHMNGTLNFYCEPTSGQQCPCKENYAGDHCDTCAQACNCHGHADKCVYDPMVDEKRLSVDIQGNYEGGGVCQECRDNTEGINCHQCVAGYYRPYGKHLNETDVCQRQCLCQPRVTGQTCNQPLQAHYYPTLHHYQFEIEDGHTPAFSPSEIIQEVNIQEPSIYQLILFIFIY
********VWALERSADNGITISLLDHRPSMKNFFNSTRLQEWTRATNVRLRLLRTKNLLGHLMSMADQDPTTTRRYFYSIKDISIGGRCRCNGHADVCDILDPEDPYHRICRCQHNTCGHNCEVCCPGYEQKAWRQSQSNKPFSCEPCNCHGHADKCVYDPMVDEKRLSVDIQGNYEGGGVCQECRDNTEGINCHQRVAGYYRPYGKHLNETDVCQPCQCAFHYATGNCAEGTGKCECRPEYTKPDCNSCAFGYFGYPNCEPCKCHMNGTLDFYCEPASGQQCPCKENYAGDHCDTCAQGYYNFPTCSPCECNAVGSLSDLCEVDSGNCTCRNNFAGRTCDSCADGYYNYPRCTSCQCAFHYATGNCAEGTGKCECRPEYTKPDCNSCAFGYFGYPNCEPCKCHMNGTLDFYCEPASGQQCPCKENYAGDHCDTCAQGYYNFPTCSQITLPDVPVIRVLMATITTHAVLLVNVTRLVLCLTCVKLILAIVRAEITLPDVPVIRVLMATITTHAVLFVIVTSEVQRLVSVIKPMDHVYVRKDTRALAVTNARQVCNCDIRGTEAGICDKTNGSCLCKEGYTGARCDQCKAGYYGYPDCKLCGCSAVGSSSTACDVSGKCPCLVNFGGKTCSQCSPGFYQYPQCKACNCDSHGNIGVSCDDDGKCQCEKNFGGDRCERCKEGLYNFPICEACNCDSHGNIGVSCDDDGKCQCEKNFGGDRCERCKEGLYNFPICEECNCNPEGVLKTFAGCGSLPAGELCECKPKVQGRICDECRPLYWNLKASNPDGCEDCDCYTLGTIGGIKNCNPKSGQCVCKATAMNRKCDACMDGTYALQDNNLFGCTECACDIGGSINNLCNKDLSALNSEELPLLNKDQPKLRFDMRITKPGPHVLVLSYVTPGPHTQDSAVIQLEASSQTTVERGNVRLHDCPYTTPCRATVLDKQGKVSVFEFDTNYISVELTADENPTNNASAAIQKIVAIPEAKWSMDHIQPKTECVRKDGQCVQAMFPTSPETKKIEAESGLGPLATQLPGSLADNKTGLVYLDHKDAMVDIAGTVNNPGAYVFVVHFYQPDFPEFDMDVLIQNGQFYEAQLPVKHCPARSGCRAVVQQTNGNRMFTLEKNIVATFKEPNHKSVWLDYILLIPANEFNENIINELPYSRAKEFIDVCGKNHFYLDNSTSEFCKKATFSMTISFLHEALPCQCDIDGSKSFECEQFGGQCQCKPNVIGRRCEMCATGYYGFPDCHPCNCPFTAVCDSYTGECICAARVIGKKCDQCEPNTFGYDPIIGCEECNCHPHGVNGTQQCDLFDGSCSCKENIVGRTCDHCVEGHWSFPYCVPCECDLRGTTIDICNQGTAECYCKKNVYGAACDVCKEGTFDIQADNVDGCTRCFCFGKTTKCSSSNLYRSQLVYCKPCECSGNINRTDPGSCDSVTGECTGCLFNSAGDSCQYCAPGYYGNAVSLKNCVKCNCNPEGVLKTFAGCGSLPAGELCECKPKVQGRICDECRPLYWNLKASNPDGCEDCDCYTLGTIGGIKNCNPKSGQCVCKATAMNRKCDACVDGTYALQDNNLFGCTECACDIGGSINNLCNKSLIWMSSFRMVSFTKLSSQSNIVLPGLVVEQFLNLCPTEFDMDVLIQNGQFYEAQLPDCQHNTLGDQCEQCQPGYHGNATQGTMADCLICACPLPITSNNFASGCDVSEDGCHMNGTLNFYCEPTSGQQCPCKENYAGDHCDTCAQACNCHGHADKCVYDPMVDEKRLSVDIQGNYEGGGVCQECRDNTEGINCHQCVAGYYRPYGKHLNETDVCQRQCLCQPRVTGQTCNQPLQAHYYPTLHHYQFEIEDGHTPAFSPSEIIQEVNIQEPSIYQLILFIFIY
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGNSPRPAVWALERSADNGITISLLDHRPSMKNFFNSTRLQEWTRATNVRLRLLRTKNLLGHLMSMADQDPTTTRRYFYSIKDISIGGRCRCNGHADVCDILDPEDPYHRICRCQHNTCGHNCEVCCPGYEQKAWRQSQSNKPFSCEPCNCHGHADKCVYDPMVDEKRLSVDIQGNYEGGGVCQECRDNTEGINCHQRVAGYYRPYGKHLNETDVCQPCQCAFHYATGNCAEGTGKCECRPEYTKPDCNSCAFGYFGYPNCEPCKCHMNGTLDFYCEPASGQQCPCKENYAGDHCDTCAQGYYNFPTCSPCECNAVGSLSDLCEVDSGNCTCRNNFAGRTCDSCADGYYNYPRCTSCQCAFHYATGNCAEGTGKCECRPEYTKPDCNSCAFGYFGYPNCEPCKCHMNGTLDFYCEPASGQQCPCKENYAGDHCDTCAQGYYNFPTCSQITLPDVPVIRVLMATITTHAVLLVNVTRLVLCLTCVKLILAIVRAEITLPDVPVIRVLMATITTHAVLFVIVTSEVQRLVSVIKPMDHVYVRKDTRALAVTNARQVCNCDIRGTEAGICDKTNGSCLCKEGYTGARCDQCKAGYYGYPDCKLCGCSAVGSSSTACDVSGKCPCLVNFGGKTCSQCSPGFYQYPQCKACNCDSHGNIGVSCDDDGKCQCEKNFGGDRCERCKEGLYNFPICEACNCDSHGNIGVSCDDDGKCQCEKNFGGDRCERCKEGLYNFPICEECNCNPEGVLKTFAGCGSLPAGELCECKPKVQGRICDECRPLYWNLKASNPDGCEDCDCYTLGTIGGIKNCNPKSGQCVCKATAMNRKCDACMDGTYALQDNNLFGCTECACDIGGSINNLCNKDLSALNSEELPLLNKDQPKLRFDMRITKPGPHVLVLSYVTPGPHTQDSAVIQLEASSQTTVERGNVRLHDCPYTTPCRATVLDKQGKVSVFEFDTNYISVELTADENPTNNASAAIQKIVAIPEAKWSMDHIQPKTECVRKDGQCVQAMFPTSPETKKIEAESGLGPLATQLPGSLADNKTGLVYLDHKDAMVDIAGTVNNPGAYVFVVHFYQPDFPEFDMDVLIQNGQFYEAQLPVKHCPARSGCRAVVQQTNGNRMFTLEKNIVATFKEPNHKSVWLDYILLIPANEFNENIINELPYSRAKEFIDVCGKNHFYLDNSTSEFCKKATFSMTISFLHEALPCQCDIDGSKSFECEQFGGQCQCKPNVIGRRCEMCATGYYGFPDCHPCNCPFTAVCDSYTGECICAARVIGKKCDQCEPNTFGYDPIIGCEECNCHPHGVNGTQQCDLFDGSCSCKENIVGRTCDHCVEGHWSFPYCVPCECDLRGTTIDICNQGTAECYCKKNVYGAACDVCKEGTFDIQADNVDGCTRCFCFGKTTKCSSSNLYRSQLVYCKPCECSGNINRTDPGSCDSVTGECTGCLFNSAGDSCQYCAPGYYGNAVSLKNCVKCNCNPEGVLKTFAGCGSLPAGELCECKPKVQGRICDECRPLYWNLKASNPDGCEDCDCYTLGTIGGIKNCNPKSGQCVCKATAMNRKCDACVDGTYALQDNNLFGCTECACDIGGSINNLCNKSLIWMSSFRMVSFTKLSSQSNIVLPGLVVEQFLNLCPTEFDMDVLIQNGQFYEAQLPDCQHNTLGDQCEQCQPGYHGNATQGTMADCLICACPLPITSNNFASGCDVSEDGCHMNGTLNFYCEPTSGQQCPCKENYAGDHCDTCAQACNCHGHADKCVYDPMVDEKRLSVDIQGNYEGGGVCQECRDNTEGINCHQCVAGYYRPYGKHLNETDVCQRQCLCQPRVTGQTCNQPLQAHYYPTLHHYQFEIEDGHTPAFSPSEIIQEVNIQEPSIYQLILFIFIY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1873 2.2.26 [Sep-21-2011]
Q00174 3712 Laminin subunit alpha OS= yes N/A 0.237 0.119 0.512 1e-148
Q21313 3672 Laminin-like protein epi- yes N/A 0.236 0.120 0.450 1e-117
O15230 3695 Laminin subunit alpha-5 O yes N/A 0.234 0.118 0.412 1e-110
Q61001 3718 Laminin subunit alpha-5 O yes N/A 0.234 0.118 0.408 1e-107
Q16787 3333 Laminin subunit alpha-3 O no N/A 0.232 0.130 0.397 2e-99
Q61789 3333 Laminin subunit alpha-3 O no N/A 0.232 0.130 0.369 2e-90
P25391 3075 Laminin subunit alpha-1 O no N/A 0.398 0.242 0.309 2e-81
P19137 3084 Laminin subunit alpha-1 O no N/A 0.391 0.237 0.311 4e-81
Q60675 3106 Laminin subunit alpha-2 O no N/A 0.397 0.239 0.300 1e-76
P24043 3122 Laminin subunit alpha-2 O no N/A 0.392 0.235 0.290 7e-73
>sp|Q00174|LAMA_DROME Laminin subunit alpha OS=Drosophila melanogaster GN=LanA PE=1 SV=2 Back     alignment and function desciption
 Score =  526 bits (1356), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 255/498 (51%), Positives = 320/498 (64%), Gaps = 54/498 (10%)

Query: 1   MGNSPRPAVWALERSADNG----------------------------------------- 19
           MGNSPRP +W LE+S D G                                         
Sbjct: 134 MGNSPRPGLWTLEKSTDYGKTWTPWQHFSDTPADCETYFGKDTYKPITRDDDVICTTEYS 193

Query: 20  ---------ITISLLDHRPSMKNFFNSTRLQEWTRATNVRLRLLRTKNLLGHLMSMADQD 70
                    I + LL+ RPS  N+FNST LQEWTRATNVR+RLLRTKNLLGHLMS+A QD
Sbjct: 194 KIVPLENGEIPVMLLNERPSSTNYFNSTVLQEWTRATNVRIRLLRTKNLLGHLMSVARQD 253

Query: 71  PTTTRRYFYSIKDISIGGRCRCNGHADVCDILDPEDPYHRI-CRCQHNTCGHNCEVCCPG 129
           PT TRRYFYSIKDISIGGRC CNGHAD CD+ DP+ P   + CRCQH+TCG  C  CCPG
Sbjct: 254 PTVTRRYFYSIKDISIGGRCMCNGHADTCDVKDPKSPVRILACRCQHHTCGIQCNECCPG 313

Query: 130 YEQKAWRQSQSNKPFSCEPCNCHGHADKCVYDPMVDEKRLSVDIQGNYEGGGVCQECRDN 189
           +EQK WRQ+ + +PF+CEPCNCHGH+++C YD  V+ K LS+DI G+Y+GGGVCQ C+ N
Sbjct: 314 FEQKKWRQNTNARPFNCEPCNCHGHSNECKYDEEVNRKGLSLDIHGHYDGGGVCQNCQHN 373

Query: 190 TEGINCHQRVAGYYRPYGKHLNETDVCQPCQCAFHYATGNCAEGTGKCECRPEYTKPDCN 249
           T GINC++    YYRP GKH NETDVC PCQC + ++TG+C E TG CECR  +  P C+
Sbjct: 374 TVGINCNKCKPKYYRPKGKHWNETDVCSPCQCDYFFSTGHCEEETGNCECRAAFQPPSCD 433

Query: 250 SCAFGYFGYPNCEPCKCHMNGTLDFYCEPASGQQCPCKENYAGDHCDTCAQGYYNFPTCS 309
           SCA+GY+GYPNC  C+C++NGT  ++CE  SGQQCPCK N+AG +C  CA+GYY FP C 
Sbjct: 434 SCAYGYYGYPNCRECECNLNGTNGYHCEAESGQQCPCKINFAGAYCKQCAEGYYGFPECK 493

Query: 310 PCECNAVGSLSDLCEVDSGNCTCRNNFAGRTCDSCADGYYNYPRCTSCQCAFHYATGN-C 368
            CECN +GS+++ C V +G C C  NF G  C+ C  GY+NYP C+ C C         C
Sbjct: 494 ACECNKIGSITNDCNVTTGECKCLTNFGGDNCERCKHGYFNYPTCSYCDCDNQGTESEIC 553

Query: 369 AEGTGKCECRPEYTKPDCNSCAFGYFGYPNCEPCKCHMNGTLDFYCEPASGQQCPCKENY 428
            + +G+C CR  +  P C+ C  G++ YP+C+PC C   G+    C+     +C C  N+
Sbjct: 554 NKQSGQCICREGFGGPRCDQCLPGFYNYPDCKPCNCSSTGSSAITCDNTG--KCNCLNNF 611

Query: 429 AGDHCDTCAQGYYNFPTC 446
           AG  C  C  GYY++P C
Sbjct: 612 AGKQCTLCTAGYYSYPDC 629




Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components.
Drosophila melanogaster (taxid: 7227)
>sp|Q21313|EPI1_CAEEL Laminin-like protein epi-1 OS=Caenorhabditis elegans GN=epi-1 PE=1 SV=1 Back     alignment and function description
>sp|O15230|LAMA5_HUMAN Laminin subunit alpha-5 OS=Homo sapiens GN=LAMA5 PE=1 SV=8 Back     alignment and function description
>sp|Q61001|LAMA5_MOUSE Laminin subunit alpha-5 OS=Mus musculus GN=Lama5 PE=1 SV=4 Back     alignment and function description
>sp|Q16787|LAMA3_HUMAN Laminin subunit alpha-3 OS=Homo sapiens GN=LAMA3 PE=1 SV=2 Back     alignment and function description
>sp|Q61789|LAMA3_MOUSE Laminin subunit alpha-3 OS=Mus musculus GN=Lama3 PE=1 SV=3 Back     alignment and function description
>sp|P25391|LAMA1_HUMAN Laminin subunit alpha-1 OS=Homo sapiens GN=LAMA1 PE=1 SV=2 Back     alignment and function description
>sp|P19137|LAMA1_MOUSE Laminin subunit alpha-1 OS=Mus musculus GN=Lama1 PE=1 SV=1 Back     alignment and function description
>sp|Q60675|LAMA2_MOUSE Laminin subunit alpha-2 OS=Mus musculus GN=Lama2 PE=1 SV=1 Back     alignment and function description
>sp|P24043|LAMA2_HUMAN Laminin subunit alpha-2 OS=Homo sapiens GN=LAMA2 PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1873
328722049 3586 PREDICTED: laminin subunit alpha-like [A 0.293 0.153 0.544 0.0
332020404 3661 Laminin subunit alpha [Acromyrmex echina 0.313 0.160 0.518 1e-180
307167492 3660 Laminin subunit alpha [Camponotus florid 0.305 0.156 0.520 1e-179
328793738 3544 PREDICTED: laminin subunit alpha, partia 0.289 0.152 0.534 1e-179
380019683 3670 PREDICTED: laminin subunit alpha-like [A 0.289 0.147 0.534 1e-178
345495089 3648 PREDICTED: laminin subunit alpha-like [N 0.290 0.149 0.515 1e-175
340715997 3666 PREDICTED: laminin subunit alpha-like [B 0.289 0.147 0.528 1e-175
383866057 3680 PREDICTED: laminin subunit alpha-like [M 0.289 0.147 0.532 1e-175
350408641 3666 PREDICTED: laminin subunit alpha-like [B 0.289 0.147 0.527 1e-175
307199233 3663 Laminin subunit alpha [Harpegnathos salt 0.315 0.161 0.498 1e-174
>gi|328722049|ref|XP_001949708.2| PREDICTED: laminin subunit alpha-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  654 bits (1686), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/560 (54%), Positives = 409/560 (73%), Gaps = 10/560 (1%)

Query: 852  INNLCNKDLSALNSEELPLLNKDQPKLRFDMRITKPGPHVLVLSYVTPGPHTQDSAVIQL 911
            ++NL  K L  L   +LP++++ QP+L  ++ I  PGP+V++++Y+TP    Q  AVI++
Sbjct: 957  VDNL--KQLDILGVPKLPVISEAQPELDLELSIVNPGPYVILINYMTPS-SIQTKAVIEI 1013

Query: 912  EASSQTTVERGNVRLHDCPYTTPCRATVLDKQGKVSVFEFDTNYISVELTADENPTNNAS 971
            E   +  +  G   L+ C +TT CR   +D  GKV++F+ +     V L   ++   ++ 
Sbjct: 1014 EVDEK--MNSGKAILYACHHTTLCRQAAVDATGKVALFDINKPVTKVILKGGKD---HSK 1068

Query: 972  AAIQKIVAIPEAKWSMDHIQPKTECVRKDGQCVQAMFPTSPETKKIEAESG-LGPLATQL 1030
              I+ IVA+P  KWS+D+I P   CV+KDG+C+Q+ +PT P+TKK+E ++G    L+T  
Sbjct: 1069 VGIESIVALPLDKWSLDYINPNPSCVKKDGKCIQSFYPTPPDTKKVEFKTGNEARLSTTA 1128

Query: 1031 PGSLADNKTGLVYLDHKDAMVDIAGTVNNPGAYVFVVHFYQPDFPEFDMDVLIQNGQFYE 1090
            P  + DN T L+ LDHKD++VD+AG V  PGAYVF+V FYQPDFP F+M+ LI NGQ YE
Sbjct: 1129 PKDIFDNTTALIILDHKDSIVDLAGKVPAPGAYVFIVQFYQPDFPAFEMNALIHNGQTYE 1188

Query: 1091 AQLPVKHCPARSGCRAVVQQTNGNRMFTLEKNIVATFKEPNHKSVWLDYILLIPANEFNE 1150
            A LP+KHCP+ SGCR+VV+Q NGN  F L +N + + KEPNHKSVWL+Y+L++PA E+++
Sbjct: 1189 AVLPIKHCPSNSGCRSVVKQANGNINFQLTENFLLSLKEPNHKSVWLEYVLVVPAQEYSD 1248

Query: 1151 NIINELPYSRAKEFIDVCGKNHFYLDNSTSEFCKKATFSMTISFLHEALPCQCDIDGSKS 1210
            +I  E P+     FI  CG NHFY++ ST+ FCK+ATFS+T ++   ALPC C+ DGS S
Sbjct: 1249 SITVEQPFDYTGLFIANCGSNHFYINTSTTGFCKEATFSLTTAYNSGALPCNCNSDGSLS 1308

Query: 1211 FECEQFGGQCQCKPNVIGRRCEMCATGYYGFPDCHPCNCPFTAVCDSYTGECICAARVIG 1270
            + C+ +GGQCQCKPNVIGRRCE C TGY+GFPDC  CNCP  A C++ +GECIC  RV+G
Sbjct: 1309 YVCDPYGGQCQCKPNVIGRRCEACKTGYFGFPDCKSCNCPSVATCETSSGECICPPRVVG 1368

Query: 1271 KKCDQCEPNTFGYDPIIGCEECNCHPHGV-NGTQQCDLFDGSCSCKENIVGRTCDHCVEG 1329
            K CDQCEP T+G+DPIIGCEECNC+  GV +  +QCDLF+GSC CKENIVGR+CDHC  G
Sbjct: 1369 KNCDQCEPMTYGFDPIIGCEECNCNFFGVEDKNRQCDLFNGSCECKENIVGRSCDHCRSG 1428

Query: 1330 HWSFPYCVPCECDLRGTTIDICNQGTAECYCKKNVYGAACDVCKEGTFDIQADNVDGCTR 1389
            HWSFP C  C CD RGTT +ICNQ  +EC+CK NVYG ACD+CKEGTF+IQ  N +GC++
Sbjct: 1429 HWSFPRCYLCNCDYRGTTSEICNQNNSECFCKSNVYGQACDLCKEGTFNIQEKNDEGCSK 1488

Query: 1390 CFCFGKTTKCSSSNLYRSQL 1409
            CFCFGKTT+C SSNLYR+++
Sbjct: 1489 CFCFGKTTRCQSSNLYRTEI 1508




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|332020404|gb|EGI60824.1| Laminin subunit alpha [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307167492|gb|EFN61065.1| Laminin subunit alpha [Camponotus floridanus] Back     alignment and taxonomy information
>gi|328793738|ref|XP_396118.4| PREDICTED: laminin subunit alpha, partial [Apis mellifera] Back     alignment and taxonomy information
>gi|380019683|ref|XP_003693732.1| PREDICTED: laminin subunit alpha-like [Apis florea] Back     alignment and taxonomy information
>gi|345495089|ref|XP_001603629.2| PREDICTED: laminin subunit alpha-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|340715997|ref|XP_003396491.1| PREDICTED: laminin subunit alpha-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|383866057|ref|XP_003708488.1| PREDICTED: laminin subunit alpha-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|350408641|ref|XP_003488468.1| PREDICTED: laminin subunit alpha-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|307199233|gb|EFN79905.1| Laminin subunit alpha [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1873
FB|FBgn0002526 3712 LanA "Laminin A" [Drosophila m 0.228 0.115 0.563 0.0
WB|WBGene00001328 3704 epi-1 [Caenorhabditis elegans 0.226 0.114 0.490 4.5e-285
ZFIN|ZDB-GENE-030131-9823 3664 lama5 "laminin, alpha 5" [Dani 0.227 0.116 0.427 6e-236
UNIPROTKB|F1NZZ2 3668 LAMA5 "Uncharacterized protein 0.202 0.103 0.415 6.1e-206
UNIPROTKB|F1MAN8 3719 Lama5 "Protein Lama5" [Rattus 0.222 0.112 0.385 1.5e-199
UNIPROTKB|E2RPP1 3337 LAMA3 "Uncharacterized protein 0.281 0.158 0.347 2.1e-192
MGI|MGI:105382 3718 Lama5 "laminin, alpha 5" [Mus 0.241 0.121 0.371 1.4e-189
UNIPROTKB|Q16787 3333 LAMA3 "Laminin subunit alpha-3 0.281 0.158 0.354 2.9e-188
UNIPROTKB|F1NQ51 3356 LAMA3 "Uncharacterized protein 0.279 0.155 0.343 1.1e-186
UNIPROTKB|O15230 3695 LAMA5 "Laminin subunit alpha-5 0.223 0.113 0.370 4.8e-186
FB|FBgn0002526 LanA "Laminin A" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1504 (534.5 bits), Expect = 0., Sum P(5) = 0.
 Identities = 244/433 (56%), Positives = 308/433 (71%)

Query:    17 DNG-ITISLLDHRPSMKNFFNSTRLQEWTRATNVRLRLLRTKNLLGHLMSMADQDPTTTR 75
             +NG I + LL+ RPS  N+FNST LQEWTRATNVR+RLLRTKNLLGHLMS+A QDPT TR
Sbjct:   199 ENGEIPVMLLNERPSSTNYFNSTVLQEWTRATNVRIRLLRTKNLLGHLMSVARQDPTVTR 258

Query:    76 RYFYSIKDISIGGRCRCNGHADVCDILDPEDPYHRI-CRCQHNTCGHNCEVCCPGYEQKA 134
             RYFYSIKDISIGGRC CNGHAD CD+ DP+ P   + CRCQH+TCG  C  CCPG+EQK 
Sbjct:   259 RYFYSIKDISIGGRCMCNGHADTCDVKDPKSPVRILACRCQHHTCGIQCNECCPGFEQKK 318

Query:   135 WRQSQSNKPFSCEPCNCHGHADKCVYDPMVDEKRLSVDIQGNYEGGGVCQECRDNTEGIN 194
             WRQ+ + +PF+CEPCNCHGH+++C YD  V+ K LS+DI G+Y+GGGVCQ C+ NT GIN
Sbjct:   319 WRQNTNARPFNCEPCNCHGHSNECKYDEEVNRKGLSLDIHGHYDGGGVCQNCQHNTVGIN 378

Query:   195 CHQRVAGYYRPYGKHLNETDVCQPCQCAFHYATGNCAEGTGKCECRPEYTKPDCNSCAFG 254
             C++    YYRP GKH NETDVC PCQC + ++TG+C E TG CECR  +  P C+SCA+G
Sbjct:   379 CNKCKPKYYRPKGKHWNETDVCSPCQCDYFFSTGHCEEETGNCECRAAFQPPSCDSCAYG 438

Query:   255 YFGYPNCEPCKCHMNGTLDFYCEPASGQQCPCKENYAGDHCDTCAQGYYNFPTCSPCECN 314
             Y+GYPNC  C+C++NGT  ++CE  SGQQCPCK N+AG +C  CA+GYY FP C  CECN
Sbjct:   439 YYGYPNCRECECNLNGTNGYHCEAESGQQCPCKINFAGAYCKQCAEGYYGFPECKACECN 498

Query:   315 AVGSLSDLCEVDSGNCTCRNNFAGRTCDSCADGYYNYPRCTSCQCAFHYATGN-CAEGTG 373
              +GS+++ C V +G C C  NF G  C+ C  GY+NYP C+ C C         C + +G
Sbjct:   499 KIGSITNDCNVTTGECKCLTNFGGDNCERCKHGYFNYPTCSYCDCDNQGTESEICNKQSG 558

Query:   374 KCECRPEYTKPDCNSCAFGYFGYPNCEPCKCHMNGTLDFYCEPASGQQCPCKENYAGDHC 433
             +C CR  +  P C+ C  G++ YP+C+PC C   G+    C+     +C C  N+AG  C
Sbjct:   559 QCICREGFGGPRCDQCLPGFYNYPDCKPCNCSSTGSSAITCDNTG--KCNCLNNFAGKQC 616

Query:   434 DTCAQGYYNFPTC 446
               C  GYY++P C
Sbjct:   617 TLCTAGYYSYPDC 629


GO:0005604 "basement membrane" evidence=ISS;NAS;IDA
GO:0007417 "central nervous system development" evidence=NAS
GO:0007422 "peripheral nervous system development" evidence=NAS
GO:0005605 "basal lamina" evidence=IDA
GO:0035001 "dorsal trunk growth, open tracheal system" evidence=IMP
GO:0007507 "heart development" evidence=IMP
GO:0009887 "organ morphogenesis" evidence=NAS
GO:0009888 "tissue development" evidence=NAS
GO:0048598 "embryonic morphogenesis" evidence=NAS
GO:0016321 "female meiosis chromosome segregation" evidence=IMP
GO:0007498 "mesoderm development" evidence=IEP
GO:0007411 "axon guidance" evidence=IMP
GO:0030334 "regulation of cell migration" evidence=IEA
GO:0030155 "regulation of cell adhesion" evidence=IEA
GO:0005606 "laminin-1 complex" evidence=IEA
GO:0045995 "regulation of embryonic development" evidence=IEA
GO:0005102 "receptor binding" evidence=IEA
GO:0001964 "startle response" evidence=IMP
GO:0031987 "locomotion involved in locomotory behavior" evidence=IMP
GO:0048854 "brain morphogenesis" evidence=IMP
GO:0002121 "inter-male aggressive behavior" evidence=IMP
GO:0007476 "imaginal disc-derived wing morphogenesis" evidence=IMP
GO:0035011 "melanotic encapsulation of foreign target" evidence=IMP
GO:0036062 "presynaptic periactive zone" evidence=IDA
GO:0045886 "negative regulation of synaptic growth at neuromuscular junction" evidence=IMP
WB|WBGene00001328 epi-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-9823 lama5 "laminin, alpha 5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NZZ2 LAMA5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MAN8 Lama5 "Protein Lama5" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2RPP1 LAMA3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:105382 Lama5 "laminin, alpha 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q16787 LAMA3 "Laminin subunit alpha-3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NQ51 LAMA3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|O15230 LAMA5 "Laminin subunit alpha-5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1873
smart00136238 smart00136, LamNT, Laminin N-terminal domain (doma 1e-21
pfam00055237 pfam00055, Laminin_N, Laminin N-terminal (Domain V 3e-14
cd0005550 cd00055, EGF_Lam, Laminin-type epidermal growth fa 9e-11
pfam0005349 pfam00053, Laminin_EGF, Laminin EGF-like (Domains 9e-10
cd0005550 cd00055, EGF_Lam, Laminin-type epidermal growth fa 2e-09
smart0018046 smart00180, EGF_Lam, Laminin-type epidermal growth 3e-09
smart0018046 smart00180, EGF_Lam, Laminin-type epidermal growth 8e-09
cd0005550 cd00055, EGF_Lam, Laminin-type epidermal growth fa 1e-08
pfam0005349 pfam00053, Laminin_EGF, Laminin EGF-like (Domains 2e-08
cd0005550 cd00055, EGF_Lam, Laminin-type epidermal growth fa 4e-08
cd0005550 cd00055, EGF_Lam, Laminin-type epidermal growth fa 4e-08
pfam0005349 pfam00053, Laminin_EGF, Laminin EGF-like (Domains 3e-07
smart0018046 smart00180, EGF_Lam, Laminin-type epidermal growth 3e-07
cd0005550 cd00055, EGF_Lam, Laminin-type epidermal growth fa 5e-07
cd0005550 cd00055, EGF_Lam, Laminin-type epidermal growth fa 5e-07
pfam0005349 pfam00053, Laminin_EGF, Laminin EGF-like (Domains 5e-07
cd0005550 cd00055, EGF_Lam, Laminin-type epidermal growth fa 7e-07
pfam0005349 pfam00053, Laminin_EGF, Laminin EGF-like (Domains 1e-06
smart0018046 smart00180, EGF_Lam, Laminin-type epidermal growth 1e-06
smart0018046 smart00180, EGF_Lam, Laminin-type epidermal growth 1e-06
pfam0005349 pfam00053, Laminin_EGF, Laminin EGF-like (Domains 2e-06
pfam0005349 pfam00053, Laminin_EGF, Laminin EGF-like (Domains 5e-06
pfam0005349 pfam00053, Laminin_EGF, Laminin EGF-like (Domains 1e-05
pfam0005349 pfam00053, Laminin_EGF, Laminin EGF-like (Domains 1e-05
cd0005550 cd00055, EGF_Lam, Laminin-type epidermal growth fa 3e-05
smart0018046 smart00180, EGF_Lam, Laminin-type epidermal growth 4e-05
smart0018046 smart00180, EGF_Lam, Laminin-type epidermal growth 4e-05
cd0005550 cd00055, EGF_Lam, Laminin-type epidermal growth fa 5e-05
smart0018046 smart00180, EGF_Lam, Laminin-type epidermal growth 6e-05
pfam0005349 pfam00053, Laminin_EGF, Laminin EGF-like (Domains 1e-04
cd0005550 cd00055, EGF_Lam, Laminin-type epidermal growth fa 2e-04
smart0018046 smart00180, EGF_Lam, Laminin-type epidermal growth 2e-04
smart0018046 smart00180, EGF_Lam, Laminin-type epidermal growth 5e-04
cd0005550 cd00055, EGF_Lam, Laminin-type epidermal growth fa 7e-04
cd0005550 cd00055, EGF_Lam, Laminin-type epidermal growth fa 7e-04
smart0018046 smart00180, EGF_Lam, Laminin-type epidermal growth 0.002
cd0005550 cd00055, EGF_Lam, Laminin-type epidermal growth fa 0.003
cd0005550 cd00055, EGF_Lam, Laminin-type epidermal growth fa 0.003
pfam0005349 pfam00053, Laminin_EGF, Laminin EGF-like (Domains 0.003
pfam0005349 pfam00053, Laminin_EGF, Laminin EGF-like (Domains 0.003
pfam0005349 pfam00053, Laminin_EGF, Laminin EGF-like (Domains 0.003
pfam0005349 pfam00053, Laminin_EGF, Laminin EGF-like (Domains 0.003
smart0018046 smart00180, EGF_Lam, Laminin-type epidermal growth 0.003
smart0018046 smart00180, EGF_Lam, Laminin-type epidermal growth 0.004
>gnl|CDD|214532 smart00136, LamNT, Laminin N-terminal domain (domain VI) Back     alignment and domain information
 Score = 95.9 bits (239), Expect = 1e-21
 Identities = 35/78 (44%), Positives = 45/78 (57%), Gaps = 3/78 (3%)

Query: 11  ALERSADNGITISLLDHRPSMKNFFNSTRLQEWTRATNVRLRLLRTKNLLGHLMSMADQD 70
            +       I  SLL+ RPS  +F NS  LQEW  ATN+R+RL R + L   LM      
Sbjct: 164 DIVPLEGGEIAFSLLEGRPSATDFDNSPVLQEWVTATNIRVRLTRLRTLGDELMDDR--- 220

Query: 71  PTTTRRYFYSIKDISIGG 88
           P  TRRY+Y+I DI++GG
Sbjct: 221 PEVTRRYYYAISDIAVGG 238


N-terminal domain of laminins and laminin-related protein such as Unc-6/ netrins. Length = 238

>gnl|CDD|215682 pfam00055, Laminin_N, Laminin N-terminal (Domain VI) Back     alignment and domain information
>gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>gnl|CDD|215680 pfam00053, Laminin_EGF, Laminin EGF-like (Domains III and V) Back     alignment and domain information
>gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>gnl|CDD|214543 smart00180, EGF_Lam, Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>gnl|CDD|214543 smart00180, EGF_Lam, Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>gnl|CDD|215680 pfam00053, Laminin_EGF, Laminin EGF-like (Domains III and V) Back     alignment and domain information
>gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>gnl|CDD|215680 pfam00053, Laminin_EGF, Laminin EGF-like (Domains III and V) Back     alignment and domain information
>gnl|CDD|214543 smart00180, EGF_Lam, Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>gnl|CDD|215680 pfam00053, Laminin_EGF, Laminin EGF-like (Domains III and V) Back     alignment and domain information
>gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>gnl|CDD|215680 pfam00053, Laminin_EGF, Laminin EGF-like (Domains III and V) Back     alignment and domain information
>gnl|CDD|214543 smart00180, EGF_Lam, Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>gnl|CDD|214543 smart00180, EGF_Lam, Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>gnl|CDD|215680 pfam00053, Laminin_EGF, Laminin EGF-like (Domains III and V) Back     alignment and domain information
>gnl|CDD|215680 pfam00053, Laminin_EGF, Laminin EGF-like (Domains III and V) Back     alignment and domain information
>gnl|CDD|215680 pfam00053, Laminin_EGF, Laminin EGF-like (Domains III and V) Back     alignment and domain information
>gnl|CDD|215680 pfam00053, Laminin_EGF, Laminin EGF-like (Domains III and V) Back     alignment and domain information
>gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>gnl|CDD|214543 smart00180, EGF_Lam, Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>gnl|CDD|214543 smart00180, EGF_Lam, Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>gnl|CDD|214543 smart00180, EGF_Lam, Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>gnl|CDD|215680 pfam00053, Laminin_EGF, Laminin EGF-like (Domains III and V) Back     alignment and domain information
>gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>gnl|CDD|214543 smart00180, EGF_Lam, Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>gnl|CDD|214543 smart00180, EGF_Lam, Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>gnl|CDD|214543 smart00180, EGF_Lam, Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>gnl|CDD|215680 pfam00053, Laminin_EGF, Laminin EGF-like (Domains III and V) Back     alignment and domain information
>gnl|CDD|215680 pfam00053, Laminin_EGF, Laminin EGF-like (Domains III and V) Back     alignment and domain information
>gnl|CDD|215680 pfam00053, Laminin_EGF, Laminin EGF-like (Domains III and V) Back     alignment and domain information
>gnl|CDD|215680 pfam00053, Laminin_EGF, Laminin EGF-like (Domains III and V) Back     alignment and domain information
>gnl|CDD|214543 smart00180, EGF_Lam, Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>gnl|CDD|214543 smart00180, EGF_Lam, Laminin-type epidermal growth factor-like domai Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1873
KOG0994|consensus 1758 100.0
KOG1836|consensus1705 100.0
KOG0994|consensus 1758 100.0
KOG1836|consensus 1705 100.0
KOG3512|consensus592 100.0
KOG3512|consensus 592 99.9
KOG4289|consensus2531 99.82
smart00136238 LamNT Laminin N-terminal domain (domain VI). N-ter 99.81
KOG4289|consensus2531 99.81
PF00055237 Laminin_N: Laminin N-terminal (Domain VI); InterPr 99.81
KOG3509|consensus964 99.53
KOG3509|consensus964 99.08
KOG1225|consensus525 98.9
KOG1225|consensus525 98.81
KOG1219|consensus4289 98.7
KOG1219|consensus4289 98.6
KOG1217|consensus487 98.4
smart0018046 EGF_Lam Laminin-type epidermal growth factor-like 98.4
cd0005550 EGF_Lam Laminin-type epidermal growth factor-like 98.39
PF0005349 Laminin_EGF: Laminin EGF-like (Domains III and V); 98.37
cd0005550 EGF_Lam Laminin-type epidermal growth factor-like 98.33
KOG1217|consensus487 98.33
PF0005349 Laminin_EGF: Laminin EGF-like (Domains III and V); 98.32
smart0018046 EGF_Lam Laminin-type epidermal growth factor-like 98.27
KOG1226|consensus783 98.21
KOG1226|consensus783 97.75
KOG1218|consensus316 97.65
KOG1218|consensus316 97.64
KOG4260|consensus350 97.58
KOG4260|consensus350 97.18
KOG1388|consensus217 96.33
KOG1214|consensus1289 96.29
KOG1388|consensus217 96.23
PF0000832 EGF: EGF-like domain This is a sub-family of the P 95.58
KOG1214|consensus1289 95.46
smart0005163 DSL delta serrate ligand. 94.03
PF0000832 EGF: EGF-like domain This is a sub-family of the P 93.79
smart0017939 EGF_CA Calcium-binding EGF-like domain. 92.7
smart0005163 DSL delta serrate ligand. 92.58
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 92.56
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 92.4
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 92.01
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 91.04
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 90.99
PF03302397 VSP: Giardia variant-specific surface protein; Int 89.99
smart0017939 EGF_CA Calcium-binding EGF-like domain. 89.19
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 86.1
cd0005336 EGF Epidermal growth factor domain, found in epide 85.88
PF0141463 DSL: Delta serrate ligand; InterPro: IPR001774 Lig 83.97
smart0018135 EGF Epidermal growth factor-like domain. 80.73
>KOG0994|consensus Back     alignment and domain information
Probab=100.00  E-value=2.1e-142  Score=1300.55  Aligned_cols=876  Identities=33%  Similarity=0.759  Sum_probs=701.9

Q ss_pred             CCCCCCceEEEeeccCC-----------------------------------------------eEEEccCCCCCCCCCC
Q psy12394          3 NSPRPAVWALERSADNG-----------------------------------------------ITISLLDHRPSMKNFF   35 (1873)
Q Consensus         3 ~sprp~~~~~ers~d~g-----------------------------------------------i~~s~~~~rp~~~~~~   35 (1873)
                      .||||++|+||||.|||                                               |+|++|... +...--
T Consensus       141 ktfRPAAMliERS~DFGkTW~vYrYFAyDC~asFPGv~~~~~kk~~DviCtSrYS~~~PstgGEVifrvl~P~-~~iedP  219 (1758)
T KOG0994|consen  141 KTFRPAAMLIERSSDFGKTWHVYRYFAYDCSATFPGVPTGPPKKWDDVICTSRYSDPEPSTGGEVIFRVLDPA-IDIEDP  219 (1758)
T ss_pred             ccCCcceeeeeecccccccceeeeeeecccccCCCCCCCCCcccccceeeecccCCCCCCCCCeEEEEecCCC-CCCCCc
Confidence            68999999999999999                                               888888874 222223


Q ss_pred             CchhhhhheeeeeeeEeeccccccccccccccCCCCCcceeeeEEeeeeeeeeeeccCCCCCcCccCCCCC---------
Q psy12394         36 NSTRLQEWTRATNVRLRLLRTKNLLGHLMSMADQDPTTTRRYFYSIKDISIGGRCRCNGHADVCDILDPED---------  106 (1873)
Q Consensus        36 ~s~~l~~~~~at~ir~~~~~~~t~~~~~~~~~~~~~~~~~~~yYai~d~~v~grC~C~gHa~~C~~~~~~~---------  106 (1873)
                      +|+++|+.+++|||||.|+|++||+++|++   ..+.+..+|||||+||.|.|+|+|||||++|.+.++..         
T Consensus       220 Ys~~IQ~~LKITNLRvn~tklhtlgdnllD---~r~E~~ekyyYAiy~~vVrGsCfCyGHAs~C~P~~g~~s~~~~~ta~  296 (1758)
T KOG0994|consen  220 YSAKIQELLKITNLRVNFTKLHTLGDNLLD---SREEIREKYYYAIYDLVVRGSCFCYGHASQCAPVDGARSAKAPGTAH  296 (1758)
T ss_pred             hhHHHHHHhhhhheeeeeEeeccccccccc---cccccccchhheeeeeeeecceeecCchhhcccCCCCCcccCCCccc
Confidence            699999999999999999999999999875   34566789999999999999999999999999987543         


Q ss_pred             CccceeecCCCCCCCCCCCCCCCccCCcCCcCCCCCCCCccCCCCCCCCCccccCccccccCcccccCcCcCCCceeCCC
Q psy12394        107 PYHRICRCQHNTCGHNCEVCCPGYEQKAWRQSQSNKPFSCEPCNCHGHADKCVYDPMVDEKRLSVDIQGNYEGGGVCQEC  186 (1873)
Q Consensus       107 ~~~~~C~C~h~t~G~~Ce~c~p~~~~~p~~~~~~~~~~~C~~C~C~~~~~~C~~d~~~~~~~~s~~~~g~~~~GG~C~~C  186 (1873)
                      +++.+|.|.|||.|.|||.|.|+||+.||+|+...++|+|++|+||+|+.+|+||..++..      +|. ..||||.+|
T Consensus       297 mVHG~C~C~HNT~G~nCE~C~~fYnDlPWrpAeG~~~neCrkC~CNgHa~sCHFD~aV~~A------SG~-vSGGVCDdC  369 (1758)
T KOG0994|consen  297 MVHGRCMCKHNTAGLNCEHCAPFYNDLPWRPAEGKTSNECRKCECNGHADTCHFDMAVYEA------SGN-VSGGVCDDC  369 (1758)
T ss_pred             eecceeEeccCCCCCChHHhhHhhcCCCCCccCCCCcccccccCCCCCcccccccHHHHhh------cCC-cccccCccc
Confidence            5689999999999999999999999999999999999999999999999999999999876      454 378999999


Q ss_pred             CCCCCCCCCCCCCCCCccCCCCCCCCCCCCccCCCCCCCCCCeeecCCCceecCCCCcCCCCcccCCcccCCCCCCCCCC
Q psy12394        187 RDNTEGINCHQRVAGYYRPYGKHLNETDVCQPCQCAFHYATGNCAEGTGKCECRPEYTKPDCNSCAFGYFGYPNCEPCKC  266 (1873)
Q Consensus       187 ~~~~~G~~Ce~C~~g~~~~~~~~~~~~~~C~~C~C~~~~n~g~C~~~~g~C~C~~G~~G~~Ce~C~~g~~g~~~C~~c~C  266 (1873)
                      +|||+|.|||+|+|.|||++.++++++++|+||.|+|.++.                                       
T Consensus       370 qHNT~G~~CE~CkP~fYRdprr~i~~p~vC~pC~CdP~GS~---------------------------------------  410 (1758)
T KOG0994|consen  370 QHNTEGQNCERCKPFFYRDPRRDISDPDVCKPCECDPAGSQ---------------------------------------  410 (1758)
T ss_pred             cccccccchhhcCcccccCCCCCCCCccccccccCCCCcCc---------------------------------------
Confidence            99999999999999999999999999888888887632210                                       


Q ss_pred             CCCCCCCceecCCCCCcccCCCCCccCCCccCCCCCCCCCCCCCCCcCCCCCCCCcccCCCcccccCCCcccCCCccCCC
Q psy12394        267 HMNGTLDFYCEPASGQQCPCKENYAGDHCDTCAQGYYNFPTCSPCECNAVGSLSDLCEVDSGNCTCRNNFAGRTCDSCAD  346 (1873)
Q Consensus       267 ~~~gt~~~~C~~~~G~~C~C~~g~~G~~Ce~C~~Gf~g~~~C~~c~C~~~gs~~~~C~~~~g~C~C~~G~~G~~Ce~C~~  346 (1873)
                                   ++                                       +.|+.                     
T Consensus       411 -------------~~---------------------------------------g~cds---------------------  417 (1758)
T KOG0994|consen  411 -------------DG---------------------------------------GICDS---------------------  417 (1758)
T ss_pred             -------------CC---------------------------------------Ccccc---------------------
Confidence                         00                                       00000                     


Q ss_pred             CCcCCCCCCcCCCCCCCCCceecCCCCeeeeCCCccCCCCccCCCCccCCCCCCCCCCCCCcEeeeeccCCCCCeeeCCC
Q psy12394        347 GYYNYPRCTSCQCAFHYATGNCAEGTGKCECRPEYTKPDCNSCAFGYFGYPNCEPCKCHMNGTLDFYCEPASGQQCPCKE  426 (1873)
Q Consensus       347 G~~g~~~C~~C~c~~c~n~g~C~~~~g~C~C~~G~tG~~Ce~C~~g~~~~~~C~~~~C~n~gtc~~~cd~~~g~~C~C~~  426 (1873)
                                                                                        .+|+.+|       
T Consensus       418 ------------------------------------------------------------------~~Dp~~G-------  424 (1758)
T KOG0994|consen  418 ------------------------------------------------------------------FCDPSTG-------  424 (1758)
T ss_pred             ------------------------------------------------------------------ccCcccc-------
Confidence                                                                              0000000       


Q ss_pred             CcccCCCCcCCCCcccCCCcccccCCCcceeeeeecccccceEEEEeeeeeeeeecceeEEEEEeeccccCCCcceeeee
Q psy12394        427 NYAGDHCDTCAQGYYNFPTCSQITLPDVPVIRVLMATITTHAVLLVNVTRLVLCLTCVKLILAIVRAEITLPDVPVIRVL  506 (1873)
Q Consensus       427 g~~G~~Ce~C~~g~~~~~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~  506 (1873)
                                                                                                      
T Consensus       425 --------------------------------------------------------------------------------  424 (1758)
T KOG0994|consen  425 --------------------------------------------------------------------------------  424 (1758)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             eeeeeceeeEEeehhHHHHhhccccccCcccccccccccccccCCcccccCCCCCcccccccCCCceecCCCCCCCCCCc
Q psy12394        507 MATITTHAVLFVIVTSEVQRLVSVIKPMDHVYVRKDTRALAVTNARQVCNCDIRGTEAGICDKTNGSCLCKEGYTGARCD  586 (1873)
Q Consensus       507 ~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~C~C~~~gt~~~~C~~~~g~C~C~~G~~G~~Ce  586 (1873)
                                                                                                      
T Consensus       425 --------------------------------------------------------------------------------  424 (1758)
T KOG0994|consen  425 --------------------------------------------------------------------------------  424 (1758)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             cCCCCccCCCCCcccCCCCCCcCCccCCCCCcccCCCCccCCCCCCCCCCcCCCCCCccCCCCCCCCCCcccCCCcceec
Q psy12394        587 QCKAGYYGYPDCKLCGCSAVGSSSTACDVSGKCPCLVNFGGKTCSQCSPGFYQYPQCKACNCDSHGNIGVSCDDDGKCQC  666 (1873)
Q Consensus       587 ~C~~g~~~~~~C~~c~C~~~Gt~~~~C~~~g~C~C~~G~~G~~Ce~C~~g~~g~~~C~~c~C~~~~~~gg~C~~~g~C~C  666 (1873)
                                                                                                      
T Consensus       425 --------------------------------------------------------------------------------  424 (1758)
T KOG0994|consen  425 --------------------------------------------------------------------------------  424 (1758)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             CCCCCCCCCcccCCCccCCCCcccCCCCCCCCCCcccCCCCceeeCCCcccCCCCcCCCCCccCCCCcCCCCCCCCCccC
Q psy12394        667 EKNFGGDRCERCKEGLYNFPICEACNCDSHGNIGVSCDDDGKCQCEKNFGGDRCERCKEGLYNFPICEECNCNPEGVLKT  746 (1873)
Q Consensus       667 ~~g~~G~~Ce~C~~g~~g~~~C~~C~C~~~g~~~~~C~~~g~C~C~~g~~G~~Ce~C~~g~~g~p~C~~C~C~~~Gs~~~  746 (1873)
                                                                                                      
T Consensus       425 --------------------------------------------------------------------------------  424 (1758)
T KOG0994|consen  425 --------------------------------------------------------------------------------  424 (1758)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             ccccccCCCCCceecCCCcccCCccccCCCCcCCCCCCCCCCCcCcCCCCCcccCCcccCCCCCceecCCCCccCCCCCC
Q psy12394        747 FAGCGSLPAGELCECKPKVQGRICDECRPLYWNLKASNPDGCEDCDCYTLGTIGGIKNCNPKSGQCVCKATAMNRKCDAC  826 (1873)
Q Consensus       747 ~~~C~~~~~~g~C~C~~g~~G~~C~~C~~g~~g~~~~~~~~C~~c~C~~~Gt~~~~~~C~~~tg~C~C~~g~~G~~C~~C  826 (1873)
                             -..|+|.||+++.|++|++|++|||||+..|+.||.+|.|++.||..+.+ ||+.||.|.||+.++|..|++|
T Consensus       425 -------lvaGqC~CK~~V~G~RCd~Ck~Gywgl~~~dp~GC~~C~CN~lGT~~~s~-CD~~TG~C~ckrlvTg~~cdqc  496 (1758)
T KOG0994|consen  425 -------LVAGQCRCKEHVAGRRCDRCKDGYWGLTSADPYGCRPCDCNPLGTRNGSG-CDPETGDCYCKRLVTGIDCDQC  496 (1758)
T ss_pred             -------ccccccccccCcCccccchhccCcccCccCCCCCccccccccccccCCCC-CCCCCCceEeeccccCCCcccc
Confidence                   01267889999999999999999999999999999999999999998866 9999999999999999999999


Q ss_pred             CCCCccCcCCCCCCCccCcCCCCCcccccccCCCCCCCCCccccccCCCCceeeeeeeecCCCeeEEEEeecCCCCCCCC
Q psy12394        827 MDGTYALQDNNLFGCTECACDIGGSINNLCNKDLSALNSEELPLLNKDQPKLRFDMRITKPGPHVLVLSYVTPGPHTQDS  906 (1873)
Q Consensus       827 ~~g~~g~~~~~~~gC~~C~C~~gg~~~~~C~~~~~~~~~~~~~~~~~~q~~~~~~~~~~~~g~y~~~l~y~~~~~~~~~~  906 (1873)
                      +|.+|||+ +.++||++|+||+||++.+.|+..+|++  +++++|.||+      +..+.+++|..+|+.+.++++..+.
T Consensus       497 lPeh~gLs-~~~~gc~~cdcd~GGs~d~sc~~~sGqC--~CRe~~~GR~------c~~~~~~yy~~~l~h~i~eAe~~~~  567 (1758)
T KOG0994|consen  497 LPEHWGLS-NDLEGCRPCDCDQGGSYDNSCDLHSGQC--ECREHMLGRR------CEQVCPGYYSPVLDHYIYEAEDAGT  567 (1758)
T ss_pred             CccccccC-CCCCCCcccccCCCCCCCcccccccCcc--cccccccccc------ccccCCcccccccchhhhhhhhccc
Confidence            99999998 5789999999999999999999999998  6777888875      4588999999999988777764310


Q ss_pred             ceEEEeecccccccccceEeecCCCCCCcceeeecCCCceEEEEeccCceEEEEeccCCCCCCccceEEEEEeeccCccc
Q psy12394        907 AVIQLEASSQTTVERGNVRLHDCPYTTPCRATVLDKQGKVSVFEFDTNYISVELTADENPTNNASAAIQKIVAIPEAKWS  986 (1873)
Q Consensus       907 ~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~P~~~~~  986 (1873)
                      .+ .+.+..                                         ...+.+.                 +     
T Consensus       568 ~~-~~~v~~-----------------------------------------r~~~~~~-----------------~-----  583 (1758)
T KOG0994|consen  568 GV-EVNVKE-----------------------------------------RKVLKST-----------------K-----  583 (1758)
T ss_pred             cc-eeeeee-----------------------------------------eeecccC-----------------C-----
Confidence            00 000000                                         0000000                 0     


Q ss_pred             ccccCcceeeeecCCccccccCCCCCCcceEEeecCCCCccccCCCcccCCCCceEEecCCCceEEEeeccCCCccEEEE
Q psy12394        987 MDHIQPKTECVRKDGQCVQAMFPTSPETKKIEAESGLGPLATQLPGSLADNKTGLVYLDHKDAMVDIAGTVNNPGAYVFV 1066 (1873)
Q Consensus       987 ~~~~~~~~~~~~~~g~c~~~~~~~~p~~~~~~~~~~~~~~~~~lp~~~~~~~~~~v~l~~~~~~~~~~~~v~~~g~Yv~v 1066 (1873)
                                                                 +| +|+  +.+|+++......+.+...||..+.|.++
T Consensus       584 -------------------------------------------~~-sft--G~gf~r~~e~~~l~f~~~~ip~sm~Ydv~  617 (1758)
T KOG0994|consen  584 -------------------------------------------LP-SFT--GKGFVRVPEGTTLEFTVPIIPPSMEYDVL  617 (1758)
T ss_pred             -------------------------------------------Cc-ccc--ccceeecCCCceeeeecCCCCcccccchh
Confidence                                                       00 111  22334443222222233568888999999


Q ss_pred             EEeecCCCCCcc--ceEEEec-CeeeeeccccccCCCCCCcceeEecCCCc--------------eeeeecc--ceEEEE
Q psy12394       1067 VHFYQPDFPEFD--MDVLIQN-GQFYEAQLPVKHCPARSGCRAVVQQTNGN--------------RMFTLEK--NIVATF 1127 (1873)
Q Consensus      1067 i~y~~~~~~~~~--~~v~~~~-~~~~~g~~~~~~c~~~~~Cr~vv~~~~~~--------------~~~~l~~--~~~~~l 1127 (1873)
                      |+|. +..+..+  +.++|+. ++           |....|...+..++.+              ..+-|+.  .++++|
T Consensus       618 ir~~-~~~~~~wen~~itvqrp~~-----------p~~g~c~~~~~~dd~~~~sl~p~sRyvv~~~~vClE~G~~Yklri  685 (1758)
T KOG0994|consen  618 IRYD-PRTPKLWENAKITVQRPGQ-----------PSLGRCGMAIPKDDRIPFSLPPGSRYVVAPNPVCLEAGKVYKLRI  685 (1758)
T ss_pred             eecc-CCCcchhhhheEEeecCCC-----------CcccccccccccccccccccCCCceeeecCCchhhccCcceEEEE
Confidence            9986 4444322  4444442 11           2334444444432210              1122222  334444


Q ss_pred             eCCC------CceeEEEEEEEeeCcccchhhccccccchhhHHH-hhcCCCcccccCCcchhcccccccceeeccCCCcC
Q psy12394       1128 KEPN------HKSVWLDYILLIPANEFNENIINELPYSRAKEFI-DVCGKNHFYLDNSTSEFCKKATFSMTISFLHEALP 1200 (1873)
Q Consensus      1128 ~~~~------~~~~~ld~v~lip~~~~~~~~l~~~~~~~~~~f~-~~C~~~~~~i~~~~~~~c~~~~~~~~~~~~~~~~~ 1200 (1873)
                      ..+.      +...+||+|+|+|..+-...|- ...+....+|. .+|....+..+..+++.|....+++++.+++++.+
T Consensus       686 ~~~~~~~~~esp~aLiDSl~L~P~~~~l~iFq-g~~~a~~~~yerYqC~~sl~~~k~~~~e~C~~l~~~lsa~l~n~a~~  764 (1758)
T KOG0994|consen  686 YFERKSHDVESPYALIDSLVLIPRIDVLPIFQ-GSVLADKKTYERYQCESSLSDMKTKSDEVCQNLDNSLSALLHNGASM  764 (1758)
T ss_pred             EeccccCCcccchhhhhhhhhccccccccccc-cchhhhhHHHHHhhhhhcccccccCcchhhhhhhhhHHHHHhcCccc
Confidence            3321      1234899999999865443332 22222244555 37833333345566889999999999999999999


Q ss_pred             ccccCCCCcceeecccCceecCCCCcccCCCCCCCCCccCCC--CCcCCCCCC----CccccCCCceEEecCCccCCCCC
Q psy12394       1201 CQCDIDGSKSFECEQFGGQCQCKPNVIGRRCEMCATGYYGFP--DCHPCNCPF----TAVCDSYTGECICAARVIGKKCD 1274 (1873)
Q Consensus      1201 c~c~~~gs~~~~c~~~~~~C~C~~~~~G~~C~~C~~g~~~~~--~C~~C~C~~----~~~C~~~tg~C~C~~~~~G~~C~ 1274 (1873)
                      |+|+++||+|.+|++.+|||+|+|||+||+|++||||+|||.  +|++|+|+.    ...||+.||+|+|.+|+.|++|+
T Consensus       765 CnCnptGSlS~vCn~~GGqCqCkPnVVGR~CdqCApGtyGFGPsGCk~CdC~~~Gs~~~~Cd~~tGQC~C~~g~ygrqCn  844 (1758)
T KOG0994|consen  765 CNCNPTGSLSSVCNPNGGQCQCKPNVVGRRCDQCAPGTYGFGPSGCKACDCNSIGSLDKYCDKITGQCQCRPGTYGRQCN  844 (1758)
T ss_pred             cccCCCccccccccCCCceecccCccccccccccCCcccCcCCccCccccccccccccccccccccceeeccccchhhcc
Confidence            999999999999999999999999999999999999999995  899999986    35899999999999999999999


Q ss_pred             cCCCCCcCCCCCCCCccccCCCCCCCCCCcccCCCcee-eccCCcccCCCcccCCCcccCC------CCCCccccCCCc-
Q psy12394       1275 QCEPNTFGYDPIIGCEECNCHPHGVNGTQQCDLFDGSC-SCKENIVGRTCDHCVEGHWSFP------YCVPCECDLRGT- 1346 (1873)
Q Consensus      1275 ~C~~g~~g~~~~~~C~~C~C~~~gs~~~~~C~~~~G~C-~C~~~~~G~~C~~C~~G~~g~p------~C~~C~C~~~gs- 1346 (1873)
                      +|+||||||   ..|+||+||.|.    ..||+.+|.| .|+..++|..||+|..||||+|      .|+||+|+.+-. 
T Consensus       845 qCqpG~WgF---PeCr~CqCNgHA----~~Cd~~tGaCi~CqD~T~G~~CdrCl~GyyGdP~lg~g~~CrPCpCP~gp~S  917 (1758)
T KOG0994|consen  845 QCQPGYWGF---PECRPCQCNGHA----DTCDPITGACIDCQDSTTGHSCDRCLDGYYGDPRLGSGIGCRPCPCPDGPAS  917 (1758)
T ss_pred             ccCCCccCC---CcCccccccCcc----cccCccccccccccccccccchhhhhccccCCcccCCCCCCCCCCCCCCCcc
Confidence            999999998   479999999986    5999999999 6999999999999999999999      499999997532 


Q ss_pred             ---cccccCCC----CceeeccCccccCCCCcCCCCccccCCCCCCCCccccccCCCcccccCccccccccccccccccC
Q psy12394       1347 ---TIDICNQG----TAECYCKKNVYGAACDVCKEGTFDIQADNVDGCTRCFCFGKTTKCSSSNLYRSQLVYCKPCECSG 1419 (1873)
Q Consensus      1347 ---~~~~Cd~~----~G~C~C~~~~~G~~Cd~C~~g~~g~~~~~~~gC~~C~C~g~~~~C~~~~~~~~~~~~~~~~~~~~ 1419 (1873)
                         .++.|...    .-.|.|++||.|.+|+.|+++|||.+.. -..|.+|.|                         ++
T Consensus       918 g~~~A~sC~~d~~t~~ivC~C~~GY~G~RCe~CA~~~fGnP~~-GGtCq~CeC-------------------------~~  971 (1758)
T KOG0994|consen  918 GRQHADSCYLDTRTQQIVCHCQEGYSGSRCEICADNHFGNPSE-GGTCQKCEC-------------------------SN  971 (1758)
T ss_pred             chhccccccccccccceeeecccCccccchhhhcccccCCccc-CCccccccc-------------------------cC
Confidence               24566443    5689999999999999999999998754 444665555                         68


Q ss_pred             CCCCCCCCCccCCCCceeccccCCCCCccEEcCCCCCcCCCCCCCcccCCCCCCcccCccccCCCCCCCcccccCCCccc
Q psy12394       1420 NINRTDPGSCDSVTGECTGCLFNSAGDSCQYCAPGYYGNAVSLKNCVKCNCNPEGVLKTFAGCGSLPAGELCECKPKVQG 1499 (1873)
Q Consensus      1420 ~~~~~~~~~cd~~tG~C~~c~~nt~G~~c~~c~pg~yG~~~~~~~c~~c~c~~~~~~~~~~~~~~~~~~~~c~C~~~v~G 1499 (1873)
                      ||+..+|++||+.||+||+|+|+|+|++|+.|++|||||++ ..+|+.|.|+-.|++.+ ++|+  ..+|||+|++||+|
T Consensus       972 NiD~~d~~aCD~~TG~CLkCL~hTeG~hCe~Ck~Gf~GdA~-~q~CqrC~Cn~LGTn~~-~~CD--r~tGQCpClpNv~G 1047 (1758)
T KOG0994|consen  972 NIDLYDPGACDVATGACLKCLYHTEGDHCEHCKDGFYGDAL-RQNCQRCVCNFLGTNST-CHCD--RFTGQCPCLPNVQG 1047 (1758)
T ss_pred             CcCccCCCccchhhchhhhhhhcccccchhhccccchhHHH-HhhhhhheccccccCCc-cccc--cccCcCCCCccccc
Confidence            99999999999999999999999999999999999999998 56899999999999877 8888  78899999999999


Q ss_pred             ccccccCCCCcCCCCCCCCCCccCCCCCCCCcCCcccccCCCCcccccCCCCcCCccccCCCccccCCCCcCCccccccC
Q psy12394       1500 RICDECRPLYWNLKASNPDGCEDCDCYTLGTIGGIKNCNPKSGQCVCKATAMNRKCDACVDGTYALQDNNLFGCTECACD 1579 (1873)
Q Consensus      1500 ~~Cd~C~~~y~~~~~~~~~~C~~C~C~~~~s~~g~~~c~~~tgqC~C~~g~~g~~Cd~C~~g~~~~~~~~~~gc~~c~C~ 1579 (1873)
                      .+||+|++++|++..  ++||++|+||+.+   + .+|+.+||||+|||||.||.|++|++-||++|++   +|.+|+|+
T Consensus      1048 ~~CDqCA~N~w~laS--G~GCe~C~Cd~~~---~-pqCN~ftGQCqCkpGfGGR~C~qCqel~WGdP~~---~C~aCdCd 1118 (1758)
T KOG0994|consen 1048 VRCDQCAENHWNLAS--GEGCEPCNCDPIG---G-PQCNEFTGQCQCKPGFGGRTCSQCQELYWGDPNE---KCRACDCD 1118 (1758)
T ss_pred             ccccccccchhcccc--CCCCCccCCCccC---C-ccccccccceeccCCCCCcchhHHHHhhcCCCCC---CceecCCC
Confidence            999999999999964  8999999997632   2 5899999999999999999999999999999975   67777665


Q ss_pred             C
Q psy12394       1580 I 1580 (1873)
Q Consensus      1580 ~ 1580 (1873)
                      +
T Consensus      1119 ~ 1119 (1758)
T KOG0994|consen 1119 P 1119 (1758)
T ss_pred             C
Confidence            4



>KOG1836|consensus Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>KOG1836|consensus Back     alignment and domain information
>KOG3512|consensus Back     alignment and domain information
>KOG3512|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>smart00136 LamNT Laminin N-terminal domain (domain VI) Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>PF00055 Laminin_N: Laminin N-terminal (Domain VI); InterPro: IPR008211 Laminin is a large molecular weight glycoprotein present only in basement membranes in almost every animal tissue Back     alignment and domain information
>KOG3509|consensus Back     alignment and domain information
>KOG3509|consensus Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>smart00180 EGF_Lam Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation Back     alignment and domain information
>cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation Back     alignment and domain information
>smart00180 EGF_Lam Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>KOG1218|consensus Back     alignment and domain information
>KOG1218|consensus Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>KOG1388|consensus Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>KOG1388|consensus Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>PF03302 VSP: Giardia variant-specific surface protein; InterPro: IPR005127 During infection, the intestinal protozoan parasite Giardia lamblia virus undergoes continuous antigenic variation which is determined by diversification of the parasite's major surface antigen, named VSP (variant surface protein) Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>PF01414 DSL: Delta serrate ligand; InterPro: IPR001774 Ligands of the Delta/Serrate/lag-2 (DSL) family and their receptors, members of the lin-12/Notch family, mediate cell-cell interactions that specify cell fate in invertebrates and vertebrates Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1873
2y38_A403 Laminin Alpha5 Chain N-Terminal Fragment Length = 4 6e-59
2y38_A403 Laminin Alpha5 Chain N-Terminal Fragment Length = 4 2e-13
4aqs_A525 Laminin Beta1 Ln-Le1-4 Structure Length = 525 3e-33
4aqs_A525 Laminin Beta1 Ln-Le1-4 Structure Length = 525 7e-23
4aqs_A525 Laminin Beta1 Ln-Le1-4 Structure Length = 525 6e-21
4aqs_A525 Laminin Beta1 Ln-Le1-4 Structure Length = 525 5e-06
4aqt_A375 Laminin Gamma1 Ln-Le1-2 Structure Length = 375 4e-29
1klo_A162 Crystal Structure Of Three Consecutive Laminin-Type 5e-14
1klo_A162 Crystal Structure Of Three Consecutive Laminin-Type 3e-09
1npe_B164 Crystal Structure Of Nidogen/laminin Complex Length 6e-14
1npe_B164 Crystal Structure Of Nidogen/laminin Complex Length 3e-09
3zyj_B426 Netring1 In Complex With Ngl1 Length = 426 4e-10
3tbd_A338 Crystal Structure Of Domain Vi And Le1 Of Human Net 3e-08
3zyg_A353 Netring2 Lam And Egf1 Domains Length = 353 3e-08
1tle_A58 Le (Laminin-Type Egf-Like) Module Giii4 In Solution 2e-05
2ygq_A324 Wif Domain-Epidermal Growth Factor (Egf)-Like Domai 1e-04
>pdb|2Y38|A Chain A, Laminin Alpha5 Chain N-Terminal Fragment Length = 403 Back     alignment and structure

Iteration: 1

Score = 226 bits (577), Expect = 6e-59, Method: Compositional matrix adjust. Identities = 117/268 (43%), Positives = 152/268 (56%), Gaps = 50/268 (18%) Query: 1 MGNSPRPAVWALERSADNG----------------------------------------- 19 NSPRP +W LERS D G Sbjct: 127 FANSPRPDLWVLERSTDFGHTYQPWQFFASSKRDCLERFGPRTLERITQDDDVICTTEYS 186 Query: 20 ---------ITISLLDHRPSMKNFFNSTRLQEWTRATNVRLRLLRTKNLLGHLMSMADQD 70 I +SL++ RP NF S L+++T+ATN+RLR LRT LLGHLM A +D Sbjct: 187 RIVPLENGEIVVSLVNGRPGALNFSYSPLLRDFTKATNIRLRFLRTNTLLGHLMGKALRD 246 Query: 71 PTTTRRYFYSIKDISIGGRCRCNGHADVCDILDPEDPYHRICRCQHNTCGHNCEVCCPGY 130 PT TRRY+YSIKDISIGGRC C+GHADVCD DP DP+ C CQHNTCG +C+ CCPG+ Sbjct: 247 PTVTRRYYYSIKDISIGGRCVCHGHADVCDAKDPLDPFRLQCACQHNTCGGSCDRCCPGF 306 Query: 131 EQKAWRQSQSNKPFSCEPCNCHGHADKCVYDPMVDEKRLSVDIQGNYEGGGVCQECRDNT 190 Q+ W+ + ++ C+ CNCHGHA C YDP VD + S + Y+GGGVC +C+ +T Sbjct: 307 NQQPWKPATTDSANECQSCNCHGHAYDCYYDPEVDRREASQNQDNVYQGGGVCLDCQHHT 366 Query: 191 EGINCHQRVAGYYRPYGKHLNETDVCQP 218 GINC + + G++R + L+ VC+P Sbjct: 367 TGINCERCLPGFFRAPDQPLDSPHVCRP 394
>pdb|2Y38|A Chain A, Laminin Alpha5 Chain N-Terminal Fragment Length = 403 Back     alignment and structure
>pdb|4AQS|A Chain A, Laminin Beta1 Ln-Le1-4 Structure Length = 525 Back     alignment and structure
>pdb|4AQS|A Chain A, Laminin Beta1 Ln-Le1-4 Structure Length = 525 Back     alignment and structure
>pdb|4AQS|A Chain A, Laminin Beta1 Ln-Le1-4 Structure Length = 525 Back     alignment and structure
>pdb|4AQS|A Chain A, Laminin Beta1 Ln-Le1-4 Structure Length = 525 Back     alignment and structure
>pdb|4AQT|A Chain A, Laminin Gamma1 Ln-Le1-2 Structure Length = 375 Back     alignment and structure
>pdb|1KLO|A Chain A, Crystal Structure Of Three Consecutive Laminin-Type Epidermal Growth Factor-Like (Le) Modules Of Laminin Gamma1 Chain Harboring The Nidogen Binding Site Length = 162 Back     alignment and structure
>pdb|1KLO|A Chain A, Crystal Structure Of Three Consecutive Laminin-Type Epidermal Growth Factor-Like (Le) Modules Of Laminin Gamma1 Chain Harboring The Nidogen Binding Site Length = 162 Back     alignment and structure
>pdb|1NPE|B Chain B, Crystal Structure Of Nidogen/laminin Complex Length = 164 Back     alignment and structure
>pdb|1NPE|B Chain B, Crystal Structure Of Nidogen/laminin Complex Length = 164 Back     alignment and structure
>pdb|3ZYJ|B Chain B, Netring1 In Complex With Ngl1 Length = 426 Back     alignment and structure
>pdb|3TBD|A Chain A, Crystal Structure Of Domain Vi And Le1 Of Human Netrin-G2 Length = 338 Back     alignment and structure
>pdb|3ZYG|A Chain A, Netring2 Lam And Egf1 Domains Length = 353 Back     alignment and structure
>pdb|1TLE|A Chain A, Le (Laminin-Type Egf-Like) Module Giii4 In Solution At Ph 3.5 And 290 K, Nmr, 14 Structures Length = 58 Back     alignment and structure
>pdb|2YGQ|A Chain A, Wif Domain-Epidermal Growth Factor (Egf)-Like Domains 1-3 Of Human Wnt Inhibitory Factor 1 In Complex With 1,2-Dipalmitoylphosphatidylcholine Length = 324 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1873
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 2e-66
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 2e-29
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 7e-29
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 4e-28
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 4e-27
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 9e-27
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 1e-26
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 3e-24
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 2e-20
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 1e-13
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 6e-13
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 2e-11
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 4e-06
2y38_A403 Laminin subunit alpha-5; structural protein, cell 5e-49
2y38_A403 Laminin subunit alpha-5; structural protein, cell 4e-16
2y38_A403 Laminin subunit alpha-5; structural protein, cell 1e-11
2y38_A403 Laminin subunit alpha-5; structural protein, cell 4e-11
2y38_A403 Laminin subunit alpha-5; structural protein, cell 6e-11
2y38_A403 Laminin subunit alpha-5; structural protein, cell 3e-09
2y38_A403 Laminin subunit alpha-5; structural protein, cell 6e-09
2y38_A403 Laminin subunit alpha-5; structural protein, cell 7e-09
2y38_A403 Laminin subunit alpha-5; structural protein, cell 2e-08
2y38_A403 Laminin subunit alpha-5; structural protein, cell 7e-08
2y38_A403 Laminin subunit alpha-5; structural protein, cell 3e-07
2y38_A403 Laminin subunit alpha-5; structural protein, cell 8e-05
2y38_A403 Laminin subunit alpha-5; structural protein, cell 3e-04
2y38_A403 Laminin subunit alpha-5; structural protein, cell 3e-04
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 8e-37
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 9e-14
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 1e-13
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 2e-13
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 7e-13
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 2e-12
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 2e-12
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 5e-12
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 2e-11
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 2e-11
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 5e-10
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 2e-09
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 1e-06
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 4e-06
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 1e-25
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 2e-25
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 3e-24
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 2e-23
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 2e-23
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 3e-23
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 3e-21
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 9e-21
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 5e-19
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 5e-18
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 2e-14
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 8e-11
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 7e-10
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 8e-10
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 4e-09
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 9e-09
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 2e-08
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 1e-06
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 3e-04
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 7e-04
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 3e-25
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 3e-12
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 7e-12
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 1e-11
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 2e-10
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 4e-09
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 2e-08
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 2e-07
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 1e-06
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 4e-05
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 2e-04
3tbd_A338 Netrin-G2, laminet-2; laminin N-terminal domain, d 8e-22
3tbd_A338 Netrin-G2, laminet-2; laminin N-terminal domain, d 7e-08
3tbd_A338 Netrin-G2, laminet-2; laminin N-terminal domain, d 2e-07
3tbd_A338 Netrin-G2, laminet-2; laminin N-terminal domain, d 3e-07
3tbd_A338 Netrin-G2, laminet-2; laminin N-terminal domain, d 4e-07
3tbd_A338 Netrin-G2, laminet-2; laminin N-terminal domain, d 1e-06
3tbd_A338 Netrin-G2, laminet-2; laminin N-terminal domain, d 2e-06
3tbd_A338 Netrin-G2, laminet-2; laminin N-terminal domain, d 1e-05
3tbd_A338 Netrin-G2, laminet-2; laminin N-terminal domain, d 1e-04
3tbd_A338 Netrin-G2, laminet-2; laminin N-terminal domain, d 1e-04
3tbd_A338 Netrin-G2, laminet-2; laminin N-terminal domain, d 3e-04
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 3e-18
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 1e-17
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 4e-14
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 6e-14
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 8e-14
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 5e-10
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 4e-08
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 3e-06
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 9e-14
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 1e-11
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 9e-11
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 3e-09
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 5e-08
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 7e-08
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 1e-06
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 5e-05
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 5e-13
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 2e-11
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 7e-11
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 1e-10
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 1e-09
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 1e-09
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 2e-09
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 4e-08
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 2e-07
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 2e-06
1skz_A119 Antistasin; factor XA inhibitor, serine protease i 9e-10
1skz_A119 Antistasin; factor XA inhibitor, serine protease i 8e-09
1skz_A119 Antistasin; factor XA inhibitor, serine protease i 3e-08
1skz_A119 Antistasin; factor XA inhibitor, serine protease i 1e-06
1skz_A119 Antistasin; factor XA inhibitor, serine protease i 1e-06
1skz_A119 Antistasin; factor XA inhibitor, serine protease i 2e-06
1skz_A119 Antistasin; factor XA inhibitor, serine protease i 2e-06
1skz_A119 Antistasin; factor XA inhibitor, serine protease i 4e-06
1skz_A119 Antistasin; factor XA inhibitor, serine protease i 3e-05
1skz_A119 Antistasin; factor XA inhibitor, serine protease i 3e-05
1skz_A119 Antistasin; factor XA inhibitor, serine protease i 5e-05
1skz_A119 Antistasin; factor XA inhibitor, serine protease i 8e-05
1skz_A119 Antistasin; factor XA inhibitor, serine protease i 1e-04
1skz_A119 Antistasin; factor XA inhibitor, serine protease i 8e-04
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 3e-09
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 7e-06
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 2e-05
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 7e-05
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 8e-08
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 7e-07
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 2e-06
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 8e-05
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 7e-04
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 1e-04
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 2e-04
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 2e-04
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 4e-04
1yy9_A624 Epidermal growth factor receptor; cell surface rec 6e-04
1igr_A478 Insulin-like growth factor receptor 1; hormone rec 7e-04
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
 Score =  234 bits (598), Expect = 2e-66
 Identities = 99/357 (27%), Positives = 160/357 (44%), Gaps = 38/357 (10%)

Query: 12  LERSADNGITISLLDHRPSMKNFFNSTRLQEWTRATNVRLRLLRTKNLLGHLMSMADQDP 71
           +E S +  +    LD    +     S R+Q   + TN+R++ ++   L  +L+   D   
Sbjct: 180 IEPSTEGEVIFRALDPAFKI-EDPYSPRIQNLLKITNLRIKFVKLHTLGDNLL---DSRM 235

Query: 72  TTTRRYFYSIKDISIGGRCRCNGHADVCDILDP-----EDPYHRICRCQHNTCGHNCEVC 126
               +Y+Y++ D+ + G C C GHA  C  +D      E   H  C C+HNT G NCE+C
Sbjct: 236 EIREKYYYAVYDMVVRGNCFCYGHASECAPVDGVNEEVEGMVHGHCMCRHNTKGLNCELC 295

Query: 127 CPGYEQKAWRQSQSNKPFSCEPCNCHGHADKCVYDPMVDEKRLSVDIQGNYEGGGVCQEC 186
              Y    WR ++     +C+ CNC+ H+  C +D        +V +      GGVC  C
Sbjct: 296 MDFYHDLPWRPAEGRNSNACKKCNCNEHSSSCHFDM-------AVFLATGNVSGGVCDNC 348

Query: 187 RDNTEGINCHQRVAGYYRPYGKHLNETDVCQPCQCAFH----------YATGNCAEGTGK 236
           + NT G NC Q    Y++   + + + ++C+PC C             Y   +     G+
Sbjct: 349 QHNTMGRNCEQCKPFYFQHPERDIRDPNLCEPCTCDPAGSENGGICDGYTDFSVGLIAGQ 408

Query: 237 CECRPEYTKPDCNSCAFGYFGYP-----NCEPCKCHMNGTLDFY--CEPASGQQCPCKEN 289
           C C+       C+ C  G++         C+ C C+  GT+     C+  +G  C CK  
Sbjct: 409 CRCKLHVEGERCDVCKEGFYDLSAEDPYGCKSCACNPLGTIPGGNPCDSETG-YCYCKRL 467

Query: 290 YAGDHCDTCAQGYYNFPT----CSPCECNAVGSLSDLCEVDSGNCTCRNNFAGRTCD 342
             G  CD C   ++        C PC+C+  G+L++ C  DSG C+C  +  GR C+
Sbjct: 468 VTGQRCDQCLPQHWGLSNDLDGCRPCDCDLGGALNNSCSEDSGQCSCLPHMIGRQCN 524


>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Length = 403 Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Length = 403 Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Length = 403 Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Length = 403 Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Length = 403 Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Length = 403 Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Length = 403 Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Length = 403 Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Length = 403 Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Length = 403 Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Length = 403 Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Length = 403 Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Length = 403 Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Length = 403 Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3tbd_A Netrin-G2, laminet-2; laminin N-terminal domain, domain VI, LE-domain, N neuronal cell adhesion molecule, netrin G ligand 2, nervous system; HET: NAG; 1.80A {Homo sapiens} PDB: 3zyg_A* 3zyi_B* Length = 338 Back     alignment and structure
>3tbd_A Netrin-G2, laminet-2; laminin N-terminal domain, domain VI, LE-domain, N neuronal cell adhesion molecule, netrin G ligand 2, nervous system; HET: NAG; 1.80A {Homo sapiens} PDB: 3zyg_A* 3zyi_B* Length = 338 Back     alignment and structure
>3tbd_A Netrin-G2, laminet-2; laminin N-terminal domain, domain VI, LE-domain, N neuronal cell adhesion molecule, netrin G ligand 2, nervous system; HET: NAG; 1.80A {Homo sapiens} PDB: 3zyg_A* 3zyi_B* Length = 338 Back     alignment and structure
>3tbd_A Netrin-G2, laminet-2; laminin N-terminal domain, domain VI, LE-domain, N neuronal cell adhesion molecule, netrin G ligand 2, nervous system; HET: NAG; 1.80A {Homo sapiens} PDB: 3zyg_A* 3zyi_B* Length = 338 Back     alignment and structure
>3tbd_A Netrin-G2, laminet-2; laminin N-terminal domain, domain VI, LE-domain, N neuronal cell adhesion molecule, netrin G ligand 2, nervous system; HET: NAG; 1.80A {Homo sapiens} PDB: 3zyg_A* 3zyi_B* Length = 338 Back     alignment and structure
>3tbd_A Netrin-G2, laminet-2; laminin N-terminal domain, domain VI, LE-domain, N neuronal cell adhesion molecule, netrin G ligand 2, nervous system; HET: NAG; 1.80A {Homo sapiens} PDB: 3zyg_A* 3zyi_B* Length = 338 Back     alignment and structure
>3tbd_A Netrin-G2, laminet-2; laminin N-terminal domain, domain VI, LE-domain, N neuronal cell adhesion molecule, netrin G ligand 2, nervous system; HET: NAG; 1.80A {Homo sapiens} PDB: 3zyg_A* 3zyi_B* Length = 338 Back     alignment and structure
>3tbd_A Netrin-G2, laminet-2; laminin N-terminal domain, domain VI, LE-domain, N neuronal cell adhesion molecule, netrin G ligand 2, nervous system; HET: NAG; 1.80A {Homo sapiens} PDB: 3zyg_A* 3zyi_B* Length = 338 Back     alignment and structure
>3tbd_A Netrin-G2, laminet-2; laminin N-terminal domain, domain VI, LE-domain, N neuronal cell adhesion molecule, netrin G ligand 2, nervous system; HET: NAG; 1.80A {Homo sapiens} PDB: 3zyg_A* 3zyi_B* Length = 338 Back     alignment and structure
>3tbd_A Netrin-G2, laminet-2; laminin N-terminal domain, domain VI, LE-domain, N neuronal cell adhesion molecule, netrin G ligand 2, nervous system; HET: NAG; 1.80A {Homo sapiens} PDB: 3zyg_A* 3zyi_B* Length = 338 Back     alignment and structure
>3tbd_A Netrin-G2, laminet-2; laminin N-terminal domain, domain VI, LE-domain, N neuronal cell adhesion molecule, netrin G ligand 2, nervous system; HET: NAG; 1.80A {Homo sapiens} PDB: 3zyg_A* 3zyi_B* Length = 338 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>1skz_A Antistasin; factor XA inhibitor, serine protease inhibitor, thrombosis; 1.90A {Haementeria officinalis} SCOP: g.3.15.1 g.3.15.1 Length = 119 Back     alignment and structure
>1skz_A Antistasin; factor XA inhibitor, serine protease inhibitor, thrombosis; 1.90A {Haementeria officinalis} SCOP: g.3.15.1 g.3.15.1 Length = 119 Back     alignment and structure
>1skz_A Antistasin; factor XA inhibitor, serine protease inhibitor, thrombosis; 1.90A {Haementeria officinalis} SCOP: g.3.15.1 g.3.15.1 Length = 119 Back     alignment and structure
>1skz_A Antistasin; factor XA inhibitor, serine protease inhibitor, thrombosis; 1.90A {Haementeria officinalis} SCOP: g.3.15.1 g.3.15.1 Length = 119 Back     alignment and structure
>1skz_A Antistasin; factor XA inhibitor, serine protease inhibitor, thrombosis; 1.90A {Haementeria officinalis} SCOP: g.3.15.1 g.3.15.1 Length = 119 Back     alignment and structure
>1skz_A Antistasin; factor XA inhibitor, serine protease inhibitor, thrombosis; 1.90A {Haementeria officinalis} SCOP: g.3.15.1 g.3.15.1 Length = 119 Back     alignment and structure
>1skz_A Antistasin; factor XA inhibitor, serine protease inhibitor, thrombosis; 1.90A {Haementeria officinalis} SCOP: g.3.15.1 g.3.15.1 Length = 119 Back     alignment and structure
>1skz_A Antistasin; factor XA inhibitor, serine protease inhibitor, thrombosis; 1.90A {Haementeria officinalis} SCOP: g.3.15.1 g.3.15.1 Length = 119 Back     alignment and structure
>1skz_A Antistasin; factor XA inhibitor, serine protease inhibitor, thrombosis; 1.90A {Haementeria officinalis} SCOP: g.3.15.1 g.3.15.1 Length = 119 Back     alignment and structure
>1skz_A Antistasin; factor XA inhibitor, serine protease inhibitor, thrombosis; 1.90A {Haementeria officinalis} SCOP: g.3.15.1 g.3.15.1 Length = 119 Back     alignment and structure
>1skz_A Antistasin; factor XA inhibitor, serine protease inhibitor, thrombosis; 1.90A {Haementeria officinalis} SCOP: g.3.15.1 g.3.15.1 Length = 119 Back     alignment and structure
>1skz_A Antistasin; factor XA inhibitor, serine protease inhibitor, thrombosis; 1.90A {Haementeria officinalis} SCOP: g.3.15.1 g.3.15.1 Length = 119 Back     alignment and structure
>1skz_A Antistasin; factor XA inhibitor, serine protease inhibitor, thrombosis; 1.90A {Haementeria officinalis} SCOP: g.3.15.1 g.3.15.1 Length = 119 Back     alignment and structure
>1skz_A Antistasin; factor XA inhibitor, serine protease inhibitor, thrombosis; 1.90A {Haementeria officinalis} SCOP: g.3.15.1 g.3.15.1 Length = 119 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Length = 188 Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Length = 188 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Length = 217 Back     alignment and structure
>1yy9_A Epidermal growth factor receptor; cell surface receptor, tyrosine kinase, glycoprotein, antigen:antibody complex, FAB fragment, antitumor, drug; HET: NDG NAG BMA MAN; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 PDB: 3qwq_A* 1nql_A* 3b2v_A* 1ivo_A* 3njp_A* Length = 624 Back     alignment and structure
>1igr_A Insulin-like growth factor receptor 1; hormone receptor, insulin receptor family; HET: NAG FUC BMA MAN; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 Length = 478 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1873
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 100.0
2y38_A403 Laminin subunit alpha-5; structural protein, cell 100.0
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 100.0
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 100.0
3tbd_A338 Netrin-G2, laminet-2; laminin N-terminal domain, d 99.95
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 99.85
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 99.79
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 99.79
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 99.58
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 99.57
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.56
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.53
2y38_A403 Laminin subunit alpha-5; structural protein, cell 99.52
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.47
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.4
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 99.38
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 99.3
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 99.29
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 99.25
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 99.23
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 99.23
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 99.19
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.03
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.0
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 98.97
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 98.87
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 98.82
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 98.78
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 98.75
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 98.59
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 98.35
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 98.14
2bou_A143 EGF-like module containing mucin-like hormone rece 98.08
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 98.04
2bou_A143 EGF-like module containing mucin-like hormone rece 97.98
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 97.96
1yo8_A634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 97.87
1yo8_A634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 97.84
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 97.81
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 97.79
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 97.69
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 97.59
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 97.58
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 97.57
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 97.5
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 97.37
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 97.27
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 97.19
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 97.15
3tbd_A338 Netrin-G2, laminet-2; laminin N-terminal domain, d 97.09
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 97.05
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 97.04
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 96.98
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 96.95
1aut_L114 Activated protein C; serine proteinase, plasma cal 96.94
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 96.93
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 96.85
2vh0_B134 Activated factor XA light chain; serine protease, 96.79
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 96.79
1aut_L114 Activated protein C; serine proteinase, plasma cal 96.79
2vh0_B134 Activated factor XA light chain; serine protease, 96.78
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 96.78
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 96.73
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 96.62
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 96.39
1a3p_A45 Epidermal growth factor; disulfide connectivities, 96.27
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 96.24
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 96.22
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 96.16
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 96.04
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 96.03
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 96.02
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 95.96
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 95.76
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 95.43
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 95.39
2k2s_B61 Micronemal protein 6; microneme protein complex, c 95.27
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 95.17
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 95.16
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 95.01
1nql_B53 Epidermal growth factor; cell surface receptor, ty 94.85
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 94.81
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 94.24
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 94.2
1a3p_A45 Epidermal growth factor; disulfide connectivities, 94.09
1nql_B53 Epidermal growth factor; cell surface receptor, ty 93.95
2k2s_B61 Micronemal protein 6; microneme protein complex, c 92.92
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 92.12
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 92.03
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 91.94
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 91.88
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 91.64
3p5b_L400 Low density lipoprotein receptor variant; B-propel 90.91
3p5b_L400 Low density lipoprotein receptor variant; B-propel 90.81
3v65_B386 Low-density lipoprotein receptor-related protein; 89.98
3v65_B386 Low-density lipoprotein receptor-related protein; 88.4
2ddu_A387 Reelin; beta-jelly-roll, signaling protein; 2.05A 88.05
1q4g_A553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 87.32
3nt1_A587 Prostaglandin-endoperoxide synthase 2; prostagland 85.77
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 85.59
2i9a_A145 Urokinase-type plasminogen activator; growth facto 82.53
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 82.01
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 81.96
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 81.56
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 80.88
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
Probab=100.00  E-value=2.5e-53  Score=546.39  Aligned_cols=329  Identities=32%  Similarity=0.765  Sum_probs=249.7

Q ss_pred             CCCCCCceEEEeeccCC-----------------------------------------------eEEEccCCCCCCCCCC
Q psy12394          3 NSPRPAVWALERSADNG-----------------------------------------------ITISLLDHRPSMKNFF   35 (1873)
Q Consensus         3 ~sprp~~~~~ers~d~g-----------------------------------------------i~~s~~~~rp~~~~~~   35 (1873)
                      +||||++||||||+|+|                                               |+|++|++||++.+ .
T Consensus       124 ~s~rP~~~~ieks~d~g~tw~p~qy~a~~C~~~f~~~~~~~~~~~~~v~Ct~~~s~~~p~~~g~v~~~~~~~~~~~~~-~  202 (525)
T 4aqs_A          124 KTFRPAAMLIERSSDFGKAWGVYRYFAYDCESSFPGISTGPMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIED-P  202 (525)
T ss_dssp             SSCCCSEEEEEEESSTTSSCEEEEEEESSTTTTSSSSCCSCCSSTTCCCEECTTCCSCSTTTCEEEEESSCSSSCCSC-T
T ss_pred             ECCCCCeEEEEEecCCCCCCcceeeehhhhhhhcCCCCCCCCCCCCcceecccCCCCCCCCCCeEEEEecCCCcccCC-C
Confidence            79999999999999988                                               99999999999865 5


Q ss_pred             CchhhhhheeeeeeeEeeccccccccccccccCCCCCcceeeeEEeeeeeeeeeeccCCCCCcCccCCC-----CCCccc
Q psy12394         36 NSTRLQEWTRATNVRLRLLRTKNLLGHLMSMADQDPTTTRRYFYSIKDISIGGRCRCNGHADVCDILDP-----EDPYHR  110 (1873)
Q Consensus        36 ~s~~l~~~~~at~ir~~~~~~~t~~~~~~~~~~~~~~~~~~~yYai~d~~v~grC~C~gHa~~C~~~~~-----~~~~~~  110 (1873)
                      +|++||||++||||||||+|++||++++|+   .++.++++|||||+||+|+|||+|||||++|++.+.     .+..++
T Consensus       203 ~s~~l~~~~~~t~iri~~~~~~~~~~~~~~---~~~~~~~~~~Yai~di~v~grC~CnGHa~~C~p~~g~~~~~~g~~~g  279 (525)
T 4aqs_A          203 YSPRIQNLLKITNLRIKFVKLHTLGDNLLD---SRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGVNEEVEGMVHG  279 (525)
T ss_dssp             TSHHHHHHHEEEEEEEEEEECCCTTCCCTT---CCHHHHTTCCCEEEEEEEEEECCCTTBCSCEECC------CCSCCCC
T ss_pred             CChhhhhhhhhhhhhhheeccccccccccc---ccccccccccEEEEeeEECeEeccCCccccCCCcCCcccCCCCCcCc
Confidence            699999999999999999999999999875   567788999999999999999999999999987542     345678


Q ss_pred             eeecCCCCCCCCCCCCCCCccCCcCCcCCCCCCCCccCCCCCCCCCccccCccccccCcccccCcCcCCCceeCCCCCCC
Q psy12394        111 ICRCQHNTCGHNCEVCCPGYEQKAWRQSQSNKPFSCEPCNCHGHADKCVYDPMVDEKRLSVDIQGNYEGGGVCQECRDNT  190 (1873)
Q Consensus       111 ~C~C~h~t~G~~Ce~c~p~~~~~p~~~~~~~~~~~C~~C~C~~~~~~C~~d~~~~~~~~s~~~~g~~~~GG~C~~C~~~~  190 (1873)
                      +|+|+|||+|++||+|+|+|++.||++++....+.+..|+|++|+..|.++......       ..+.+||+|.+|.++|
T Consensus       280 ~C~C~~G~~G~~Ce~C~~g~~~~p~~~~~c~~~~~~~~C~C~~~~~~C~~d~~~c~~-------~~~~~gg~C~~C~~g~  352 (525)
T 4aqs_A          280 HCMCRHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSSSCHFDMAVFLA-------TGNVSGGVCDNCQHNT  352 (525)
T ss_dssp             EECCCTTEESSSSCEECTTCCSSCCCCCBTTBCCCCCCCCCTTSCSEEEECHHHHHH-------TTSSCCEEEESCCTTE
T ss_pred             cccCcCCCcCCCCcCCCCccCCCccCCCcccCCCcccccccCCCCCCCCCCcccccc-------cCccCCCcccCCCCCC
Confidence            999999999999999999999999999999899999999999999999998876543       3456899999999999


Q ss_pred             CCCCCCCCCCCCccCCCCCCCCCCCCccCCCCCCC--CCCeeec--------CCCceecCCCCcCCCCcccCCcccCCC-
Q psy12394        191 EGINCHQRVAGYYRPYGKHLNETDVCQPCQCAFHY--ATGNCAE--------GTGKCECRPEYTKPDCNSCAFGYFGYP-  259 (1873)
Q Consensus       191 ~G~~Ce~C~~g~~~~~~~~~~~~~~C~~C~C~~~~--n~g~C~~--------~~g~C~C~~G~~G~~Ce~C~~g~~g~~-  259 (1873)
                      +|.+|++|.++|++.+.......+.+.+|.|++..  ++..|..        ..+.|.|+++|.|.+|++|++||++.+ 
T Consensus       353 ~G~~Ce~C~~g~~~~~~~~~~~~~~~~~C~C~~~~~~~~~~C~~~~~~~~~~~~~~C~C~~g~~G~~C~~C~~Gy~G~~c  432 (525)
T 4aqs_A          353 MGRNCEQCKPFYFQHPERDIRDPNLCEPCTCDPAGSENGGICDGYTDFSVGLIAGQCRCKLHVEGERCDVCKEGFYDLSA  432 (525)
T ss_dssp             ESTTSCEECTTEEECSSSCTTCTTCEEECCCCTTTBSGGGCCCCSCBGGGTBCSSCCCBCTTEETTTTCEECTTEECCCT
T ss_pred             CCCCcccccCcccccCCCCCCCCCCCcCCCCCCCCCCCCccccCCCCCCcCCCCCccCCCCCCCCCcccCCCCCCcCCCC
Confidence            99999999999999998888888888899887654  2344432        346899999999999999999999865 


Q ss_pred             ----CCCCCCCCCCCCC--CceecCCCCCcccCCCCCccCCCccCCCCCCCC----CCCCCCCcCCCCCCCCcccCCCcc
Q psy12394        260 ----NCEPCKCHMNGTL--DFYCEPASGQQCPCKENYAGDHCDTCAQGYYNF----PTCSPCECNAVGSLSDLCEVDSGN  329 (1873)
Q Consensus       260 ----~C~~c~C~~~gt~--~~~C~~~~G~~C~C~~g~~G~~Ce~C~~Gf~g~----~~C~~c~C~~~gs~~~~C~~~~g~  329 (1873)
                          .|.+++|++.|+.  ++.|+..+| +|.|++||+|.+||+|++||+++    ..|++|+|+++|+.+..|+..+|+
T Consensus       433 ~~~~~C~~C~C~~~gtc~~~~~Cd~~tg-~C~C~~g~~G~~Ce~C~~G~~g~~~~~~~C~~C~C~~~gs~~~~C~~~tG~  511 (525)
T 4aqs_A          433 EDPYGCKSCACNPLGTIPGGNPCDSETG-YCYCKRLVTGQRCDQCLPQHWGLSNDLDGCRPCDCDLGGALNNSCSEDSGQ  511 (525)
T ss_dssp             TSTTSSEECCCCTTTBCCSSCCBCTTTC-CBCBCTTCCSTTTCC------------------------------------
T ss_pred             CCCCCCccCCCCCCceecCCCcccCCCC-EEECCCCCcCCCcccCCCCccCCCCCCCCCcCCCCCCCCccCCccCCCCCe
Confidence                4888999988764  457888778 99999999999999999999986    349999999999999999999999


Q ss_pred             cccCCCcccCCCcc
Q psy12394        330 CTCRNNFAGRTCDS  343 (1873)
Q Consensus       330 C~C~~G~~G~~Ce~  343 (1873)
                      |.|++||+|.+||+
T Consensus       512 C~C~~G~~G~~Ceq  525 (525)
T 4aqs_A          512 CSCLPHMIGRQCNE  525 (525)
T ss_dssp             --------------
T ss_pred             eECCCCCcCCCCCC
Confidence            99999999999984



>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3tbd_A Netrin-G2, laminet-2; laminin N-terminal domain, domain VI, LE-domain, N neuronal cell adhesion molecule, netrin G ligand 2, nervous system; HET: NAG; 1.80A {Homo sapiens} PDB: 3zyg_A* 3zyi_B* Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>3tbd_A Netrin-G2, laminet-2; laminin N-terminal domain, domain VI, LE-domain, N neuronal cell adhesion molecule, netrin G ligand 2, nervous system; HET: NAG; 1.80A {Homo sapiens} PDB: 3zyg_A* 3zyi_B* Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2ddu_A Reelin; beta-jelly-roll, signaling protein; 2.05A {Mus musculus} Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1873
d1kloa256 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (M 4e-10
d1kloa256 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (M 8e-06
d1kloa256 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (M 1e-05
d1kloa256 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (M 4e-05
d1kloa256 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (M 1e-04
d1kloa256 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (M 7e-04
d1kloa256 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (M 0.001
d1kloa256 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (M 0.003
d1kloa256 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (M 0.003
d1kloa351 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( 6e-09
d1kloa351 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( 4e-08
d1kloa351 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( 7e-08
d1kloa351 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( 8e-08
d1kloa351 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( 1e-07
d1kloa351 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( 2e-06
d1kloa351 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( 2e-06
d1kloa351 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( 4e-06
d1kloa351 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( 6e-06
d1kloa351 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( 2e-05
d1kloa351 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( 2e-05
d1kloa351 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( 3e-05
d1kloa351 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( 7e-05
d1kloa351 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( 7e-05
d1kloa351 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( 4e-04
d1kloa351 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( 4e-04
d1kloa351 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( 0.001
d1kloa351 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( 0.002
>d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 56 Back     information, alignment and structure

class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: Laminin-type module
domain: Laminin gamma1 chain
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 54.9 bits (132), Expect = 4e-10
 Identities = 21/54 (38%), Positives = 34/54 (62%)

Query: 1415 CECSGNINRTDPGSCDSVTGECTGCLFNSAGDSCQYCAPGYYGNAVSLKNCVKC 1468
            C+C+ NI+    G+C+ +TGEC  C++N+AG  C  C  G++GN ++     KC
Sbjct: 1    CQCNDNIDPNAVGNCNRLTGECLKCIYNTAGFYCDRCKEGFFGNPLAPNPADKC 54


>d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 56 Back     information, alignment and structure
>d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 56 Back     information, alignment and structure
>d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 56 Back     information, alignment and structure
>d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 56 Back     information, alignment and structure
>d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 56 Back     information, alignment and structure
>d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 56 Back     information, alignment and structure
>d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 56 Back     information, alignment and structure
>d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 56 Back     information, alignment and structure
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 Back     information, alignment and structure
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 Back     information, alignment and structure
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 Back     information, alignment and structure
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 Back     information, alignment and structure
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 Back     information, alignment and structure
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 Back     information, alignment and structure
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 Back     information, alignment and structure
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 Back     information, alignment and structure
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 Back     information, alignment and structure
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 Back     information, alignment and structure
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 Back     information, alignment and structure
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 Back     information, alignment and structure
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 Back     information, alignment and structure
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 Back     information, alignment and structure
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 Back     information, alignment and structure
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 Back     information, alignment and structure
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 Back     information, alignment and structure
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1873
d1kloa351 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 98.81
d1kloa256 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 98.77
d1kloa256 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 98.54
d1kloa351 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 98.53
d1kloa155 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 98.05
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 97.72
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 97.68
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 97.65
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 97.65
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 97.64
d1kloa155 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 97.42
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.18
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.18
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 97.18
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 97.18
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 97.15
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 97.1
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 96.99
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 96.9
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 96.74
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 96.72
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 96.71
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 96.61
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 96.58
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 96.49
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 96.32
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 96.32
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 96.26
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 96.01
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 95.87
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 95.69
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 95.6
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 95.35
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 95.02
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 94.95
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 94.19
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 92.82
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 92.42
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 90.63
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 90.27
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 89.86
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 87.55
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 87.2
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 86.21
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: Laminin-type module
domain: Laminin gamma1 chain
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=98.81  E-value=6.9e-10  Score=93.36  Aligned_cols=48  Identities=29%  Similarity=0.845  Sum_probs=42.0

Q ss_pred             ccCCCCCCC-CCCcccCCCceeeccCCcccCCCcccCCCcccCCCCCCc
Q psy12394       1292 CNCHPHGVN-GTQQCDLFDGSCSCKENIVGRTCDHCVEGHWSFPYCVPC 1339 (1873)
Q Consensus      1292 C~C~~~gs~-~~~~C~~~~G~C~C~~~~~G~~C~~C~~G~~g~p~C~~C 1339 (1873)
                      |+|++.|+. ....||+.+|||.||++|+|++||+|++|||+++.+..|
T Consensus         1 C~C~~~Gs~~~~~~Cd~~tGqC~Ck~~v~G~~Cd~C~~g~~~~~~~~gC   49 (51)
T d1kloa3           1 CACNPYGTVQQQSSCNPVTGQCQCLPHVSGRDCGTCDPGYYNLQSGQGC   49 (51)
T ss_dssp             CCCCTTTBGGGCCCCCTTTCCCCBCTTEESTTCCEECTTCBCGGGSSCC
T ss_pred             CcCCCCcccCCCCccCCCCCeecCCCCCcCCCcccccccccCCCCCCCC
Confidence            789999974 234799999999999999999999999999999876654



>d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure