Psyllid ID: psy12445

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150

MKKSHLRFAYTETSLRYMGIWYEAERYFAVFEFAGKCVSANYTNEGNGIYRVVNTQTSSITGITSNIEGEIRYMGIWYEAERYFAVFEFAGKCVSANYTNEGNGIYRVVNTQTSSITGITSNIEGEIRVFERSDTSKFFIKFPSLPNFPV

ccccccccccccccccccEEEEEEEEcccccccccEEEEEEEEcccccEEEEEEccccccccccccccccccccEEEEEEEEEccccccccEEEEEEEEEccccEEEEEEcEEEcccccEEEEEEEEEEcccccccEEEEEEcccccccc

cccccEEEcccHHHHHHHHHHHHHHHHHHHEEEccEEEEEEEEEccccEEEEEEcEEccccccccccccEEEEEEEEEEEHHccHHEEEccEEEEEEEEEccccEEEEEEcEEccccccEEEEEEEEEEcccccccEEEEEEcccccccc

mkkshlrfayteTSLRYMGIWYEAERYFAVFEFAGKcvsanytnegngIYRVVNTqtssitgitsnieGEIRYMGIWYEAERYFAVFEFAGKcvsanytnegngIYRVVNTqtssitgitsniegeirvfersdtskffikfpslpnfpv

mkkshlrfaytetslryMGIWYEAERYFAVFEFAGKCVSANYTNEGNGIYRvvntqtssitgitsnieGEIRYMGIWYEAERYFAVFEFAGKCVSANYTNEGNGIYRVvntqtssitgitsniegeiRVFErsdtskffikfpslpnfpv

MKKSHLRFAYTETSLRYMGIWYEAERYFAVFEFAGKCVSANYTNEGNGIYRVVNTQTSSITGITSNIEGEIRYMGIWYEAERYFAVFEFAGKCVSANYTNEGNGIYRVVNTQTSSITGITSNIEGEIRVFERSDTSKFFIKFPSLPNFPV

*****LRFAYTETSLRYMGIWYEAERYFAVFEFAGKCVSANYTNEGNGIYRVVNTQTSSITGITSNIEGEIRYMGIWYEAERYFAVFEFAGKCVSANYTNEGNGIYRVVNTQTSSITGITSNIEGEIRVFERSDTSKFFIKF********

***SHLRFAYTETSLRYMGIWYEAERYFAVFEFAGKCVSANYTNEGNGIYRVVNTQTSSITGITSNIEGEIRYMGIWYEAERYFAVFEFAGKCVSANYTNEGNGIYRVVNTQTSSITGITSNIEGEIRVFERSDTSKFFIKFPSLPNFP*

MKKSHLRFAYTETSLRYMGIWYEAERYFAVFEFAGKCVSANYTNEGNGIYRVVNTQTSSITGITSNIEGEIRYMGIWYEAERYFAVFEFAGKCVSANYTNEGNGIYRVVNTQTSSITGITSNIEGEIRVFERSDTSKFFIKFPSLPNFPV

***SHLRFAYTETSLRYMGIWYEAERYFAVFEFAGKCVSANYTNEGNGIYRVVNTQTSSITGITSNIEGEIRYMGIWYEAERYFAVFEFAGKCVSANYTNEGNGIYRVVNTQTSSITGITSNIEGEIRVFERSDTSKFFIKFPSLPN***

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MKKSHLRFAYTETSLRYMGIWYEAERYFAVFEFAGKCVSANYTNEGNGIYRVVNTQTSSITGITSNIEGEIRYMGIWYEAERYFAVFEFAGKCVSANYTNEGNGIYRVVNTQTSSITGITSNIEGEIRVFERSDTSKFFIKFPSLPNFPV

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		150	2.2.26 [Sep-21-2011]
P05090		189	Apolipoprotein D OS=Homo	yes	N/A	0.486	0.386	0.354	6e-06
P51910		189	Apolipoprotein D OS=Mus m	yes	N/A	0.506	0.402	0.354	8e-06
Q8SPI0		189	Apolipoprotein D OS=Macac	N/A	N/A	0.486	0.386	0.354	1e-05
Q32KY0		189	Apolipoprotein D OS=Bos t	yes	N/A	0.486	0.386	0.354	2e-05
P51909		189	Apolipoprotein D OS=Cavia	yes	N/A	0.486	0.386	0.367	4e-05
P23593		189	Apolipoprotein D OS=Rattu	yes	N/A	0.48	0.380	0.351	4e-05
P37153		189	Apolipoprotein D OS=Oryct	yes	N/A	0.46	0.365	0.352	0.0002

>sp\|P05090\|APOD_HUMAN Apolipoprotein D OS=Homo sapiens GN=APOD PE=1 SV=1	Back alignment and function desciption

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 43/79 (54%), Gaps = 6/79 (7%)

Query: 72  RYMGIWYEAERYFAVFEFAGKCVSANYTNEGNGIYRVVNTQTSSITGITSNIEGEIRVFE 131
           +Y+G WYE E+    FE  G+C+ ANY+   NG  +V+N +  +  G  + IEGE     
Sbjct: 41  KYLGRWYEIEKIPTTFE-NGRCIQANYSLMENGKIKVLNQELRA-DGTVNQIEGEATPVN 98

Query: 132 RSDTSKFFIKF----PSLP 146
            ++ +K  +KF    PS P
Sbjct: 99  LTEPAKLEVKFSWFMPSAP 117

APOD occurs in the macromolecular complex with lecithin-cholesterol acyltransferase. It is probably involved in the transport and binding of bilin. Appears to be able to transport a variety of ligands in a number of different contexts.
Homo sapiens (taxid: 9606)

>sp\|P51910\|APOD_MOUSE Apolipoprotein D OS=Mus musculus GN=Apod PE=2 SV=1	Back alignment and function description

>sp\|Q8SPI0\|APOD_MACFA Apolipoprotein D OS=Macaca fascicularis GN=APOD PE=2 SV=1	Back alignment and function description

>sp\|Q32KY0\|APOD_BOVIN Apolipoprotein D OS=Bos taurus GN=APOD PE=2 SV=1	Back alignment and function description

>sp\|P51909\|APOD_CAVPO Apolipoprotein D OS=Cavia porcellus GN=APOD PE=2 SV=1	Back alignment and function description

>sp\|P23593\|APOD_RAT Apolipoprotein D OS=Rattus norvegicus GN=Apod PE=1 SV=1	Back alignment and function description

>sp\|P37153\|APOD_RABIT Apolipoprotein D OS=Oryctolagus cuniculus GN=APOD PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		150
170047462		208	neural Lazarillo [Culex quinquefasciatus	0.833	0.600	0.348	6e-18
332026341		210	Apolipoprotein D [Acromyrmex echinatior]	0.773	0.552	0.422	1e-17
170055915		197	conserved hypothetical protein [Culex qu	0.833	0.634	0.348	1e-17
307181592		515	Apolipoprotein D [Camponotus floridanus]	0.493	0.143	0.573	2e-17
307200185		174	Apolipoprotein D [Harpegnathos saltator]	0.5	0.431	0.56	2e-17
322794737		513	hypothetical protein SINV_00606 [Solenop	0.493	0.144	0.546	3e-17
383848263		188	PREDICTED: apolipoprotein D-like [Megach	0.566	0.452	0.477	6e-17
156547534		200	PREDICTED: apolipoprotein D-like isoform	0.493	0.37	0.52	3e-13
357605980		193	hypothetical protein KGM_18288 [Danaus p	0.52	0.404	0.493	3e-13
350408857		189	PREDICTED: apolipoprotein D-like [Bombus	0.493	0.391	0.467	1e-12

>gi\|170047462\|ref\|XP_001851239.1\| neural Lazarillo [Culex quinquefasciatus] gi\|167869906\|gb\|EDS33289.1\| neural Lazarillo [Culex quinquefasciatus]	Back alignment and taxonomy information

 Score = 95.5 bits (236), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 54/155 (34%), Positives = 78/155 (50%), Gaps = 30/155 (19%)

Query: 16  RYMGIWYEAERYFAVFEFAGKCVSANYTNEGNGIYRVVNTQTSSIT-------------- 61
           RY G+WYE E+Y  +FE  GKCV+A Y+   +    VVN Q S+I               
Sbjct: 53  RYGGLWYEQEKYPFIFELGGKCVTAEYSLSADNTITVVNRQISTIQLTVPIILLASSLLS 112

Query: 62  --------GITSNIEGEI-----RYMGIWYEAERYFAVFEFAGKCVSANYTNEGNGIYRV 108
                   GI  ++  +      R++G+WYE ERY  VFE A KCV++ Y+   +  + +
Sbjct: 113 IDAQIASLGICPDVPKQHDFHPERFVGLWYEQERYPNVFELAAKCVTSEYSMNADTTFTI 172

Query: 109 VNTQTSSITGITSNIEGEIRVFERSDTSKFFIKFP 143
            N Q +S+TG  S   G  R   R+  SK+ +KFP
Sbjct: 173 TNKQINSLTGNESKYFGSAR---RTKISKYQVKFP 204

Source: Culex quinquefasciatus

Species: Culex quinquefasciatus

Genus: Culex

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|332026341\|gb\|EGI66470.1\| Apolipoprotein D [Acromyrmex echinatior]	Back alignment and taxonomy information

>gi\|170055915\|ref\|XP_001863795.1\| conserved hypothetical protein [Culex quinquefasciatus] gi\|167875763\|gb\|EDS39146.1\| conserved hypothetical protein [Culex quinquefasciatus]	Back alignment and taxonomy information

>gi\|307181592\|gb\|EFN69132.1\| Apolipoprotein D [Camponotus floridanus]	Back alignment and taxonomy information

>gi\|307200185\|gb\|EFN80483.1\| Apolipoprotein D [Harpegnathos saltator]	Back alignment and taxonomy information

>gi\|322794737\|gb\|EFZ17684.1\| hypothetical protein SINV_00606 [Solenopsis invicta]	Back alignment and taxonomy information

>gi\|383848263\|ref\|XP_003699771.1\| PREDICTED: apolipoprotein D-like [Megachile rotundata]	Back alignment and taxonomy information

>gi\|156547534\|ref\|XP_001607285.1\| PREDICTED: apolipoprotein D-like isoform 1 [Nasonia vitripennis] gi\|345485043\|ref\|XP_003425180.1\| PREDICTED: apolipoprotein D-like isoform 2 [Nasonia vitripennis]	Back alignment and taxonomy information

>gi\|357605980\|gb\|EHJ64856.1\| hypothetical protein KGM_18288 [Danaus plexippus]	Back alignment and taxonomy information

>gi\|350408857\|ref\|XP_003488538.1\| PREDICTED: apolipoprotein D-like [Bombus impatiens]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		150
UNIPROTKB\|E3VX36		189	GW7_00081 "Apolipoprotein D" [	0.506	0.402	0.379	2.6e-08
UNIPROTKB\|Q5G8Y9		189	ApoD "Apolipoprotein D" [Gallu	0.486	0.386	0.379	3.3e-08
FB\|FBgn0053126		224	NLaz "Neural Lazarillo" [Droso	0.393	0.263	0.406	5.2e-08
UNIPROTKB\|G1RAG0		189	APOD "Uncharacterized protein"	0.506	0.402	0.341	5.3e-08
UNIPROTKB\|F6XM13		213	APOD "Uncharacterized protein"	0.486	0.342	0.367	7.1e-08
UNIPROTKB\|F7BHM9		189	LOC100389364 "Uncharacterized	0.486	0.386	0.367	8.7e-08
MGI\|MGI:88056		189	Apod "apolipoprotein D" [Mus m	0.506	0.402	0.354	8.7e-08
UNIPROTKB\|G3QHM6		200	APOD "Uncharacterized protein"	0.506	0.38	0.341	8.9e-08
UNIPROTKB\|F7FST1		189	LOC709223 "Apolipoprotein D" [	0.486	0.386	0.354	1.1e-07
UNIPROTKB\|Q8SPI0		189	APOD "Apolipoprotein D" [Macac	0.486	0.386	0.354	1.1e-07

UNIPROTKB\|E3VX36 GW7_00081 "Apolipoprotein D" [Heterocephalus glaber (taxid:10181)]	Back alignment and assigned GO terms

 Score = 127 (49.8 bits), Expect = 2.6e-08, P = 2.6e-08
 Identities = 30/79 (37%), Positives = 44/79 (55%)

Query:    72 RYMGIWYEAERYFAVFEFAGKCVSANYTNEGNGIYRVVNTQTSSITGITSNIEGEIRVFE 131
             +Y+G WYE E+    FE  G C+ ANY+ + NG  +V+N +  S  G  + IEGE     
Sbjct:    41 KYLGRWYEIEKIPVSFE-KGNCIQANYSVKENGNIKVLNQELRS-DGTVNQIEGEATQSN 98

Query:   132 RSDTSKFFIKFPSL-PNFP 149
              +D +K  +KF  L P+ P
Sbjct:    99 ITDPAKLGVKFFQLMPSAP 117

GO:0000302 "response to reactive oxygen species" evidence=ISS

GO:0005615 "extracellular space" evidence=ISS

GO:0005783 "endoplasmic reticulum" evidence=ISS

GO:0006006 "glucose metabolic process" evidence=ISS

GO:0006629 "lipid metabolic process" evidence=ISS

GO:0007420 "brain development" evidence=ISS

GO:0007568 "aging" evidence=ISS

GO:0010642 "negative regulation of platelet-derived growth factor receptor signaling pathway" evidence=ISS

GO:0014012 "peripheral nervous system axon regeneration" evidence=ISS

GO:0015485 "cholesterol binding" evidence=ISS

GO:0022626 "cytosolic ribosome" evidence=ISS

GO:0030425 "dendrite" evidence=ISS

GO:0042246 "tissue regeneration" evidence=ISS

GO:0042308 "negative regulation of protein import into nucleus" evidence=ISS

GO:0042493 "response to drug" evidence=ISS

GO:0043025 "neuronal cell body" evidence=ISS

GO:0048471 "perinuclear region of cytoplasm" evidence=ISS

GO:0048662 "negative regulation of smooth muscle cell proliferation" evidence=ISS

GO:0048678 "response to axon injury" evidence=ISS

GO:0051895 "negative regulation of focal adhesion assembly" evidence=ISS

GO:0060588 "negative regulation of lipoprotein lipid oxidation" evidence=ISS

GO:0071638 "negative regulation of monocyte chemotactic protein-1 production" evidence=ISS

GO:1900016 "negative regulation of cytokine production involved in inflammatory response" evidence=ISS

GO:2000098 "negative regulation of smooth muscle cell-matrix adhesion" evidence=ISS

GO:2000405 "negative regulation of T cell migration" evidence=ISS

UNIPROTKB\|Q5G8Y9 ApoD "Apolipoprotein D" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

FB\|FBgn0053126 NLaz "Neural Lazarillo" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

UNIPROTKB\|G1RAG0 APOD "Uncharacterized protein" [Nomascus leucogenys (taxid:61853)]	Back alignment and assigned GO terms

UNIPROTKB\|F6XM13 APOD "Uncharacterized protein" [Equus caballus (taxid:9796)]	Back alignment and assigned GO terms

UNIPROTKB\|F7BHM9 LOC100389364 "Uncharacterized protein" [Callithrix jacchus (taxid:9483)]	Back alignment and assigned GO terms

MGI\|MGI:88056 Apod "apolipoprotein D" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|G3QHM6 APOD "Uncharacterized protein" [Gorilla gorilla gorilla (taxid:9595)]	Back alignment and assigned GO terms

UNIPROTKB\|F7FST1 LOC709223 "Apolipoprotein D" [Macaca mulatta (taxid:9544)]	Back alignment and assigned GO terms

UNIPROTKB\|Q8SPI0 APOD "Apolipoprotein D" [Macaca fascicularis (taxid:9541)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		150
PF08212		143	Lipocalin_2: Lipocalin-like domain; InterPro: IPR0	99.84
COG3040		174	Blc Bacterial lipocalin [Cell envelope biogenesis,	99.8
PF08212		143	Lipocalin_2: Lipocalin-like domain; InterPro: IPR0	99.75
PRK10477		177	outer membrane lipoprotein Blc; Provisional	99.71
COG3040		174	Blc Bacterial lipocalin [Cell envelope biogenesis,	99.71
PRK10477		177	outer membrane lipoprotein Blc; Provisional	99.67
KOG4824\|consensus		224		99.58
KOG4824\|consensus		224		99.56
PF00061		144	Lipocalin: Lipocalin / cytosolic fatty-acid bindin	96.72
PF00061		144	Lipocalin: Lipocalin / cytosolic fatty-acid bindin	96.53
PF07137		198	VDE: Violaxanthin de-epoxidase (VDE); InterPro: IP	86.76

>PF08212 Lipocalin_2: Lipocalin-like domain; InterPro: IPR000566 Proteins which transport small hydrophobic molecules such as steroids, bilins, retinoids, and lipids share limited regions of sequence homology and a common tertiary structure architecture [, , , , ]	Back alignment and domain information

Probab=99.84  E-value=7.4e-21  Score=139.17  Aligned_cols=78  Identities=35%  Similarity=0.604  Sum_probs=65.5

Q ss_pred             cceeEEeEeeeccccceeecccceeeeEEEEecCCceEEEEEeEEecCCCCeEEEEEEEEEeCCCCCcEEEEEeCCCCC
Q psy12445         69 GEIRYMGIWYEAERYFAVFEFAGKCVSANYTNEGNGIYRVVNTQTSSITGITSNIEGEIRVFERSDTSKFFIKFPSLPN  147 (150)
Q Consensus        69 ~~~r~~g~wy~iar~~~~fe~~~~C~~a~Yt~~~dg~i~V~n~~~~~~~g~~~~~~G~a~~~~~~~~akl~V~f~~~p~  147 (150)
                      |+.||+|+||||||+|+.||++|.|++++|++.+||.|+|.|+|+. .+|+...+.|+|++.+++.+|||+|+|++.|.
T Consensus         2 Dl~rY~G~WYEiar~p~~~q~~~~~~~a~Yt~~~dg~i~V~n~~~~-~~g~~~~~~g~a~~~~~~~~~~l~V~f~~~~~   79 (143)
T PF08212_consen    2 DLDRYMGTWYEIARYPNFFQRGCVCVTAEYTLRDDGTISVRNSCRR-PDGKIKTIRGTATVVDPSGPAKLKVRFPGIPF   79 (143)
T ss_dssp             -CCCC-EEEEEEEEE--CCCTT-ECEEEEEEE-TTS-EEEEEEEEE-TTTCCCEEEEEEEESSBTTSSEEEEESST---
T ss_pred             ChHHcCEeeeEEEEECCcccceeeeeeeeEEEcCCCEEEEEEEEEc-CCCCEEEEEeEEEEcCCCCccEEEEEEecccc
Confidence            6889999999999999999999999999999999999999999987 79999999999999998889999999998443

This is an eight stranded antiparallel beta-barrel with a repeated + 1 topology enclosing a internal ligand binding site [, ]. The name 'lipocalin' has been proposed [] for this protein family, but cytosolic fatty-acid binding proteins are also included. The sequences of most members of the family, the core or kernal lipocalins, are characterised by three short conserved stretches of residues, while others, the outlier lipocalin group, share only one or two of these [, ]. Proteins known to belong to this family include alpha-1-microglobulin (protein HC); alpha-1-acid glycoprotein (orosomucoid) []; aphrodisin; apolipoprotein D; beta-lactoglobulin; complement component C8 gamma chain []; crustacyanin []; epididymal-retinoic acid binding protein (E-RABP) []; insectacyanin; odorant-binding protein (OBP); human pregnancy-associated endometrial alpha-2 globulin; probasin (PB), a rat prostatic protein; prostaglandin D synthase (5.3.99.2 from EC) []; purpurin; Von Ebner's gland protein (VEGP) []; and lizard epididymal secretory protein IV (LESP IV) [].; GO: 0005488 binding; PDB: 3EBW_B 1QWD_A 2ACO_A 3MBT_A.

>COG3040 Blc Bacterial lipocalin [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PF08212 Lipocalin_2: Lipocalin-like domain; InterPro: IPR000566 Proteins which transport small hydrophobic molecules such as steroids, bilins, retinoids, and lipids share limited regions of sequence homology and a common tertiary structure architecture [, , , , ]	Back alignment and domain information

>PRK10477 outer membrane lipoprotein Blc; Provisional	Back alignment and domain information

>COG3040 Blc Bacterial lipocalin [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK10477 outer membrane lipoprotein Blc; Provisional	Back alignment and domain information

>KOG4824\|consensus	Back alignment and domain information

>KOG4824\|consensus	Back alignment and domain information

>PF00061 Lipocalin: Lipocalin / cytosolic fatty-acid binding protein family fatty acid-binding protein signature lipocalin signature; InterPro: IPR000566 Proteins which transport small hydrophobic molecules such as steroids, bilins, retinoids, and lipids share limited regions of sequence homology and a common tertiary structure architecture [, , , , ]	Back alignment and domain information

>PF00061 Lipocalin: Lipocalin / cytosolic fatty-acid binding protein family fatty acid-binding protein signature lipocalin signature; InterPro: IPR000566 Proteins which transport small hydrophobic molecules such as steroids, bilins, retinoids, and lipids share limited regions of sequence homology and a common tertiary structure architecture [, , , , ]	Back alignment and domain information

>PF07137 VDE: Violaxanthin de-epoxidase (VDE); InterPro: IPR010788 This family represents a conserved region approximately 350 residues long within plant violaxanthin de-epoxidase (VDE)	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		150
2hzq_A		174	Crystal Structure Of Human Apolipoprotein D (Apod)		1e-06

>pdb|2HZQ|A Chain A, Crystal Structure Of Human Apolipoprotein D (Apod) In Complex With Progesterone Length = 174

Back alignment and structure

Iteration: 1
 Score = 48.5 bits (114), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 42/79 (53%), Gaps = 6/79 (7%)
Query: 72  RYMGIWYEAERYFAVFEFAGKCVSANYTNEGNGIYRVVNTQTSSITGITSNIEGEIRVFE 131
           +Y G WYE E+    FE  G+C+ ANY+   NG  +V+N +  +  G  + IEGE     
Sbjct: 19  KYPGRWYEIEKIPTTFE-NGRCIQANYSLXENGKIKVLNQELRA-DGTVNQIEGEATPVN 76
Query: 132 RSDTSKFFIKF----PSLP 146
            ++ +K  +KF    PS P
Sbjct: 77  LTEPAKLEVKFSWFXPSAP 95

PyMOL of 2hzq

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		150
1kt6_A		183	RBP, plasma retinol-binding protein; transport pro	1e-15
1kt6_A		183	RBP, plasma retinol-binding protein; transport pro	1e-10
3fmz_A		212	Retinol-binding protein 4; disease mutation, secre	3e-14
3fmz_A		212	Retinol-binding protein 4; disease mutation, secre	4e-10
1z24_A		189	Insecticyanin A form; blue biliprotein, INS-A, chr	1e-11
1z24_A		189	Insecticyanin A form; blue biliprotein, INS-A, chr	5e-10
1kxo_A		184	DIGA16; lipocalin, anticalin, genetical engineerin	2e-11
1kxo_A		184	DIGA16; lipocalin, anticalin, genetical engineerin	5e-08
1gka_B		174	Crustacyanin A2 subunit; lipocalin, lobster, astax	6e-11
1gka_B		174	Crustacyanin A2 subunit; lipocalin, lobster, astax	2e-09
2hzq_A		174	Apolipoprotein D, APO-D, APOD; lipocalin, beta bar	2e-10
2hzq_A		174	Apolipoprotein D, APO-D, APOD; lipocalin, beta bar	3e-07
1i4u_A		181	Crustacyanin; lipocalin fold, antiparallel beta ba	4e-10
1i4u_A		181	Crustacyanin; lipocalin fold, antiparallel beta ba	4e-09
3ebw_A		163	PER A 4 allergen; beta barrel, cockroach; HET: PE4	2e-09
3ebw_A		163	PER A 4 allergen; beta barrel, cockroach; HET: PE4	3e-08
1qwd_A		177	Outer membrane lipoprotein BLC; bacterial lipocali	3e-08
1qwd_A		177	Outer membrane lipoprotein BLC; bacterial lipocali	4e-07

>1kt6_A RBP, plasma retinol-binding protein; transport protein; HET: RTL; 1.10A {Bos taurus} SCOP: b.60.1.1 PDB: 1erb_A* 1fem_A* 1fen_A* 1hbp_A* 1fel_A* 1kt4_A* 1kt3_A* 1kt7_A* 1hbq_A 1aqb_A* 1kt5_A* 1rlb_E* 1rbp_A* 1brq_A 1brp_A* 1jyd_A 1jyj_A 2wqa_E* 3bsz_E* 1qab_E* ... Length = 183	Back alignment and structure

 Score = 69.1 bits (168), Expect = 1e-15
 Identities = 13/79 (16%), Positives = 27/79 (34%), Gaps = 1/79 (1%)

Query: 72  RYMGIWYEAERYFAVFEFAGKCVSANYTNEGNGIYRVVNTQTSSIT-GITSNIEGEIRVF 130
           R+ G WY   +      F    + A ++ + NG           +        +      
Sbjct: 19  RFAGTWYAMAKKDPEGLFLQDNIVAEFSVDENGHMSATAKGRVRLLNNWDVCADMVGTFT 78

Query: 131 ERSDTSKFFIKFPSLPNFP 149
           +  D +KF +K+  + +F 
Sbjct: 79  DTEDPAKFKMKYWGVASFL 97

PyMOL of 1kt6

>1kt6_A RBP, plasma retinol-binding protein; transport protein; HET: RTL; 1.10A {Bos taurus} SCOP: b.60.1.1 PDB: 1erb_A* 1fem_A* 1fen_A* 1hbp_A* 1fel_A* 1kt4_A* 1kt3_A* 1kt7_A* 1hbq_A 1aqb_A* 1kt5_A* 1rlb_E* 1rbp_A* 1brq_A 1brp_A* 1jyd_A 1jyj_A 2wqa_E* 3bsz_E* 1qab_E* ... Length = 183	Back alignment and structure

>3fmz_A Retinol-binding protein 4; disease mutation, secreted, sensory transduction, transport, vision, vitamin A, transport protein; HET: 2T1; 2.90A {Homo sapiens} Length = 212	Back alignment and structure

>3fmz_A Retinol-binding protein 4; disease mutation, secreted, sensory transduction, transport, vision, vitamin A, transport protein; HET: 2T1; 2.90A {Homo sapiens} Length = 212	Back alignment and structure

>1z24_A Insecticyanin A form; blue biliprotein, INS-A, chromophore binding., lipid binding protein; HET: BLV; 2.60A {Manduca sexta} SCOP: b.60.1.1 Length = 189	Back alignment and structure

>1z24_A Insecticyanin A form; blue biliprotein, INS-A, chromophore binding., lipid binding protein; HET: BLV; 2.60A {Manduca sexta} SCOP: b.60.1.1 Length = 189	Back alignment and structure

>1kxo_A DIGA16; lipocalin, anticalin, genetical engineering, digoxigenin, ligand binding protein; 1.80A {Pieris brassicae} SCOP: b.60.1.1 PDB: 1lke_A* 1lnm_A* 1n0s_A* 1t0v_A 1bbp_A* Length = 184	Back alignment and structure

>1kxo_A DIGA16; lipocalin, anticalin, genetical engineering, digoxigenin, ligand binding protein; 1.80A {Pieris brassicae} SCOP: b.60.1.1 PDB: 1lke_A* 1lnm_A* 1n0s_A* 1t0v_A 1bbp_A* Length = 184	Back alignment and structure

>1gka_B Crustacyanin A2 subunit; lipocalin, lobster, astaxanthin, bathochromic, coloration; HET: AXT D12 EPE; 3.23A {Homarus gammarus} SCOP: b.60.1.1 Length = 174	Back alignment and structure

>1gka_B Crustacyanin A2 subunit; lipocalin, lobster, astaxanthin, bathochromic, coloration; HET: AXT D12 EPE; 3.23A {Homarus gammarus} SCOP: b.60.1.1 Length = 174	Back alignment and structure

>2hzq_A Apolipoprotein D, APO-D, APOD; lipocalin, beta barrel, bilin-binding protein, transport protein; HET: STR; 1.80A {Homo sapiens} PDB: 2hzr_A Length = 174	Back alignment and structure

>2hzq_A Apolipoprotein D, APO-D, APOD; lipocalin, beta barrel, bilin-binding protein, transport protein; HET: STR; 1.80A {Homo sapiens} PDB: 2hzr_A Length = 174	Back alignment and structure

>1i4u_A Crustacyanin; lipocalin fold, antiparallel beta barrel, transport protein; 1.15A {Synthetic} SCOP: b.60.1.1 PDB: 1obq_A 1obu_A 1s2p_A 1h91_A 1gka_A 1s44_A Length = 181	Back alignment and structure

>1i4u_A Crustacyanin; lipocalin fold, antiparallel beta barrel, transport protein; 1.15A {Synthetic} SCOP: b.60.1.1 PDB: 1obq_A 1obu_A 1s2p_A 1h91_A 1gka_A 1s44_A Length = 181	Back alignment and structure

>3ebw_A PER A 4 allergen; beta barrel, cockroach; HET: PE4; 2.80A {Periplaneta americana} Length = 163	Back alignment and structure

>3ebw_A PER A 4 allergen; beta barrel, cockroach; HET: PE4; 2.80A {Periplaneta americana} Length = 163	Back alignment and structure

>1qwd_A Outer membrane lipoprotein BLC; bacterial lipocalin, lipid binding protein; 1.75A {Escherichia coli} SCOP: b.60.1.1 PDB: 2aco_A* 3mbt_A Length = 177	Back alignment and structure

>1qwd_A Outer membrane lipoprotein BLC; bacterial lipocalin, lipid binding protein; 1.75A {Escherichia coli} SCOP: b.60.1.1 PDB: 2aco_A* 3mbt_A Length = 177	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		150
3ebw_A		163	PER A 4 allergen; beta barrel, cockroach; HET: PE4	99.82
1qwd_A		177	Outer membrane lipoprotein BLC; bacterial lipocali	99.76
3ebw_A		163	PER A 4 allergen; beta barrel, cockroach; HET: PE4	99.76
3fmz_A		212	Retinol-binding protein 4; disease mutation, secre	99.74
1qwd_A		177	Outer membrane lipoprotein BLC; bacterial lipocali	99.71
3fmz_A		212	Retinol-binding protein 4; disease mutation, secre	99.7
2hzq_A		174	Apolipoprotein D, APO-D, APOD; lipocalin, beta bar	99.67
1kxo_A		184	DIGA16; lipocalin, anticalin, genetical engineerin	99.62
1gka_B		174	Crustacyanin A2 subunit; lipocalin, lobster, astax	99.6
2hzq_A		174	Apolipoprotein D, APO-D, APOD; lipocalin, beta bar	99.58
1z24_A		189	Insecticyanin A form; blue biliprotein, INS-A, chr	99.58
3ebk_A		176	Allergen BLA G 4; beta barrel, cockroach, glycopro	99.57
1kxo_A		184	DIGA16; lipocalin, anticalin, genetical engineerin	99.57
1i4u_A		181	Crustacyanin; lipocalin fold, antiparallel beta ba	99.55
1kt6_A		183	RBP, plasma retinol-binding protein; transport pro	99.54
1z24_A		189	Insecticyanin A form; blue biliprotein, INS-A, chr	99.52
1gm6_A		175	SAL, salivary lipocalin; odorant-binding protein;	99.51
3bx8_A		178	Engineered human lipocalin 2; protein design, liga	99.51
1gka_B		174	Crustacyanin A2 subunit; lipocalin, lobster, astax	99.5
1kt6_A		183	RBP, plasma retinol-binding protein; transport pro	99.49
3s26_A		190	Neutrophil gelatinase-associated lipocalin; beta-b	99.48
2xst_A		161	Lipocalin 15; transport protein, LCN15, MSFL2541;	99.45
1ew3_A		159	Allergen EQU C 1; lipocalin, beta barrel; 2.30A {E	99.44
1i4u_A		181	Crustacyanin; lipocalin fold, antiparallel beta ba	99.43
1beb_A		162	Beta-lactoglobulin; lipocalin, MILK WHEY protein,	99.43
3cbc_A		198	Neutrophil gelatinase-associated lipocalin; sidero	99.43
1epa_A		164	Epididymal retinoic acid-binding protein; 2.10A {R	99.41
1bj7_A		156	D 2; allergen, lipocalin; 1.80A {Bos taurus} SCOP:	99.39
1exs_A		160	Beta-lactoglobulin; lipocalin fold, lipid-binding	99.39
1lf7_A		182	Complement protein C8gamma; lipocalin, beta barrel	99.38
3o22_A		162	Prostaglandin-H2 D-isomerase; lipocalin, prostagla	99.37
3ebk_A		176	Allergen BLA G 4; beta barrel, cockroach, glycopro	99.37
1xki_A		162	VON ebner'S gland protein; beta barrel, ligand bin	99.35
2ra6_A		166	Trichosurin; lipocalin, beta barrel, glycoprotein,	99.34
1dzk_A		157	PIG OBP, odorant-binding protein; lipocalin, trans	99.31
2hlv_A		160	Odorant-binding protein; domain swapping, transpor	99.31
2l5p_A		184	Lipocalin 12; beta barrel, transport protein; NMR	99.31
1ew3_A		159	Allergen EQU C 1; lipocalin, beta barrel; 2.30A {E	99.31
3bx8_A		178	Engineered human lipocalin 2; protein design, liga	99.28
3s26_A		190	Neutrophil gelatinase-associated lipocalin; beta-b	99.28
2xst_A		161	Lipocalin 15; transport protein, LCN15, MSFL2541;	99.26
1bj7_A		156	D 2; allergen, lipocalin; 1.80A {Bos taurus} SCOP:	99.25
3cbc_A		198	Neutrophil gelatinase-associated lipocalin; sidero	99.24
2a2u_A		181	Protein (alpha-2U-globulin); lipid binding protein	99.23
1e5p_A		151	Aphrodisin; lipocalin, pheromone, hamster,; HET: M	99.22
1e5p_A		151	Aphrodisin; lipocalin, pheromone, hamster,; HET: M	99.17
1exs_A		160	Beta-lactoglobulin; lipocalin fold, lipid-binding	99.17
1xki_A		162	VON ebner'S gland protein; beta barrel, ligand bin	99.15
1dzk_A		157	PIG OBP, odorant-binding protein; lipocalin, trans	99.14
2ra6_A		166	Trichosurin; lipocalin, beta barrel, glycoprotein,	99.13
2hlv_A		160	Odorant-binding protein; domain swapping, transpor	99.12
2l5p_A		184	Lipocalin 12; beta barrel, transport protein; NMR	99.1
1lf7_A		182	Complement protein C8gamma; lipocalin, beta barrel	99.09
1epa_A		164	Epididymal retinoic acid-binding protein; 2.10A {R	99.05
2a2u_A		181	Protein (alpha-2U-globulin); lipid binding protein	99.0
3o22_A		162	Prostaglandin-H2 D-isomerase; lipocalin, prostagla	98.97
3sao_A		160	Extracellular fatty acid-binding protein; beta-bar	98.91
3kff_A		162	MUP 4, major urinary protein 4; pheromone, lipocal	98.88
3qkg_A		193	Protein AMBP; beta barrel, binding protein, bound	98.75
3sao_A		160	Extracellular fatty acid-binding protein; beta-bar	98.69
1pm1_X		180	Nitrophorin 2, NP2, prolixin-S; beta barrel, lipoc	98.66
1x8p_A		184	Nitrophorin 4, NP4; lipocalin, beta barrel, ferric	98.53
3kff_A		162	MUP 4, major urinary protein 4; pheromone, lipocal	98.51
1pm1_X		180	Nitrophorin 2, NP2, prolixin-S; beta barrel, lipoc	98.51
3kq0_A		192	Alpha-1-acid glycoprotein 1; plasma protein, polym	98.35
1avg_I		142	Triabin; bovine thrombin, thrombin inhibitor, comp	98.28
3l4r_A		170	Allergen DOG 2, minor allergen CAN F 2; lipocalin	98.25
3qkg_A		193	Protein AMBP; beta barrel, binding protein, bound	98.17
1avg_I		142	Triabin; bovine thrombin, thrombin inhibitor, comp	98.08
1x8p_A		184	Nitrophorin 4, NP4; lipocalin, beta barrel, ferric	98.01
3l4r_A		170	Allergen DOG 2, minor allergen CAN F 2; lipocalin	97.76
3kq0_A		192	Alpha-1-acid glycoprotein 1; plasma protein, polym	97.48
4ge1_A		197	Biogenic amine-binding protein; lipocalin binding	96.18
3fiq_A		157	OBP1, RCG36470, odorant-binding protein 1F; lipoca	96.15
4ge1_A		197	Biogenic amine-binding protein; lipocalin binding	95.07
3bx6_A		192	Alpha-1-acid glycoprotein; plasma protein, acute p	93.19
3fiq_A		157	OBP1, RCG36470, odorant-binding protein 1F; lipoca	91.65
1beb_A		162	Beta-lactoglobulin; lipocalin, MILK WHEY protein,	87.18
3cqn_A		185	Violaxanthin DE-epoxidase, chloroplast; lipocalin,	86.46

>3ebw_A PER A 4 allergen; beta barrel, cockroach; HET: PE4; 2.80A {Periplaneta americana}	Back alignment and structure

Probab=99.82  E-value=9.5e-21  Score=140.13  Aligned_cols=79  Identities=23%  Similarity=0.251  Sum_probs=72.7

Q ss_pred             cceeeccc-----cceeEEeEeeeccccceeecccc-eeeeEEEEecCCceEEEEEeEEecCCCCeE-EEEEEEEEeCCC
Q psy12445         61 TGITSNIE-----GEIRYMGIWYEAERYFAVFEFAG-KCVSANYTNEGNGIYRVVNTQTSSITGITS-NIEGEIRVFERS  133 (150)
Q Consensus        61 ~G~c~~~~-----~~~r~~g~wy~iar~~~~fe~~~-~C~~a~Yt~~~dg~i~V~n~~~~~~~g~~~-~~~G~a~~~~~~  133 (150)
                      +|.||+++     ++.||+|+||||||+|+.||+++ .|++|+|++.+||+|+|.|++ +  +|... .++|+|++.++.
T Consensus         1 d~~Cp~v~~~~~fdl~ry~G~WYeiar~~~~fe~~~~~~~~a~Y~l~~dg~i~V~n~~-~--~g~~~~~~~G~a~~~~~~   77 (163)
T 3ebw_A            1 DDSCQIGTSFTGLDMTKYVGTWYELFRTPNSDEEDFTNCEYDKYTLDENGVIQVTSVA-Y--TNSIRGFITSTGTVPSWT   77 (163)
T ss_dssp             CCSCCCCCCCCCCCTTTTCEEEEEEEECCCSTTSSCCSCEEEEEEECTTSCEEEEEEE-E--CSTTSSEEEEEEECCCBC
T ss_pred             CCCCcCCCccCCCChHHhCEEeEEEEEeCcccccCcCccceEEEEECCCCeEEEEEEe-e--CCeEEEEEEEEEEeCCCC
Confidence            36788765     88999999999999999999999 999999999999999999999 5  89999 999999999888


Q ss_pred             CCcEEEEEeC
Q psy12445        134 DTSKFFIKFP  143 (150)
Q Consensus       134 ~~akl~V~f~  143 (150)
                      .+| |+|+|+
T Consensus        78 ~~~-l~v~f~   86 (163)
T 3ebw_A           78 EDT-FDIAYG   86 (163)
T ss_dssp             SSE-EEEBC-
T ss_pred             CCc-eEEEec
Confidence            899 999997

PyMOL of 3ebw

>1qwd_A Outer membrane lipoprotein BLC; bacterial lipocalin, lipid binding protein; 1.75A {Escherichia coli} SCOP: b.60.1.1 PDB: 2aco_A* 3mbt_A	Back alignment and structure

>3ebw_A PER A 4 allergen; beta barrel, cockroach; HET: PE4; 2.80A {Periplaneta americana}	Back alignment and structure

>3fmz_A Retinol-binding protein 4; disease mutation, secreted, sensory transduction, transport, vision, vitamin A, transport protein; HET: 2T1; 2.90A {Homo sapiens}	Back alignment and structure

>1qwd_A Outer membrane lipoprotein BLC; bacterial lipocalin, lipid binding protein; 1.75A {Escherichia coli} SCOP: b.60.1.1 PDB: 2aco_A* 3mbt_A	Back alignment and structure

>3fmz_A Retinol-binding protein 4; disease mutation, secreted, sensory transduction, transport, vision, vitamin A, transport protein; HET: 2T1; 2.90A {Homo sapiens}	Back alignment and structure

>2hzq_A Apolipoprotein D, APO-D, APOD; lipocalin, beta barrel, bilin-binding protein, transport protein; HET: STR; 1.80A {Homo sapiens} PDB: 2hzr_A	Back alignment and structure

>1kxo_A DIGA16; lipocalin, anticalin, genetical engineering, digoxigenin, ligand binding protein; 1.80A {Pieris brassicae} SCOP: b.60.1.1 PDB: 1lke_A* 1lnm_A* 1n0s_A* 1t0v_A 1bbp_A*	Back alignment and structure

>1gka_B Crustacyanin A2 subunit; lipocalin, lobster, astaxanthin, bathochromic, coloration; HET: AXT D12 EPE; 3.23A {Homarus gammarus} SCOP: b.60.1.1	Back alignment and structure

>2hzq_A Apolipoprotein D, APO-D, APOD; lipocalin, beta barrel, bilin-binding protein, transport protein; HET: STR; 1.80A {Homo sapiens} PDB: 2hzr_A	Back alignment and structure

>1z24_A Insecticyanin A form; blue biliprotein, INS-A, chromophore binding., lipid binding protein; HET: BLV; 2.60A {Manduca sexta} SCOP: b.60.1.1	Back alignment and structure

>3ebk_A Allergen BLA G 4; beta barrel, cockroach, glycoprotein, secreted; 1.90A {Blattella germanica}	Back alignment and structure

>1kxo_A DIGA16; lipocalin, anticalin, genetical engineering, digoxigenin, ligand binding protein; 1.80A {Pieris brassicae} SCOP: b.60.1.1 PDB: 1lke_A* 1lnm_A* 1n0s_A* 1t0v_A 1bbp_A*	Back alignment and structure

>1i4u_A Crustacyanin; lipocalin fold, antiparallel beta barrel, transport protein; 1.15A {Synthetic} SCOP: b.60.1.1 PDB: 1obq_A 1obu_A 1s2p_A 1h91_A 1gka_A 1s44_A	Back alignment and structure

>1kt6_A RBP, plasma retinol-binding protein; transport protein; HET: RTL; 1.10A {Bos taurus} SCOP: b.60.1.1 PDB: 1erb_A* 1fem_A* 1fen_A* 1hbp_A* 1fel_A* 1kt4_A* 1kt3_A* 1kt7_A* 1hbq_A 1aqb_A* 1kt5_A* 1rlb_E* 1rbp_A* 1brq_A 1brp_A* 1jyd_A 1jyj_A 2wqa_E* 3bsz_E* 1qab_E* ...	Back alignment and structure

>1z24_A Insecticyanin A form; blue biliprotein, INS-A, chromophore binding., lipid binding protein; HET: BLV; 2.60A {Manduca sexta} SCOP: b.60.1.1	Back alignment and structure

>1gm6_A SAL, salivary lipocalin; odorant-binding protein; HET: NAG; 2.13A {Sus scrofa} SCOP: b.60.1.1	Back alignment and structure

>3bx8_A Engineered human lipocalin 2; protein design, ligand binding protein, de novo protein, protein binding; HET: 1PE PE5; 2.00A {Homo sapiens} PDB: 3bx7_A* 3dtq_A 3dsz_A* 1l6m_A* 3tf6_A* 1x71_A* 1x89_A* 1x8u_A* 3fw4_A 3fw5_A 3k3l_A* 3pec_A* 3ped_A* 3tzs_A* 1ngl_A 1dfv_A* 1qqs_A*	Back alignment and structure

>1gka_B Crustacyanin A2 subunit; lipocalin, lobster, astaxanthin, bathochromic, coloration; HET: AXT D12 EPE; 3.23A {Homarus gammarus} SCOP: b.60.1.1	Back alignment and structure

>1kt6_A RBP, plasma retinol-binding protein; transport protein; HET: RTL; 1.10A {Bos taurus} SCOP: b.60.1.1 PDB: 1erb_A* 1fem_A* 1fen_A* 1hbp_A* 1fel_A* 1kt4_A* 1kt3_A* 1kt7_A* 1hbq_A 1aqb_A* 1kt5_A* 1rlb_E* 1rbp_A* 1brq_A 1brp_A* 1jyd_A 1jyj_A 2wqa_E* 3bsz_E* 1qab_E* ...	Back alignment and structure

>3s26_A Neutrophil gelatinase-associated lipocalin; beta-barrel, siderophore binding protein, N-linked glycosyla secreted, transport protein; HET: NAG BMA MAN; 1.80A {Mus musculus} SCOP: b.60.1.1 PDB: 2k23_A	Back alignment and structure

>2xst_A Lipocalin 15; transport protein, LCN15, MSFL2541; 1.63A {Homo sapiens}	Back alignment and structure

>1ew3_A Allergen EQU C 1; lipocalin, beta barrel; 2.30A {Equus caballus} SCOP: b.60.1.1	Back alignment and structure

>1i4u_A Crustacyanin; lipocalin fold, antiparallel beta barrel, transport protein; 1.15A {Synthetic} SCOP: b.60.1.1 PDB: 1obq_A 1obu_A 1s2p_A 1h91_A 1gka_A 1s44_A	Back alignment and structure

>1beb_A Beta-lactoglobulin; lipocalin, MILK WHEY protein, bovine, retinol-binding; 1.80A {Bos taurus} SCOP: b.60.1.1 PDB: 3nq3_A* 1b0o_A 1bsq_A 1gx8_A* 1gx9_A* 1gxa_A* 2gj5_A* 2r56_A* 3npo_A 1b8e_A* 3nq9_A* 3qzj_A* 3qzk_A* 3ueu_A* 3uev_A* 3uew_A* 3uex_A* 4dq3_A* 4dq4_A* 1qg5_A ...	Back alignment and structure

>3cbc_A Neutrophil gelatinase-associated lipocalin; siderocalin, NGAL, enterobactin, glycoprotein, pyrroli carboxylic acid, secreted; HET: DBS; 2.17A {Homo sapiens} PDB: 3hwg_A* 3hwf_A* 3hwe_A* 3u03_A* 3u0d_A* 3cmp_A* 3i0a_A* 3hwd_A 3t1d_A* 3by0_A*	Back alignment and structure

>1epa_A Epididymal retinoic acid-binding protein; 2.10A {Rattus norvegicus} SCOP: b.60.1.1 PDB: 1epb_A*	Back alignment and structure

>1bj7_A D 2; allergen, lipocalin; 1.80A {Bos taurus} SCOP: b.60.1.1	Back alignment and structure

>1exs_A Beta-lactoglobulin; lipocalin fold, lipid-binding protein; 2.39A {Sus scrofa} SCOP: b.60.1.1	Back alignment and structure

>1lf7_A Complement protein C8gamma; lipocalin, beta barrel, calyx, MAC, immune system; HET: CIT; 1.20A {Homo sapiens} SCOP: b.60.1.1 PDB: 1iw2_A* 2ovd_A* 2ove_A 2ova_A 2rd7_C 3ojy_C* 2qos_C	Back alignment and structure

>3o22_A Prostaglandin-H2 D-isomerase; lipocalin, prostaglandin synthase; HET: OLA PLM; 1.40A {Homo sapiens} PDB: 3o19_A* 3o2y_A* 2wwp_A 2czt_A 2czu_A 2rq0_A 2e4j_A 2ktd_A*	Back alignment and structure

>3ebk_A Allergen BLA G 4; beta barrel, cockroach, glycoprotein, secreted; 1.90A {Blattella germanica}	Back alignment and structure

>1xki_A VON ebner'S gland protein; beta barrel, ligand binding protein, transport protein; 1.80A {Homo sapiens} SCOP: b.60.1.1 PDB: 3eyc_A	Back alignment and structure

>2ra6_A Trichosurin; lipocalin, beta barrel, glycoprotein, MILK protein, secreted, transport, transport protein; 1.50A {Trichosurus vulpecula} PDB: 2r73_A 2r74_A	Back alignment and structure

>1dzk_A PIG OBP, odorant-binding protein; lipocalin, transport, olfaction, sensory transduction; HET: PRZ; 1.48A {Sus scrofa} SCOP: b.60.1.1 PDB: 1dzj_A* 1dzm_A* 1dzp_A* 1e00_A* 1e02_A* 1e06_A* 1hqp_A* 1a3y_A	Back alignment and structure

>2hlv_A Odorant-binding protein; domain swapping, transport protein; HET: LIK; 1.65A {Bos taurus} PDB: 1gt1_A* 1gt3_A* 1gt4_A* 1gt5_A* 1hn2_A* 1obp_A 1g85_A 1pbo_A*	Back alignment and structure

>2l5p_A Lipocalin 12; beta barrel, transport protein; NMR {Rattus norvegicus}	Back alignment and structure

>1ew3_A Allergen EQU C 1; lipocalin, beta barrel; 2.30A {Equus caballus} SCOP: b.60.1.1	Back alignment and structure

>3bx8_A Engineered human lipocalin 2; protein design, ligand binding protein, de novo protein, protein binding; HET: 1PE PE5; 2.00A {Homo sapiens} PDB: 3bx7_A* 3dtq_A 3dsz_A* 1l6m_A* 3tf6_A* 1x71_A* 1x89_A* 1x8u_A* 3fw4_A 3fw5_A 3k3l_A* 3pec_A* 3ped_A* 3tzs_A* 1ngl_A 1dfv_A* 1qqs_A*	Back alignment and structure

>3s26_A Neutrophil gelatinase-associated lipocalin; beta-barrel, siderophore binding protein, N-linked glycosyla secreted, transport protein; HET: NAG BMA MAN; 1.80A {Mus musculus} SCOP: b.60.1.1 PDB: 2k23_A	Back alignment and structure

>2xst_A Lipocalin 15; transport protein, LCN15, MSFL2541; 1.63A {Homo sapiens}	Back alignment and structure

>1bj7_A D 2; allergen, lipocalin; 1.80A {Bos taurus} SCOP: b.60.1.1	Back alignment and structure

>3cbc_A Neutrophil gelatinase-associated lipocalin; siderocalin, NGAL, enterobactin, glycoprotein, pyrroli carboxylic acid, secreted; HET: DBS; 2.17A {Homo sapiens} PDB: 3hwg_A* 3hwf_A* 3hwe_A* 3u03_A* 3u0d_A* 3cmp_A* 3i0a_A* 3hwd_A 3t1d_A* 3by0_A*	Back alignment and structure

>2a2u_A Protein (alpha-2U-globulin); lipid binding protein; 2.50A {Rattus norvegicus} SCOP: b.60.1.1 PDB: 2a2g_A	Back alignment and structure

>1e5p_A Aphrodisin; lipocalin, pheromone, hamster,; HET: MSE; 1.63A {Mesocricetus auratus} SCOP: b.60.1.1	Back alignment and structure

>1e5p_A Aphrodisin; lipocalin, pheromone, hamster,; HET: MSE; 1.63A {Mesocricetus auratus} SCOP: b.60.1.1	Back alignment and structure

>1exs_A Beta-lactoglobulin; lipocalin fold, lipid-binding protein; 2.39A {Sus scrofa} SCOP: b.60.1.1	Back alignment and structure

>1xki_A VON ebner'S gland protein; beta barrel, ligand binding protein, transport protein; 1.80A {Homo sapiens} SCOP: b.60.1.1 PDB: 3eyc_A	Back alignment and structure

>1dzk_A PIG OBP, odorant-binding protein; lipocalin, transport, olfaction, sensory transduction; HET: PRZ; 1.48A {Sus scrofa} SCOP: b.60.1.1 PDB: 1dzj_A* 1dzm_A* 1dzp_A* 1e00_A* 1e02_A* 1e06_A* 1hqp_A* 1a3y_A	Back alignment and structure

>2ra6_A Trichosurin; lipocalin, beta barrel, glycoprotein, MILK protein, secreted, transport, transport protein; 1.50A {Trichosurus vulpecula} PDB: 2r73_A 2r74_A	Back alignment and structure

>2hlv_A Odorant-binding protein; domain swapping, transport protein; HET: LIK; 1.65A {Bos taurus} PDB: 1gt1_A* 1gt3_A* 1gt4_A* 1gt5_A* 1hn2_A* 1obp_A 1g85_A 1pbo_A*	Back alignment and structure

>2l5p_A Lipocalin 12; beta barrel, transport protein; NMR {Rattus norvegicus}	Back alignment and structure

>1lf7_A Complement protein C8gamma; lipocalin, beta barrel, calyx, MAC, immune system; HET: CIT; 1.20A {Homo sapiens} SCOP: b.60.1.1 PDB: 1iw2_A* 2ovd_A* 2ove_A 2ova_A 2rd7_C 3ojy_C* 2qos_C	Back alignment and structure

>1epa_A Epididymal retinoic acid-binding protein; 2.10A {Rattus norvegicus} SCOP: b.60.1.1 PDB: 1epb_A*	Back alignment and structure

>2a2u_A Protein (alpha-2U-globulin); lipid binding protein; 2.50A {Rattus norvegicus} SCOP: b.60.1.1 PDB: 2a2g_A	Back alignment and structure

>3o22_A Prostaglandin-H2 D-isomerase; lipocalin, prostaglandin synthase; HET: OLA PLM; 1.40A {Homo sapiens} PDB: 3o19_A* 3o2y_A* 2wwp_A 2czt_A 2czu_A 2rq0_A 2e4j_A 2ktd_A*	Back alignment and structure

>3sao_A Extracellular fatty acid-binding protein; beta-barrel, siderophore binding protein, transport protein; HET: NKN DBH; 1.80A {Gallus gallus} SCOP: b.60.1.1 PDB: 1jzu_A 2kt4_B* 2lbv_A*	Back alignment and structure

>3kff_A MUP 4, major urinary protein 4; pheromone, lipocalin, beta barrel, DI bond, pheromone-binding, secreted, transport, transport Pro; 0.96A {Mus musculus} SCOP: b.60.1.1 PDB: 3kfg_A 3kfh_A 3kfi_A 2l9c_A 2lb6_A 1i06_A 1i05_A* 1i04_A 1mup_A 1znd_A 1qy0_A* 1qy2_A* 1qy1_A 1zne_A 1zng_A 1znh_A 1znk_A* 1znl_A* 2dm5_A* 2ozq_A ...	Back alignment and structure

>3qkg_A Protein AMBP; beta barrel, binding protein, bound chromophore, human plasm system; 2.30A {Homo sapiens}	Back alignment and structure

>3sao_A Extracellular fatty acid-binding protein; beta-barrel, siderophore binding protein, transport protein; HET: NKN DBH; 1.80A {Gallus gallus} SCOP: b.60.1.1 PDB: 1jzu_A 2kt4_B* 2lbv_A*	Back alignment and structure

>1pm1_X Nitrophorin 2, NP2, prolixin-S; beta barrel, lipocalin, imidazole, ferric heme, blood clotting inhibitor; HET: HEM; 1.10A {Rhodnius prolixus} SCOP: b.60.1.1 PDB: 2all_X* 2amm_X* 2hys_A* 1euo_A* 1pee_A* 1t68_X* 2acp_X* 2ah7_X* 2al0_X* 2gtf_X* 2a3f_X* 2eu7_X* 2asn_X*	Back alignment and structure

>1x8p_A Nitrophorin 4, NP4; lipocalin, beta barrel, ferric heme, ligand binding protein; HET: HEM; 0.85A {Rhodnius prolixus} SCOP: b.60.1.1 PDB: 1d3s_A* 1eqd_A* 1erx_A* 1ike_A* 1ikj_A* 1d2u_A* 1ml7_A* 1np4_A* 1u0x_A* 1x8n_A* 1koi_A* 1x8o_A* 1x8q_A* 1ywa_A* 1ywb_A* 1ywc_A* 1ywd_A* 2at4_X* 2at5_X* 2at6_X* ...	Back alignment and structure

>3kff_A MUP 4, major urinary protein 4; pheromone, lipocalin, beta barrel, DI bond, pheromone-binding, secreted, transport, transport Pro; 0.96A {Mus musculus} SCOP: b.60.1.1 PDB: 3kfg_A 3kfh_A 3kfi_A 2l9c_A 2lb6_A 1i06_A 1i05_A* 1i04_A 1mup_A 1znd_A 1qy0_A* 1qy2_A* 1qy1_A 1zne_A 1zng_A 1znh_A 1znk_A* 1znl_A* 2dm5_A* 2ozq_A ...	Back alignment and structure

>1pm1_X Nitrophorin 2, NP2, prolixin-S; beta barrel, lipocalin, imidazole, ferric heme, blood clotting inhibitor; HET: HEM; 1.10A {Rhodnius prolixus} SCOP: b.60.1.1 PDB: 2all_X* 2amm_X* 2hys_A* 1euo_A* 1pee_A* 1t68_X* 2acp_X* 2ah7_X* 2al0_X* 2gtf_X* 2a3f_X* 2eu7_X* 2asn_X*	Back alignment and structure

>3kq0_A Alpha-1-acid glycoprotein 1; plasma protein, polymorphism, acute phase protein, secreted, pyrrolidone carboxylic acid, lipocalin; 1.80A {Homo sapiens} PDB: 3apu_A* 3apv_A* 3apw_A* 3apx_A*	Back alignment and structure

>1avg_I Triabin; bovine thrombin, thrombin inhibitor, complex (blood coagulation/inhibitor); 2.60A {Triatoma pallidipennis} SCOP: b.60.1.3	Back alignment and structure

>3l4r_A Allergen DOG 2, minor allergen CAN F 2; lipocalin allergen, disulfide bond, secreted, TRAN lipid binding protein; 1.45A {Canis familiaris}	Back alignment and structure

>3qkg_A Protein AMBP; beta barrel, binding protein, bound chromophore, human plasm system; 2.30A {Homo sapiens}	Back alignment and structure

>1avg_I Triabin; bovine thrombin, thrombin inhibitor, complex (blood coagulation/inhibitor); 2.60A {Triatoma pallidipennis} SCOP: b.60.1.3	Back alignment and structure

>1x8p_A Nitrophorin 4, NP4; lipocalin, beta barrel, ferric heme, ligand binding protein; HET: HEM; 0.85A {Rhodnius prolixus} SCOP: b.60.1.1 PDB: 1d3s_A* 1eqd_A* 1erx_A* 1ike_A* 1ikj_A* 1d2u_A* 1ml7_A* 1np4_A* 1u0x_A* 1x8n_A* 1koi_A* 1x8o_A* 1x8q_A* 1ywa_A* 1ywb_A* 1ywc_A* 1ywd_A* 2at4_X* 2at5_X* 2at6_X* ...	Back alignment and structure

>3l4r_A Allergen DOG 2, minor allergen CAN F 2; lipocalin allergen, disulfide bond, secreted, TRAN lipid binding protein; 1.45A {Canis familiaris}	Back alignment and structure

>3kq0_A Alpha-1-acid glycoprotein 1; plasma protein, polymorphism, acute phase protein, secreted, pyrrolidone carboxylic acid, lipocalin; 1.80A {Homo sapiens} PDB: 3apu_A* 3apv_A* 3apw_A* 3apx_A*	Back alignment and structure

>4ge1_A Biogenic amine-binding protein; lipocalin binding protein, serotonin, norepinephrine, saliva amine-binding protein; HET: TSS; 2.15A {Rhodnius prolixus} PDB: 4get_A* 4hfo_A	Back alignment and structure

>3fiq_A OBP1, RCG36470, odorant-binding protein 1F; lipocalin, oderant-binding protein, transport protein; 1.60A {Rattus norvegicus} SCOP: b.60.1.0	Back alignment and structure

>4ge1_A Biogenic amine-binding protein; lipocalin binding protein, serotonin, norepinephrine, saliva amine-binding protein; HET: TSS; 2.15A {Rhodnius prolixus} PDB: 4get_A* 4hfo_A	Back alignment and structure

>3fiq_A OBP1, RCG36470, odorant-binding protein 1F; lipocalin, oderant-binding protein, transport protein; 1.60A {Rattus norvegicus} SCOP: b.60.1.0	Back alignment and structure

>1beb_A Beta-lactoglobulin; lipocalin, MILK WHEY protein, bovine, retinol-binding; 1.80A {Bos taurus} SCOP: b.60.1.1 PDB: 3nq3_A* 1b0o_A 1bsq_A 1gx8_A* 1gx9_A* 1gxa_A* 2gj5_A* 2r56_A* 3npo_A 1b8e_A* 3nq9_A* 3qzj_A* 3qzk_A* 3ueu_A* 3uev_A* 3uew_A* 3uex_A* 4dq3_A* 4dq4_A* 1qg5_A ...	Back alignment and structure

>3cqn_A Violaxanthin DE-epoxidase, chloroplast; lipocalin, enzyme, xanthophyll cycle, non photochemical quenching, NPQ, antheraxanthin, zeaxanthin; 2.00A {Arabidopsis thaliana} PDB: 3cqr_A	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		150
d1kt7a_		175	b.60.1.1 (A:) Retinol binding protein {Cow (Bos ta	6e-12
d1kt7a_		175	b.60.1.1 (A:) Retinol binding protein {Cow (Bos ta	2e-08
d1i4ua_		181	b.60.1.1 (A:) Alpha-crustacyanin {European lobster	1e-11
d1i4ua_		181	b.60.1.1 (A:) Alpha-crustacyanin {European lobster	6e-10
d1qwda_		167	b.60.1.1 (A:) Outer membrane lipoprotein Blc {Esch	7e-11
d1qwda_		167	b.60.1.1 (A:) Outer membrane lipoprotein Blc {Esch	5e-10
d1gkab_		174	b.60.1.1 (B:) Alpha-crustacyanin {European lobster	9e-10
d1gkab_		174	b.60.1.1 (B:) Alpha-crustacyanin {European lobster	5e-08
d1z24a1		189	b.60.1.1 (A:1-189) Insecticyanin {Tobacco hornworm	2e-09
d1z24a1		189	b.60.1.1 (A:1-189) Insecticyanin {Tobacco hornworm	8e-08
d1kxoa_		171	b.60.1.1 (A:) Bilin-binding protein {Cabbage butte	3e-07
d1avgi_		142	b.60.1.3 (I:) Thrombin inhibitor {Triatomine bug (	3e-06
d1avgi_		142	b.60.1.3 (I:) Thrombin inhibitor {Triatomine bug (	0.001
d1lf7a_		171	b.60.1.1 (A:) Complement protein C8gamma {Human (H	1e-05
d1lf7a_		171	b.60.1.1 (A:) Complement protein C8gamma {Human (H	2e-04
d1x71a1		174	b.60.1.1 (A:4-177) Neutrophil gelatinase-associate	5e-05
d1x71a1		174	b.60.1.1 (A:4-177) Neutrophil gelatinase-associate	3e-04
d1epba_		160	b.60.1.1 (A:) Retinoic acid-binding protein {Rat (	2e-04
d1pm1x_		180	b.60.1.1 (X:) Nitrophorin 2 (prolixin-s) {Rhodnius	2e-04
d1pm1x_		180	b.60.1.1 (X:) Nitrophorin 2 (prolixin-s) {Rhodnius	6e-04
d1exsa_		160	b.60.1.1 (A:) beta-Lactoglobulin {Pig (Sus scrofa)	2e-04
d1exsa_		160	b.60.1.1 (A:) beta-Lactoglobulin {Pig (Sus scrofa)	8e-04
d1gm6a_		158	b.60.1.1 (A:) Salivary lipocalin {Pig (Sus scrofa)	4e-04
d1gm6a_		158	b.60.1.1 (A:) Salivary lipocalin {Pig (Sus scrofa)	0.001
d1beba_		156	b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus)	0.002
d1jzua_		157	b.60.1.1 (A:) Lipocalin q83 {Common quail (Coturni	0.002
d1x8qa_		184	b.60.1.1 (A:) Nitrophorin 4 {Rhodnius prolixus [Ta	0.002
d1x8qa_		184	b.60.1.1 (A:) Nitrophorin 4 {Rhodnius prolixus [Ta	0.003

>d1kt7a_ b.60.1.1 (A:) Retinol binding protein {Cow (Bos taurus) [TaxId: 9913]} Length = 175	Back information, alignment and structure


class: All beta proteins
fold: Lipocalins
superfamily: Lipocalins
family: Retinol binding protein-like
domain: Retinol binding protein
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 57.9 bits (139), Expect = 6e-12
 Identities = 13/79 (16%), Positives = 27/79 (34%), Gaps = 1/79 (1%)

Query: 72  RYMGIWYEAERYFAVFEFAGKCVSANYTNEGNGIYRVVNTQTS-SITGITSNIEGEIRVF 130
           R+ G WY   +      F    + A ++ + NG            +       +      
Sbjct: 19  RFAGTWYAMAKKDPEGLFLQDNIVAEFSVDENGHMSATAKGRVRLLNNWDVCADMVGTFT 78

Query: 131 ERSDTSKFFIKFPSLPNFP 149
           +  D +KF +K+  + +F 
Sbjct: 79  DTEDPAKFKMKYWGVASFL 97

PyMOL of d1kt7a_

>d1kt7a_ b.60.1.1 (A:) Retinol binding protein {Cow (Bos taurus) [TaxId: 9913]} Length = 175	Back information, alignment and structure

>d1i4ua_ b.60.1.1 (A:) Alpha-crustacyanin {European lobster (Homarus gammarus) [TaxId: 6707]} Length = 181	Back information, alignment and structure

>d1i4ua_ b.60.1.1 (A:) Alpha-crustacyanin {European lobster (Homarus gammarus) [TaxId: 6707]} Length = 181	Back information, alignment and structure

>d1qwda_ b.60.1.1 (A:) Outer membrane lipoprotein Blc {Escherichia coli [TaxId: 562]} Length = 167	Back information, alignment and structure

>d1qwda_ b.60.1.1 (A:) Outer membrane lipoprotein Blc {Escherichia coli [TaxId: 562]} Length = 167	Back information, alignment and structure

>d1gkab_ b.60.1.1 (B:) Alpha-crustacyanin {European lobster (Homarus gammarus) [TaxId: 6707]} Length = 174	Back information, alignment and structure

>d1gkab_ b.60.1.1 (B:) Alpha-crustacyanin {European lobster (Homarus gammarus) [TaxId: 6707]} Length = 174	Back information, alignment and structure

>d1z24a1 b.60.1.1 (A:1-189) Insecticyanin {Tobacco hornworm (Manduca sexta) [TaxId: 7130]} Length = 189	Back information, alignment and structure

>d1z24a1 b.60.1.1 (A:1-189) Insecticyanin {Tobacco hornworm (Manduca sexta) [TaxId: 7130]} Length = 189	Back information, alignment and structure

>d1kxoa_ b.60.1.1 (A:) Bilin-binding protein {Cabbage butterfly (Pieris brassicae) [TaxId: 7116]} Length = 171	Back information, alignment and structure

>d1avgi_ b.60.1.3 (I:) Thrombin inhibitor {Triatomine bug (Triatoma pallidipennis) [TaxId: 30077]} Length = 142	Back information, alignment and structure

>d1avgi_ b.60.1.3 (I:) Thrombin inhibitor {Triatomine bug (Triatoma pallidipennis) [TaxId: 30077]} Length = 142	Back information, alignment and structure

>d1lf7a_ b.60.1.1 (A:) Complement protein C8gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 171	Back information, alignment and structure

>d1lf7a_ b.60.1.1 (A:) Complement protein C8gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 171	Back information, alignment and structure

>d1x71a1 b.60.1.1 (A:4-177) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]} Length = 174	Back information, alignment and structure

>d1x71a1 b.60.1.1 (A:4-177) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]} Length = 174	Back information, alignment and structure

>d1epba_ b.60.1.1 (A:) Retinoic acid-binding protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 160	Back information, alignment and structure

>d1pm1x_ b.60.1.1 (X:) Nitrophorin 2 (prolixin-s) {Rhodnius prolixus [TaxId: 13249]} Length = 180	Back information, alignment and structure

>d1pm1x_ b.60.1.1 (X:) Nitrophorin 2 (prolixin-s) {Rhodnius prolixus [TaxId: 13249]} Length = 180	Back information, alignment and structure

>d1exsa_ b.60.1.1 (A:) beta-Lactoglobulin {Pig (Sus scrofa) [TaxId: 9823]} Length = 160	Back information, alignment and structure

>d1exsa_ b.60.1.1 (A:) beta-Lactoglobulin {Pig (Sus scrofa) [TaxId: 9823]} Length = 160	Back information, alignment and structure

>d1gm6a_ b.60.1.1 (A:) Salivary lipocalin {Pig (Sus scrofa) [TaxId: 9823]} Length = 158	Back information, alignment and structure

>d1gm6a_ b.60.1.1 (A:) Salivary lipocalin {Pig (Sus scrofa) [TaxId: 9823]} Length = 158	Back information, alignment and structure

>d1beba_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]} Length = 156	Back information, alignment and structure

>d1jzua_ b.60.1.1 (A:) Lipocalin q83 {Common quail (Coturnix coturnix) [TaxId: 9091]} Length = 157	Back information, alignment and structure

>d1x8qa_ b.60.1.1 (A:) Nitrophorin 4 {Rhodnius prolixus [TaxId: 13249]} Length = 184	Back information, alignment and structure

>d1x8qa_ b.60.1.1 (A:) Nitrophorin 4 {Rhodnius prolixus [TaxId: 13249]} Length = 184	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		150
d1qwda_		167	Outer membrane lipoprotein Blc {Escherichia coli [	99.73
d1kt7a_		175	Retinol binding protein {Cow (Bos taurus) [TaxId:	99.63
d1i4ua_		181	Alpha-crustacyanin {European lobster (Homarus gamm	99.6
d1kxoa_		171	Bilin-binding protein {Cabbage butterfly (Pieris b	99.55
d1kt7a_		175	Retinol binding protein {Cow (Bos taurus) [TaxId:	99.55
d1i4ua_		181	Alpha-crustacyanin {European lobster (Homarus gamm	99.52
d1kxoa_		171	Bilin-binding protein {Cabbage butterfly (Pieris b	99.44
d1gkab_		174	Alpha-crustacyanin {European lobster (Homarus gamm	99.4
d1gkab_		174	Alpha-crustacyanin {European lobster (Homarus gamm	99.39
d1z24a1		189	Insecticyanin {Tobacco hornworm (Manduca sexta) [T	99.38
d1z24a1		189	Insecticyanin {Tobacco hornworm (Manduca sexta) [T	99.35
d1pm1x_		180	Nitrophorin 2 (prolixin-s) {Rhodnius prolixus [Tax	99.34
d1x71a1		174	Neutrophil gelatinase-associated lipocalin (NGAL)	99.33
d1epba_		160	Retinoic acid-binding protein {Rat (Rattus norvegi	99.27
d1lf7a_		171	Complement protein C8gamma {Human (Homo sapiens) [	99.13
d1ew3a_		159	Lipocalin allergen {Horse (Equus caballus), equ c	99.1
d1beba_		156	beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]	99.1
d1gm6a_		158	Salivary lipocalin {Pig (Sus scrofa) [TaxId: 9823]	99.1
d1x71a1		174	Neutrophil gelatinase-associated lipocalin (NGAL)	99.04
d1exsa_		160	beta-Lactoglobulin {Pig (Sus scrofa) [TaxId: 9823]	99.04
d1x8qa_		184	Nitrophorin 4 {Rhodnius prolixus [TaxId: 13249]}	99.04
d2a2ua_		158	Major urinary protein/alpha-2u-globulin {Rat (Ratt	98.85
d1avgi_		142	Thrombin inhibitor {Triatomine bug (Triatoma palli	98.85
d1epba_		160	Retinoic acid-binding protein {Rat (Rattus norvegi	98.85
d1jzua_		157	Lipocalin q83 {Common quail (Coturnix coturnix) [T	98.8
d1lf7a_		171	Complement protein C8gamma {Human (Homo sapiens) [	98.73
d1avgi_		142	Thrombin inhibitor {Triatomine bug (Triatoma palli	98.67
d1znda1		157	Major urinary protein/alpha-2u-globulin {Mouse (Mu	98.66
d1beba_		156	beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]	98.64
d1jzua_		157	Lipocalin q83 {Common quail (Coturnix coturnix) [T	98.6
d1ew3a_		159	Lipocalin allergen {Horse (Equus caballus), equ c	98.57
d1pm1x_		180	Nitrophorin 2 (prolixin-s) {Rhodnius prolixus [Tax	98.53
d1exsa_		160	beta-Lactoglobulin {Pig (Sus scrofa) [TaxId: 9823]	98.51
d1gm6a_		158	Salivary lipocalin {Pig (Sus scrofa) [TaxId: 9823]	98.4
d1qwda_		167	Outer membrane lipoprotein Blc {Escherichia coli [	98.37
d2a2ua_		158	Major urinary protein/alpha-2u-globulin {Rat (Ratt	98.05
d1x8qa_		184	Nitrophorin 4 {Rhodnius prolixus [TaxId: 13249]}	98.0
d1bj7a_		150	Lipocalin allergen {Cow (Bos taurus), bos d 2 [Tax	97.9
d1znda1		157	Major urinary protein/alpha-2u-globulin {Mouse (Mu	97.75
d1gt1a_		158	Odorant-binding protein {Cow (Bos taurus) [TaxId:	97.45
d1xkia_		139	Von Ebner's gland protein (VEGP, tear lipocalin) {	97.25
d1bj7a_		150	Lipocalin allergen {Cow (Bos taurus), bos d 2 [Tax	97.03
d1xkia_		139	Von Ebner's gland protein (VEGP, tear lipocalin) {	96.87
d1gt1a_		158	Odorant-binding protein {Cow (Bos taurus) [TaxId:	96.19
d1dzka_		148	Odorant-binding protein {Pig (Sus scrofa) [TaxId:	87.77
d1e5pa_		149	Aphrodisin, a sex pheromone {Golden hamster (Mesoc	80.33

>d1qwda_ b.60.1.1 (A:) Outer membrane lipoprotein Blc {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

class: All beta proteins
fold: Lipocalins
superfamily: Lipocalins
family: Retinol binding protein-like
domain: Outer membrane lipoprotein Blc
species: Escherichia coli [TaxId: 562]

Probab=99.73  E-value=7.8e-18  Score=121.81  Aligned_cols=55  Identities=27%  Similarity=0.440  Sum_probs=51.8

Q ss_pred             cceeeeecccccccceeeEEEeecCCccccCceeeeEEEeecCceeEEEEeeeee
Q psy12445          4 SHLRFAYTETSLRYMGIWYEAERYFAVFEFAGKCVSANYTNEGNGIYRVVNTQTS   58 (150)
Q Consensus         4 ~~~~~~~~~d~~ry~G~Wyeiar~p~~~~~~~~c~~a~Ytl~~~g~I~V~N~~~~   58 (150)
                      .++.+|++||++||+|+||||||+|+.++++|.|++++|++..++.+.|.|++..
T Consensus        17 ~~v~~v~nFDl~rf~G~WYeia~~p~~~~~~~~~~~~~y~~~~~~~i~v~~~~~~   71 (167)
T d1qwda_          17 RGVTVVNNFDAKRYLGTWYEIARFDHRFERGLEKVTATYSLRDDGGLNVINKGYN   71 (167)
T ss_dssp             TCEEEESSCCHHHHCEEEEEEEECCCGGGTTCEEEEEEEEECTTSCEEEEEEEEE
T ss_pred             CCCccCCCCCHHHcCeEeeEEEEcCCchhcCceeeEEEeeecCCCcEEEEEEEEc
Confidence            5799999999999999999999999999999999999999999999999998853

PyMOL of d1qwda_

>d1kt7a_ b.60.1.1 (A:) Retinol binding protein {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1i4ua_ b.60.1.1 (A:) Alpha-crustacyanin {European lobster (Homarus gammarus) [TaxId: 6707]}	Back information, alignment and structure

>d1kxoa_ b.60.1.1 (A:) Bilin-binding protein {Cabbage butterfly (Pieris brassicae) [TaxId: 7116]}	Back information, alignment and structure

>d1kt7a_ b.60.1.1 (A:) Retinol binding protein {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1i4ua_ b.60.1.1 (A:) Alpha-crustacyanin {European lobster (Homarus gammarus) [TaxId: 6707]}	Back information, alignment and structure

>d1kxoa_ b.60.1.1 (A:) Bilin-binding protein {Cabbage butterfly (Pieris brassicae) [TaxId: 7116]}	Back information, alignment and structure

>d1gkab_ b.60.1.1 (B:) Alpha-crustacyanin {European lobster (Homarus gammarus) [TaxId: 6707]}	Back information, alignment and structure

>d1gkab_ b.60.1.1 (B:) Alpha-crustacyanin {European lobster (Homarus gammarus) [TaxId: 6707]}	Back information, alignment and structure

>d1z24a1 b.60.1.1 (A:1-189) Insecticyanin {Tobacco hornworm (Manduca sexta) [TaxId: 7130]}	Back information, alignment and structure

>d1z24a1 b.60.1.1 (A:1-189) Insecticyanin {Tobacco hornworm (Manduca sexta) [TaxId: 7130]}	Back information, alignment and structure

>d1pm1x_ b.60.1.1 (X:) Nitrophorin 2 (prolixin-s) {Rhodnius prolixus [TaxId: 13249]}	Back information, alignment and structure

>d1x71a1 b.60.1.1 (A:4-177) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1epba_ b.60.1.1 (A:) Retinoic acid-binding protein {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1lf7a_ b.60.1.1 (A:) Complement protein C8gamma {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ew3a_ b.60.1.1 (A:) Lipocalin allergen {Horse (Equus caballus), equ c 1 [TaxId: 9796]}	Back information, alignment and structure

>d1beba_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1gm6a_ b.60.1.1 (A:) Salivary lipocalin {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1x71a1 b.60.1.1 (A:4-177) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1exsa_ b.60.1.1 (A:) beta-Lactoglobulin {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1x8qa_ b.60.1.1 (A:) Nitrophorin 4 {Rhodnius prolixus [TaxId: 13249]}	Back information, alignment and structure

>d2a2ua_ b.60.1.1 (A:) Major urinary protein/alpha-2u-globulin {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1avgi_ b.60.1.3 (I:) Thrombin inhibitor {Triatomine bug (Triatoma pallidipennis) [TaxId: 30077]}	Back information, alignment and structure

>d1epba_ b.60.1.1 (A:) Retinoic acid-binding protein {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1jzua_ b.60.1.1 (A:) Lipocalin q83 {Common quail (Coturnix coturnix) [TaxId: 9091]}	Back information, alignment and structure

>d1lf7a_ b.60.1.1 (A:) Complement protein C8gamma {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1avgi_ b.60.1.3 (I:) Thrombin inhibitor {Triatomine bug (Triatoma pallidipennis) [TaxId: 30077]}	Back information, alignment and structure

>d1znda1 b.60.1.1 (A:1-157) Major urinary protein/alpha-2u-globulin {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1beba_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1jzua_ b.60.1.1 (A:) Lipocalin q83 {Common quail (Coturnix coturnix) [TaxId: 9091]}	Back information, alignment and structure

>d1ew3a_ b.60.1.1 (A:) Lipocalin allergen {Horse (Equus caballus), equ c 1 [TaxId: 9796]}	Back information, alignment and structure

>d1pm1x_ b.60.1.1 (X:) Nitrophorin 2 (prolixin-s) {Rhodnius prolixus [TaxId: 13249]}	Back information, alignment and structure

>d1exsa_ b.60.1.1 (A:) beta-Lactoglobulin {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1gm6a_ b.60.1.1 (A:) Salivary lipocalin {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1qwda_ b.60.1.1 (A:) Outer membrane lipoprotein Blc {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2a2ua_ b.60.1.1 (A:) Major urinary protein/alpha-2u-globulin {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1x8qa_ b.60.1.1 (A:) Nitrophorin 4 {Rhodnius prolixus [TaxId: 13249]}	Back information, alignment and structure

>d1bj7a_ b.60.1.1 (A:) Lipocalin allergen {Cow (Bos taurus), bos d 2 [TaxId: 9913]}	Back information, alignment and structure

>d1znda1 b.60.1.1 (A:1-157) Major urinary protein/alpha-2u-globulin {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1gt1a_ b.60.1.1 (A:) Odorant-binding protein {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1xkia_ b.60.1.1 (A:) Von Ebner's gland protein (VEGP, tear lipocalin) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1bj7a_ b.60.1.1 (A:) Lipocalin allergen {Cow (Bos taurus), bos d 2 [TaxId: 9913]}	Back information, alignment and structure

>d1xkia_ b.60.1.1 (A:) Von Ebner's gland protein (VEGP, tear lipocalin) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gt1a_ b.60.1.1 (A:) Odorant-binding protein {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1dzka_ b.60.1.1 (A:) Odorant-binding protein {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1e5pa_ b.60.1.1 (A:) Aphrodisin, a sex pheromone {Golden hamster (Mesocricetus auratus) [TaxId: 10036]}	Back information, alignment and structure