Psyllid ID: psy12455

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150--
ILLYIGDSKTGKEKVQLTDVKQRRLCSAAKKALSKIPTKHIKGEDKEISGDGECCAICIEFYKPSDIVRILPCKHEYHKNCIDPWLLEHRTCPMCKMDILKHYGFVILAHSPLVTTRLKQPLNSPYEAKCTPNSKHSEQKFDPAGNQTRDLC
cEEEEcccccHHHHHHHHHHHcccccHHHHHHHHccccEEEcccccccccccccccccccccccccEEEEcccccccccccHHHHHccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccc
cEEEEEcccccccccccccccHHHHHHHHHHHHHHcccEEEcccccccccccccEEEEEEccccccEEEEEEccccHcHHcccHHHHHcccccccHHcHHHHcccccccccccccccccccccccccccccccccccccccccccccccccc
illyigdsktgkekvQLTDVKQRRLCSAAKKALSkiptkhikgedkeisgdgecCAICiefykpsdivrilpckheyhkncidpwllehrtcpmckmdILKHYGFVILAHsplvttrlkqplnspyeakctpnskhseqkfdpagnqtrdlc
illyigdsktgkekvqltdvkqrRLCSAakkalskiptkhikgedkeisgdGECCAICIEFYKPSDIVRILPCKHEYHKNCIDPWLLEHRTCPMCKMDILKHYGFVILAHSPLVTTRLKQPLNSPYEAkctpnskhseqkfdpagnqtrdlc
ILLYIGDSKTGKEKVQLTDVKQRRLCSAAKKALSKIPTKHIKGEDKEISGDGECCAICIEFYKPSDIVRILPCKHEYHKNCIDPWLLEHRTCPMCKMDILKHYGFVILAHSPLVTTRLKQPLNSPYEAKCTPNSKHSEQKFDPAGNQTRDLC
***********************************************ISGDGECCAICIEFYKPSDIVRILPCKHEYHKNCIDPWLLEHRTCPMCKMDILKHYGFVILAHSPLVTTRL**********************************
ILLYIGDSKTGK***********************IPTKHI**********GECCAICIEFYKPSDIVRILPCKHEYHKNCIDPWLLEHRTCPMCKMDI*****************************************************
ILLYIGDSKTGKEKVQLTDVKQRRLCSAAKKALSKIPTKHIKGEDKEISGDGECCAICIEFYKPSDIVRILPCKHEYHKNCIDPWLLEHRTCPMCKMDILKHYGFVILAHSPLVTTRLKQPLNSPY**************************
ILLYIGDSKTGKEKVQ**DVKQRRLCSAAKKALSKIPTKHIKGEDKEISGDGECCAICIEFYKPSDIVRILPCKHEYHKNCIDPWLLEHRTCPMCKMDILKHYGF***********************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ILLYIGDSKTGKEKVQLTDVKQRRLCSAAKKALSKIPTKHIKGEDKEISGDGECCAICIEFYKPSDIVRILPCKHEYHKNCIDPWLLEHRTCPMCKMDILKHYGFVILAHSPLVTTRLKQPLNSPYEAKCTPNSKHSEQKFDPAGNQTRDLC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query152 2.2.26 [Sep-21-2011]
Q06003461 Protein goliath OS=Drosop yes N/A 0.618 0.203 0.652 3e-34
Q9ULK6438 RING finger protein 150 O yes N/A 0.572 0.198 0.632 1e-28
Q5DTZ6437 RING finger protein 150 O yes N/A 0.572 0.199 0.620 2e-28
Q9D304428 E3 ubiquitin-protein liga no N/A 0.809 0.287 0.472 1e-27
Q8AWW4404 E3 ubiquitin-protein liga N/A N/A 0.559 0.210 0.647 4e-27
Q29RU0431 E3 ubiquitin-protein liga no N/A 0.809 0.285 0.456 5e-27
Q566M8419 RING finger protein 150 O no N/A 0.572 0.207 0.586 1e-26
Q8TEB7428 E3 ubiquitin-protein liga no N/A 0.572 0.203 0.597 1e-26
Q5RF74428 E3 ubiquitin-protein liga no N/A 0.572 0.203 0.586 2e-26
Q86XS8419 E3 ubiquitin-protein liga no N/A 0.618 0.224 0.567 2e-26
>sp|Q06003|GOLI_DROME Protein goliath OS=Drosophila melanogaster GN=gol PE=2 SV=3 Back     alignment and function desciption
 Score =  144 bits (362), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 62/95 (65%), Positives = 73/95 (76%), Gaps = 1/95 (1%)

Query: 15  VQLTDVKQRRLCSAAKKALSKIPTKHIKGEDKEISGDGECCAICIEFYKPSDIVRILPCK 74
           +Q  D + R LCS  KKA+ KIPTK  K  D E   D +CCAICIE YKP+D +RILPCK
Sbjct: 264 MQAKDQQSRNLCSVTKKAIMKIPTKTGKFSD-EKDLDSDCCAICIEAYKPTDTIRILPCK 322

Query: 75  HEYHKNCIDPWLLEHRTCPMCKMDILKHYGFVILA 109
           HE+HKNCIDPWL+EHRTCPMCK+D+LK YG+V L 
Sbjct: 323 HEFHKNCIDPWLIEHRTCPMCKLDVLKFYGYVFLG 357
Regulation of gene expression during embryonic mesoderm formation. Putative role as transcription factor.
Drosophila melanogaster (taxid: 7227)
>sp|Q9ULK6|RN150_HUMAN RING finger protein 150 OS=Homo sapiens GN=RNF150 PE=2 SV=2 Back     alignment and function description
>sp|Q5DTZ6|RN150_MOUSE RING finger protein 150 OS=Mus musculus GN=Rnf150 PE=2 SV=2 Back     alignment and function description
>sp|Q9D304|RN128_MOUSE E3 ubiquitin-protein ligase RNF128 OS=Mus musculus GN=Rnf128 PE=1 SV=1 Back     alignment and function description
>sp|Q8AWW4|RN128_XENLA E3 ubiquitin-protein ligase RNF128 OS=Xenopus laevis GN=rnf128 PE=2 SV=2 Back     alignment and function description
>sp|Q29RU0|RN128_BOVIN E3 ubiquitin-protein ligase RNF128 OS=Bos taurus GN=RNF128 PE=2 SV=1 Back     alignment and function description
>sp|Q566M8|RN150_DANRE RING finger protein 150 OS=Danio rerio GN=rnf150 PE=2 SV=1 Back     alignment and function description
>sp|Q8TEB7|RN128_HUMAN E3 ubiquitin-protein ligase RNF128 OS=Homo sapiens GN=RNF128 PE=1 SV=1 Back     alignment and function description
>sp|Q5RF74|RN128_PONAB E3 ubiquitin-protein ligase RNF128 OS=Pongo abelii GN=RNF128 PE=2 SV=1 Back     alignment and function description
>sp|Q86XS8|GOLI_HUMAN E3 ubiquitin-protein ligase RNF130 OS=Homo sapiens GN=RNF130 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query152
328704644 451 PREDICTED: protein goliath-like isoform 0.677 0.228 0.691 1e-38
328704642 367 PREDICTED: protein goliath-like isoform 0.677 0.280 0.691 2e-38
91081613 470 PREDICTED: similar to goliath E3 ubiquit 0.605 0.195 0.782 1e-37
157132158 500 goliath E3 ubiquitin ligase [Aedes aegyp 0.598 0.182 0.698 1e-36
321459525 473 hypothetical protein DAPPUDRAFT_327936 [ 0.585 0.188 0.711 1e-34
158290004 361 AGAP010356-PA [Anopheles gambiae str. PE 0.625 0.263 0.680 6e-34
195430052 779 GK21726 [Drosophila willistoni] gi|19415 0.605 0.118 0.677 1e-33
195124305 490 GI18477 [Drosophila mojavensis] gi|19391 0.618 0.191 0.663 3e-33
357602283 408 putative goliath E3 ubiquitin ligase [Da 0.611 0.227 0.677 4e-33
195154835 737 GL16830 [Drosophila persimilis] gi|19411 0.605 0.124 0.655 1e-32
>gi|328704644|ref|XP_001948021.2| PREDICTED: protein goliath-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  164 bits (414), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 89/107 (83%), Gaps = 4/107 (3%)

Query: 1   ILLYIGDSKTGKEKVQLTDVKQRRLCSAAKKALSKIPTKHIKGEDKEISGDGECCAICIE 60
           +  YI   +    K QL+    RRLC+AAKKALSKIPTKHIK +DKEI GDG+CCA+CIE
Sbjct: 218 VFYYIQRFRYIHAKDQLS----RRLCNAAKKALSKIPTKHIKMDDKEIVGDGDCCAVCIE 273

Query: 61  FYKPSDIVRILPCKHEYHKNCIDPWLLEHRTCPMCKMDILKHYGFVI 107
            Y+PS++VRILPC+HE+HK+C+DPWLLEHRTCPMCKMDILKHYGF+ 
Sbjct: 274 PYRPSEVVRILPCRHEFHKSCVDPWLLEHRTCPMCKMDILKHYGFLF 320

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328704642|ref|XP_003242556.1| PREDICTED: protein goliath-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|91081613|ref|XP_966546.1| PREDICTED: similar to goliath E3 ubiquitin ligase [Tribolium castaneum] Back     alignment and taxonomy information
>gi|157132158|ref|XP_001662491.1| goliath E3 ubiquitin ligase [Aedes aegypti] gi|108871273|gb|EAT35498.1| AAEL012337-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|321459525|gb|EFX70577.1| hypothetical protein DAPPUDRAFT_327936 [Daphnia pulex] Back     alignment and taxonomy information
>gi|158290004|ref|XP_559104.3| AGAP010356-PA [Anopheles gambiae str. PEST] gi|157018431|gb|EAL41047.3| AGAP010356-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|195430052|ref|XP_002063071.1| GK21726 [Drosophila willistoni] gi|194159156|gb|EDW74057.1| GK21726 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195124305|ref|XP_002006634.1| GI18477 [Drosophila mojavensis] gi|193911702|gb|EDW10569.1| GI18477 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|357602283|gb|EHJ63333.1| putative goliath E3 ubiquitin ligase [Danaus plexippus] Back     alignment and taxonomy information
>gi|195154835|ref|XP_002018318.1| GL16830 [Drosophila persimilis] gi|194114114|gb|EDW36157.1| GL16830 [Drosophila persimilis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query152
FB|FBgn0004919461 gol "goliath" [Drosophila mela 0.605 0.199 0.642 1.8e-32
MGI|MGI:1914139428 Rnf128 "ring finger protein 12 0.809 0.287 0.472 2.4e-28
UNIPROTKB|F1MCR4431 RNF128 "E3 ubiquitin-protein l 0.809 0.285 0.456 3.1e-28
UNIPROTKB|D6RIE5230 RNF150 "RING finger protein 15 0.565 0.373 0.639 6.4e-28
UNIPROTKB|Q9ULK6438 RNF150 "RING finger protein 15 0.565 0.196 0.639 6.4e-28
UNIPROTKB|J9JHQ4310 RNF150 "Uncharacterized protei 0.565 0.277 0.639 8.2e-28
UNIPROTKB|J9NYE2382 RNF150 "Uncharacterized protei 0.565 0.225 0.639 8.2e-28
UNIPROTKB|F1RRE9269 RNF150 "Uncharacterized protei 0.565 0.319 0.639 8.2e-28
UNIPROTKB|F1RXM2431 LOC100515872 "Uncharacterized 0.809 0.285 0.456 8.2e-28
RGD|1566282428 Rnf128 "ring finger protein 12 0.809 0.287 0.456 8.2e-28
FB|FBgn0004919 gol "goliath" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 355 (130.0 bits), Expect = 1.8e-32, P = 1.8e-32
 Identities = 61/95 (64%), Positives = 76/95 (80%)

Query:    15 VQLTDVKQRRLCSAAKKALSKIPTKHIK-GEDKEISGDGECCAICIEFYKPSDIVRILPC 73
             +Q  D + R LCS  KKA+ KIPTK  K  ++K++  D +CCAICIE YKP+D +RILPC
Sbjct:   264 MQAKDQQSRNLCSVTKKAIMKIPTKTGKFSDEKDL--DSDCCAICIEAYKPTDTIRILPC 321

Query:    74 KHEYHKNCIDPWLLEHRTCPMCKMDILKHYGFVIL 108
             KHE+HKNCIDPWL+EHRTCPMCK+D+LK YG+V L
Sbjct:   322 KHEFHKNCIDPWLIEHRTCPMCKLDVLKFYGYVFL 356
GO:0005634 "nucleus" evidence=NAS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=NAS
GO:0007498 "mesoderm development" evidence=NAS
GO:0008270 "zinc ion binding" evidence=IEA
MGI|MGI:1914139 Rnf128 "ring finger protein 128" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1MCR4 RNF128 "E3 ubiquitin-protein ligase RNF128" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|D6RIE5 RNF150 "RING finger protein 150" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9ULK6 RNF150 "RING finger protein 150" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J9JHQ4 RNF150 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9NYE2 RNF150 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RRE9 RNF150 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1RXM2 LOC100515872 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1566282 Rnf128 "ring finger protein 128, E3 ubiquitin protein ligase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q06003GOLI_DROMENo assigned EC number0.65260.61840.2039yesN/A
Q5DTZ6RN150_MOUSENo assigned EC number0.62060.57230.1990yesN/A
Q9ULK6RN150_HUMANNo assigned EC number0.63210.57230.1986yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query152
COG5540374 COG5540, COG5540, RING-finger-containing ubiquitin 9e-13
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 1e-11
cd0016245 cd00162, RING, RING-finger (Really Interesting New 5e-09
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 6e-07
pfam1267873 pfam12678, zf-rbx1, RING-H2 zinc finger 8e-07
smart0018440 smart00184, RING, Ring finger 1e-05
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 2e-05
COG5243491 COG5243, HRD1, HRD ubiquitin ligase complex, ER me 1e-04
COG52191525 COG5219, COG5219, Uncharacterized conserved protei 0.001
PHA02929238 PHA02929, PHA02929, N1R/p28-like protein; Provisio 0.002
>gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score = 63.9 bits (155), Expect = 9e-13
 Identities = 28/72 (38%), Positives = 39/72 (54%), Gaps = 8/72 (11%)

Query: 36  IPTKHIKGEDKEIS-------GDGECCAICIEFYKPSDIVRILPCKHEYHKNCIDPWLLE 88
           IPT   KG  K +S         G  CAIC+  +  +D +R+LPC H +H  C+D WLL 
Sbjct: 300 IPTTTTKGSLKPLSIERAVEADKGVECAICMSNFIKNDRLRVLPCDHRFHVGCVDKWLLG 359

Query: 89  HR-TCPMCKMDI 99
           +   CP+C+  I
Sbjct: 360 YSNKCPVCRTAI 371

Length = 374
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|227544 COG5219, COG5219, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 152
KOG4628|consensus348 99.71
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.59
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 99.47
PHA02929238 N1R/p28-like protein; Provisional 99.41
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 99.38
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 99.34
KOG0823|consensus230 99.3
KOG0317|consensus293 99.23
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.22
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.2
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 99.19
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 99.14
cd0016245 RING RING-finger (Really Interesting New Gene) dom 99.08
smart0050463 Ubox Modified RING finger domain. Modified RING fi 99.02
KOG0320|consensus187 99.02
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 99.0
PHA02926242 zinc finger-like protein; Provisional 98.97
PF1463444 zf-RING_5: zinc-RING finger domain 98.96
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.96
KOG0802|consensus 543 98.91
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.91
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.88
KOG0287|consensus 442 98.76
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.71
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.65
KOG2164|consensus 513 98.63
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.62
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 98.62
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.59
KOG2177|consensus 386 98.47
KOG0828|consensus636 98.44
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 98.42
KOG1734|consensus328 98.41
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.38
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 98.3
KOG1493|consensus84 98.29
KOG1785|consensus563 98.25
COG52191525 Uncharacterized conserved protein, contains RING Z 98.19
KOG2930|consensus114 98.14
KOG4265|consensus349 98.12
KOG0827|consensus 465 98.11
KOG0804|consensus 493 98.09
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 98.07
KOG4159|consensus 398 98.06
KOG0311|consensus 381 97.96
KOG4445|consensus 368 97.9
KOG0824|consensus 324 97.89
KOG4172|consensus62 97.87
KOG1039|consensus344 97.72
KOG0978|consensus698 97.57
KOG0297|consensus 391 97.57
KOG4692|consensus489 97.55
KOG0825|consensus 1134 97.55
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 97.5
KOG1941|consensus518 97.49
COG5152259 Uncharacterized conserved protein, contains RING a 97.4
KOG2660|consensus 331 97.31
KOG1645|consensus 463 97.29
KOG2879|consensus298 97.15
KOG1813|consensus313 97.14
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 97.07
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 97.04
KOG1814|consensus 445 97.03
KOG4275|consensus350 96.99
KOG3970|consensus 299 96.98
PHA02825162 LAP/PHD finger-like protein; Provisional 96.8
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 96.78
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 96.72
KOG0826|consensus357 96.69
COG5222427 Uncharacterized conserved protein, contains RING Z 96.67
COG5236 493 Uncharacterized conserved protein, contains RING Z 96.66
KOG1002|consensus 791 96.65
KOG1428|consensus 3738 96.59
KOG0801|consensus205 96.58
KOG1571|consensus355 96.51
KOG3039|consensus303 96.43
KOG1952|consensus 950 96.41
PF04641260 Rtf2: Rtf2 RING-finger 96.35
PHA02862156 5L protein; Provisional 96.31
KOG4739|consensus 233 96.24
COG5175 480 MOT2 Transcriptional repressor [Transcription] 96.18
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 96.13
KOG1940|consensus276 96.0
PHA03096284 p28-like protein; Provisional 95.93
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 95.77
KOG3268|consensus234 95.41
KOG2114|consensus933 95.36
KOG4185|consensus 296 95.33
PF10272358 Tmpp129: Putative transmembrane protein precursor; 95.3
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 95.27
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 95.19
KOG3002|consensus 299 94.78
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 94.56
KOG1001|consensus 674 94.56
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 94.41
KOG2817|consensus394 94.28
KOG4367|consensus 699 94.24
KOG2932|consensus 389 93.88
KOG2034|consensus911 93.25
KOG0309|consensus1081 92.56
KOG0298|consensus 1394 92.35
KOG1100|consensus207 92.33
KOG3800|consensus 300 92.05
KOG0827|consensus 465 91.77
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 91.11
KOG1609|consensus 323 90.62
KOG1812|consensus 384 90.37
KOG3899|consensus381 89.73
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 89.2
PF0690657 DUF1272: Protein of unknown function (DUF1272); In 88.11
KOG3053|consensus 293 87.02
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 86.67
KOG0824|consensus 324 86.65
KOG1815|consensus 444 84.77
KOG3113|consensus293 83.93
KOG4362|consensus 684 83.67
KOG1812|consensus384 83.03
KOG3039|consensus 303 82.73
KOG3005|consensus276 81.26
PF13901202 DUF4206: Domain of unknown function (DUF4206) 81.0
KOG1829|consensus580 80.87
KOG0802|consensus543 80.57
KOG0269|consensus839 80.52
KOG3579|consensus352 80.33
KOG2807|consensus378 80.1
>KOG4628|consensus Back     alignment and domain information 
Probab=99.71  E-value=3.4e-17  Score=131.11  Aligned_cols=83  Identities=43%  Similarity=0.847  Sum_probs=71.1

Q ss_pred             hhhhHHHHHHhhcCCCccccCCCCcCCCCCccccccccCccCCCcEEEecCCCcccHhhHHHHHhCCC-ccccccccccc
Q psy12455         23 RRLCSAAKKALSKIPTKHIKGEDKEISGDGECCAICIEFYKPSDIVRILPCKHEYHKNCIDPWLLEHR-TCPMCKMDILK  101 (152)
Q Consensus        23 ~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~C~IC~~~~~~~~~~~~lpC~H~fh~~Ci~~w~~~~~-~CP~Cr~~~~~  101 (152)
                      .+.....++.+.++|...+...+++...  +.|+||+|+|..++++++|||+|.||..||..||.... .||+||+.+..
T Consensus       202 ~~~~r~~k~~l~~~p~~~f~~~~~~~~~--~~CaIClEdY~~GdklRiLPC~H~FH~~CIDpWL~~~r~~CPvCK~di~~  279 (348)
T KOG4628|consen  202 LRRNRLIKRLLKKLPVRTFTKGDDEDAT--DTCAICLEDYEKGDKLRILPCSHKFHVNCIDPWLTQTRTFCPVCKRDIRT  279 (348)
T ss_pred             hhhhhhHHHHHhhCCcEEeccccccCCC--ceEEEeecccccCCeeeEecCCCchhhccchhhHhhcCccCCCCCCcCCC
Confidence            4566789999999999999877666533  78999999999999999999999999999999999876 59999998876


Q ss_pred             ccCccc
Q psy12455        102 HYGFVI  107 (152)
Q Consensus       102 ~~~~~~  107 (152)
                      ..+...
T Consensus       280 ~~~~~~  285 (348)
T KOG4628|consen  280 DSGSEP  285 (348)
T ss_pred             CCCCCC
Confidence            655543

>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0823|consensus Back     alignment and domain information
>KOG0317|consensus Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG0320|consensus Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG0802|consensus Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG0287|consensus Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG2164|consensus Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2177|consensus Back     alignment and domain information
>KOG0828|consensus Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG1734|consensus Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG1493|consensus Back     alignment and domain information
>KOG1785|consensus Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2930|consensus Back     alignment and domain information
>KOG4265|consensus Back     alignment and domain information
>KOG0827|consensus Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG4159|consensus Back     alignment and domain information
>KOG0311|consensus Back     alignment and domain information
>KOG4445|consensus Back     alignment and domain information
>KOG0824|consensus Back     alignment and domain information
>KOG4172|consensus Back     alignment and domain information
>KOG1039|consensus Back     alignment and domain information
>KOG0978|consensus Back     alignment and domain information
>KOG0297|consensus Back     alignment and domain information
>KOG4692|consensus Back     alignment and domain information
>KOG0825|consensus Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG1941|consensus Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG2660|consensus Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG2879|consensus Back     alignment and domain information
>KOG1813|consensus Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG1814|consensus Back     alignment and domain information
>KOG4275|consensus Back     alignment and domain information
>KOG3970|consensus Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG0826|consensus Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>KOG1428|consensus Back     alignment and domain information
>KOG0801|consensus Back     alignment and domain information
>KOG1571|consensus Back     alignment and domain information
>KOG3039|consensus Back     alignment and domain information
>KOG1952|consensus Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG4739|consensus Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>KOG1940|consensus Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG3268|consensus Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>KOG4185|consensus Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG3002|consensus Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>KOG2817|consensus Back     alignment and domain information
>KOG4367|consensus Back     alignment and domain information
>KOG2932|consensus Back     alignment and domain information
>KOG2034|consensus Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>KOG1100|consensus Back     alignment and domain information
>KOG3800|consensus Back     alignment and domain information
>KOG0827|consensus Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1609|consensus Back     alignment and domain information
>KOG1812|consensus Back     alignment and domain information
>KOG3899|consensus Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>PF06906 DUF1272: Protein of unknown function (DUF1272); InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length Back     alignment and domain information
>KOG3053|consensus Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0824|consensus Back     alignment and domain information
>KOG1815|consensus Back     alignment and domain information
>KOG3113|consensus Back     alignment and domain information
>KOG4362|consensus Back     alignment and domain information
>KOG1812|consensus Back     alignment and domain information
>KOG3039|consensus Back     alignment and domain information
>KOG3005|consensus Back     alignment and domain information
>PF13901 DUF4206: Domain of unknown function (DUF4206) Back     alignment and domain information
>KOG1829|consensus Back     alignment and domain information
>KOG0802|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG3579|consensus Back     alignment and domain information
>KOG2807|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query152
2ep4_A74 Solution Structure Of Ring Finger From Human Ring F 3e-09
1x4j_A75 Solution Structure Of Ring Finger In Ring Finger Pr 5e-09
2ect_A78 Solution Structure Of The Zinc Finger, C3hc4 Type ( 3e-08
2kiz_A69 Solution Structure Of Arkadia Ring-H2 Finger Domain 1e-07
2l0b_A91 Solution Nmr Structure Of Zinc Finger Domain Of E3 2e-07
1iym_A55 Ring-H2 Finger Domain Of El5 Length = 55 6e-07
2ecn_A70 Solution Structure Of The Ring Domain Of The Human 3e-05
>pdb|2EP4|A Chain A, Solution Structure Of Ring Finger From Human Ring Finger Protein 24 Length = 74 Back     alignment and structure 
Iteration: 1

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 33/49 (67%)
Query: 53  ECCAICIEFYKPSDIVRILPCKHEYHKNCIDPWLLEHRTCPMCKMDILK 101
           E CA+C+E +KP D + I PCKH +H+ C+  WL   + CP+C M +L+
Sbjct: 16  ELCAVCLEDFKPRDELGICPCKHAFHRKCLIKWLEVRKVCPLCNMPVLQ 64
>pdb|1X4J|A Chain A, Solution Structure Of Ring Finger In Ring Finger Protein 38 Length = 75 Back     alignment and structure
>pdb|2ECT|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Of Ring Finger Protein 126 Length = 78 Back     alignment and structure
>pdb|2KIZ|A Chain A, Solution Structure Of Arkadia Ring-H2 Finger Domain Length = 69 Back     alignment and structure
>pdb|2L0B|A Chain A, Solution Nmr Structure Of Zinc Finger Domain Of E3 Ubiquitin-Protein Ligase Praja-1 From Homo Sapiens, Northeast Structural Genomics Consortium (Nesg) Target Hr4710b Length = 91 Back     alignment and structure
>pdb|1IYM|A Chain A, Ring-H2 Finger Domain Of El5 Length = 55 Back     alignment and structure
>pdb|2ECN|A Chain A, Solution Structure Of The Ring Domain Of The Human Ring Finger Protein 141 Length = 70 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query152
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 6e-28
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 2e-26
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 7e-26
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 1e-25
2ect_A78 Ring finger protein 126; metal binding protein, st 5e-24
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 2e-20
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 2e-18
2ecm_A55 Ring finger and CHY zinc finger domain- containing 2e-17
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 3e-16
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 1e-11
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 5e-11
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 2e-09
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 3e-09
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 2e-08
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 7e-08
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 8e-08
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 9e-08
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 9e-07
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 1e-06
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 2e-06
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 5e-06
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 6e-06
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 1e-05
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 2e-05
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 4e-05
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 6e-05
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 4e-04
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 6e-04
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 9e-04
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
 Score = 97.8 bits (244), Expect = 6e-28
 Identities = 21/77 (27%), Positives = 40/77 (51%), Gaps = 2/77 (2%)

Query: 28  AAKKALSKIPTKHIKGEDKEISGDGECCAICIEFYKPSDIVRILPCKHEYHKNCIDPWLL 87
            +  +  ++P+      +     +   C +C+  ++   ++R+LPC HE+H  C+D WL 
Sbjct: 1   GSSGSSGQLPSYRFNPNNH--QSEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLK 58

Query: 88  EHRTCPMCKMDILKHYG 104
            +RTCP+C+ D     G
Sbjct: 59  ANRTCPICRADSGPSSG 75
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query152
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.67
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.66
2ect_A78 Ring finger protein 126; metal binding protein, st 99.63
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.62
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.61
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.59
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.52
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.5
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.5
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.49
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.49
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.49
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.48
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.48
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.47
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.47
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.45
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.45
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.43
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.43
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.43
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.42
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.42
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.42
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.41
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.4
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.39
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.37
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.37
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.36
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.35
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.35
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.34
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.34
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.33
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.31
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.31
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 99.29
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.29
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.28
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.27
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.27
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.26
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.26
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 99.25
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.25
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.25
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.23
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.21
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.2
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.17
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.16
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 99.15
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 99.13
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 99.11
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 99.1
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 99.07
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 99.07
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.04
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 99.02
2ea5_A68 Cell growth regulator with ring finger domain prot 98.98
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.94
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.88
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.87
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.85
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.77
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.74
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.73
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.7
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.65
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 98.28
3nw0_A238 Non-structural maintenance of chromosomes element 98.12
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 96.6
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 96.23
1wil_A89 KIAA1045 protein; ring finger domain, structural g 95.75
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 95.06
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 93.09
1we9_A64 PHD finger family protein; structural genomics, PH 88.9
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 88.53
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 88.47
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 86.35
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 86.32
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 86.07
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 85.87
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 85.42
2k16_A75 Transcription initiation factor TFIID subunit 3; p 85.29
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 84.14
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 83.89
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 83.55
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 83.1
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 82.82
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 82.4
1wem_A76 Death associated transcription factor 1; structura 81.27
2yt5_A66 Metal-response element-binding transcription facto 81.21
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 80.86
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 80.42
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
Probab=99.67  E-value=2.3e-17  Score=108.74  Aligned_cols=77  Identities=30%  Similarity=0.715  Sum_probs=64.0

Q ss_pred             hhhHHHHHHhhcCCCccccCCCCcCCCCCccccccccCccCCCcEEEecCCCcccHhhHHHHHhCCCccccccccccc
Q psy12455         24 RLCSAAKKALSKIPTKHIKGEDKEISGDGECCAICIEFYKPSDIVRILPCKHEYHKNCIDPWLLEHRTCPMCKMDILK  101 (152)
Q Consensus        24 ~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~C~IC~~~~~~~~~~~~lpC~H~fh~~Ci~~w~~~~~~CP~Cr~~~~~  101 (152)
                      ...++++..++.||...+..... ..+++..|+||++.|...+.++.++|+|.||..||..|+..+.+||+||..+..
T Consensus        13 ~~~~~s~~~i~~lp~~~~~~~~~-~~~~~~~C~IC~~~~~~~~~~~~l~C~H~Fh~~Ci~~wl~~~~~CP~Cr~~~~~   89 (91)
T 2l0b_A           13 ANPPASKESIDALPEILVTEDHG-AVGQEMCCPICCSEYVKGDVATELPCHHYFHKPCVSIWLQKSGTCPVCRCMFPP   89 (91)
T ss_dssp             CCCCCCHHHHHTSCEEECCTTCS-SSSSCSEETTTTEECCTTCEEEEETTTEEEEHHHHHHHHTTTCBCTTTCCBSSC
T ss_pred             CCCCCCHHHHHhCCCeeeccccc-ccCCCCCCcccChhhcCCCcEEecCCCChHHHHHHHHHHHcCCcCcCcCccCCC
Confidence            34557788899999887765443 234677899999999988888899999999999999999999999999998753
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 152
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 4e-15
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 3e-12
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 1e-09
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 2e-09
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 1e-06
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 1e-06
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 3e-06
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 1e-05
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 2e-05
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 4e-05
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 9e-05
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 0.002
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 0.004
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]

 Score = 63.4 bits (154), Expect = 4e-15
 Identities = 20/51 (39%), Positives = 31/51 (60%), Gaps = 1/51 (1%)

Query: 51  DGECCAICIEFYKPSDIVRILP-CKHEYHKNCIDPWLLEHRTCPMCKMDIL 100
           DG  CA+C+   +  +  R LP C H +H  C+D WL  H TCP+C++ ++
Sbjct: 4   DGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVV 54
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query152
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.7
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.54
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.54
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.48
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.46
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.42
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.42
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.39
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.39
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.34
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.34
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.26
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.26
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 99.16
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.13
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 99.02
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.66
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 95.35
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 93.17
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 90.79
d1wema_76 Death associated transcription factor 1, Datf1 (DI 87.95
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 87.68
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 86.83
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 85.55
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 85.12
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 81.93
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 81.25
d1y02a251 Rififylin (FYVE-RING finger protein Sakura) {Human 80.81
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]

Probab=99.70  E-value=3.5e-18  Score=101.31  Aligned_cols=50  Identities=40%  Similarity=1.081  Sum_probs=45.1

Q ss_pred             CCccccccccCccCCCcEEEec-CCCcccHhhHHHHHhCCCcccccccccc
Q psy12455         51 DGECCAICIEFYKPSDIVRILP-CKHEYHKNCIDPWLLEHRTCPMCKMDIL  100 (152)
Q Consensus        51 ~~~~C~IC~~~~~~~~~~~~lp-C~H~fh~~Ci~~w~~~~~~CP~Cr~~~~  100 (152)
                      ++.+|+||++.|..++.+..++ |+|.||..||..|++.+.+||+||+.+.
T Consensus         4 d~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~~~~~CP~CR~~i~   54 (55)
T d1iyma_           4 DGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVV   54 (55)
T ss_dssp             CSCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTTCCSCSSSCCCSC
T ss_pred             CCCCCeEECccccCCCEEEEeCCCCCcccHHHHHHHHHhCCcCCCCCCEeE
Confidence            5567999999999888888776 9999999999999999999999999874
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure