Psyllid ID: psy12464


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60-------
MGAKLPVFTSLQISVGIKKTFLIEGLGFLIVPFLPASNLFFPVGFVIAERVLYIPSMGFCMLLSKVC
ccccccEEEEEEEcccccHHHHHHHHHHHHHcccccccccEEEEEEEEEEEEEccHHHHHHHHHccc
ccccHHHHHHEccccccccHEEEHHHHHHHHccccHcccEEHHHHHEHHHHEEcHHHHHHHHHHHcc
MGAKLPVFTSLQISVGIKKTFLIEGLgflivpflpasnlffpVGFVIAERVLYIPSMGFCMLLSKVC
MGAKLPVFTSLQISVGIKKTFLIEGLGFLIVPFLPASNLFFPVGFVIAERVLYIPSMGFCMLLSKVC
MGAKLPVFTSLQISVGIKKTFLIEGLGFLIVPFLPASNLFFPVGFVIAERVLYIPSMGFCMLLSKVC
*****PVFTSLQISVGIKKTFLIEGLGFLIVPFLPASNLFFPVGFVIAERVLYIPSMGFCMLLS***
****LPVFTSLQISVGIKKTFLIEGLGFLIVPFLPASNLFFPVGFVIAERVLYIPSMGFCMLLSKVC
MGAKLPVFTSLQISVGIKKTFLIEGLGFLIVPFLPASNLFFPVGFVIAERVLYIPSMGFCMLLSKVC
*GAKLPVFTSLQISVGIKKTFLIEGLGFLIVPFLPASNLFFPVGFVIAERVLYIPSMGFCMLLSKVC
oooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHiiii
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGAKLPVFTSLQISVGIKKTFLIEGLGFLIVPFLPASNLFFPVGFVIAERVLYIPSMGFCMLLSKVC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query67 2.2.26 [Sep-21-2011]
Q5T4D3 741 Transmembrane and TPR rep yes N/A 0.731 0.066 0.693 9e-15
Q8BG19 741 Transmembrane and TPR rep yes N/A 0.865 0.078 0.603 1e-14
Q7K4B6 926 Transmembrane and TPR rep yes N/A 0.641 0.046 0.697 3e-14
Q6DCD5 836 Transmembrane and TPR rep N/A N/A 0.686 0.055 0.695 3e-13
Q8IUR5 882 Transmembrane and TPR rep no N/A 0.641 0.048 0.702 3e-13
Q3UV71 942 Transmembrane and TPR rep no N/A 0.686 0.048 0.66 3e-13
Q56A06 836 Transmembrane and TPR rep no N/A 0.686 0.055 0.673 3e-13
Q8N394 836 Transmembrane and TPR rep no N/A 0.686 0.055 0.652 6e-13
Q6ZXV5 915 Transmembrane and TPR rep no N/A 0.865 0.063 0.6 2e-12
Q8BRH0 920 Transmembrane and TPR rep no N/A 0.671 0.048 0.673 3e-12
>sp|Q5T4D3|TMTC4_HUMAN Transmembrane and TPR repeat-containing protein 4 OS=Homo sapiens GN=TMTC4 PE=2 SV=2 Back     alignment and function desciption
 Score = 79.0 bits (193), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 34/49 (69%), Positives = 43/49 (87%)

Query: 16  GIKKTFLIEGLGFLIVPFLPASNLFFPVGFVIAERVLYIPSMGFCMLLS 64
           G K+  L  GLGFL++PFLPASNLFF VGFV+AERVLY+PS+G+C+LL+
Sbjct: 378 GHKRRILTLGLGFLVIPFLPASNLFFRVGFVVAERVLYLPSVGYCVLLT 426





Homo sapiens (taxid: 9606)
>sp|Q8BG19|TMTC4_MOUSE Transmembrane and TPR repeat-containing protein 4 OS=Mus musculus GN=Tmtc4 PE=2 SV=1 Back     alignment and function description
>sp|Q7K4B6|TMTC3_DROME Transmembrane and TPR repeat-containing protein CG4050 OS=Drosophila melanogaster GN=CG4050 PE=2 SV=1 Back     alignment and function description
>sp|Q6DCD5|TMTC2_XENLA Transmembrane and TPR repeat-containing protein 2 OS=Xenopus laevis GN=tmtc2 PE=2 SV=1 Back     alignment and function description
>sp|Q8IUR5|TMTC1_HUMAN Transmembrane and TPR repeat-containing protein 1 OS=Homo sapiens GN=TMTC1 PE=1 SV=3 Back     alignment and function description
>sp|Q3UV71|TMTC1_MOUSE Transmembrane and TPR repeat-containing protein 1 OS=Mus musculus GN=Tmtc1 PE=2 SV=2 Back     alignment and function description
>sp|Q56A06|TMTC2_MOUSE Transmembrane and TPR repeat-containing protein 2 OS=Mus musculus GN=Tmtc2 PE=2 SV=1 Back     alignment and function description
>sp|Q8N394|TMTC2_HUMAN Transmembrane and TPR repeat-containing protein 2 OS=Homo sapiens GN=TMTC2 PE=2 SV=1 Back     alignment and function description
>sp|Q6ZXV5|TMTC3_HUMAN Transmembrane and TPR repeat-containing protein 3 OS=Homo sapiens GN=TMTC3 PE=1 SV=2 Back     alignment and function description
>sp|Q8BRH0|TMTC3_MOUSE Transmembrane and TPR repeat-containing protein 3 OS=Mus musculus GN=Tmtc3 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query67
328697970 890 PREDICTED: transmembrane and TPR repeat- 0.865 0.065 0.603 1e-14
390457513 1101 PREDICTED: transmembrane and TPR repeat- 0.865 0.052 0.620 4e-14
354481873 742 PREDICTED: transmembrane and TPR repeat- 0.865 0.078 0.637 4e-14
344253264 741 Transmembrane and TPR repeat-containing 0.865 0.078 0.637 4e-14
157112300 707 smile protein [Aedes aegypti] gi|1088837 0.656 0.062 0.772 4e-14
157785563 524 transmembrane and TPR repeat-containing 0.701 0.089 0.744 7e-14
170065407 715 smile protein [Culex quinquefasciatus] g 0.641 0.060 0.767 9e-14
395833249 741 PREDICTED: transmembrane and TPR repeat- 0.731 0.066 0.714 1e-13
312372803 996 hypothetical protein AND_19668 [Anophele 0.597 0.040 0.825 1e-13
158293248 663 AGAP010599-PA [Anopheles gambiae str. PE 0.597 0.060 0.825 1e-13
>gi|328697970|ref|XP_001947340.2| PREDICTED: transmembrane and TPR repeat-containing protein CG4050-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score = 83.6 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 35/58 (60%), Positives = 46/58 (79%)

Query: 7   VFTSLQISVGIKKTFLIEGLGFLIVPFLPASNLFFPVGFVIAERVLYIPSMGFCMLLS 64
           V+T+   S   K+  +I  LG  ++PFLPASN+FFPVGFV+AERVLY+PSMGFCML++
Sbjct: 361 VYTAFTTSNRTKRIVVIMSLGLTVLPFLPASNMFFPVGFVVAERVLYMPSMGFCMLVA 418




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|390457513|ref|XP_002806517.2| PREDICTED: transmembrane and TPR repeat-containing protein 4-like [Callithrix jacchus] Back     alignment and taxonomy information
>gi|354481873|ref|XP_003503125.1| PREDICTED: transmembrane and TPR repeat-containing protein 4 [Cricetulus griseus] Back     alignment and taxonomy information
>gi|344253264|gb|EGW09368.1| Transmembrane and TPR repeat-containing protein 4 [Cricetulus griseus] Back     alignment and taxonomy information
>gi|157112300|ref|XP_001657484.1| smile protein [Aedes aegypti] gi|108883757|gb|EAT47982.1| AAEL000971-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|157785563|ref|NP_001099099.1| transmembrane and TPR repeat-containing protein 4 [Bos taurus] gi|157279159|gb|AAI34549.1| TMTC4 protein [Bos taurus] gi|296481625|tpg|DAA23740.1| TPA: transmembrane and tetratricopeptide repeat containing 4 [Bos taurus] Back     alignment and taxonomy information
>gi|170065407|ref|XP_001867926.1| smile protein [Culex quinquefasciatus] gi|167882504|gb|EDS45887.1| smile protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|395833249|ref|XP_003789652.1| PREDICTED: transmembrane and TPR repeat-containing protein 4 [Otolemur garnettii] Back     alignment and taxonomy information
>gi|312372803|gb|EFR20681.1| hypothetical protein AND_19668 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|158293248|ref|XP_314563.4| AGAP010599-PA [Anopheles gambiae str. PEST] gi|157016867|gb|EAA09887.4| AGAP010599-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query67
FB|FBgn0020312 926 CG4050 [Drosophila melanogaste 0.746 0.053 0.607 1.2e-13
UNIPROTKB|B7Z666 630 TMTC4 "cDNA FLJ55995, weakly s 0.731 0.077 0.693 1.3e-13
UNIPROTKB|Q5T4D3 741 TMTC4 "Transmembrane and TPR r 0.731 0.066 0.693 1.6e-13
MGI|MGI:1921050 741 Tmtc4 "transmembrane and tetra 0.865 0.078 0.603 2.1e-13
UNIPROTKB|F1SPX9 650 TMTC3 "Uncharacterized protein 0.910 0.093 0.609 1.2e-12
UNIPROTKB|E1C3P5 921 TMTC3 "Uncharacterized protein 0.865 0.062 0.6 3.4e-12
UNIPROTKB|E1BG63 920 TMTC3 "Uncharacterized protein 0.910 0.066 0.593 4.3e-12
RGD|1306351 920 Tmtc3 "transmembrane and tetra 0.910 0.066 0.578 4.3e-12
UNIPROTKB|I3LN91288 TMTC2 "Uncharacterized protein 0.686 0.159 0.652 4.6e-12
UNIPROTKB|E2QUG9 915 TMTC3 "Uncharacterized protein 0.910 0.066 0.593 7e-12
FB|FBgn0020312 CG4050 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 177 (67.4 bits), Expect = 1.2e-13, Sum P(2) = 1.2e-13
 Identities = 31/51 (60%), Positives = 46/51 (90%)

Query:    14 SVGIKKTFLIEGLGFLIVPFLPASNLFFPVGFVIAERVLYIPSMGFCMLLS 64
             ++ + +T LI  LG++++PFLPASNLFFPVGFV+AER+LY+PSMG+C+L++
Sbjct:   407 NLALSRT-LIMCLGWMVLPFLPASNLFFPVGFVVAERILYMPSMGYCLLVA 456


GO:0016262 "protein N-acetylglucosaminyltransferase activity" evidence=ISS
GO:0017122 "protein N-acetylglucosaminyltransferase complex" evidence=ISS
GO:0008150 "biological_process" evidence=ND
UNIPROTKB|B7Z666 TMTC4 "cDNA FLJ55995, weakly similar to Homo sapiens transmembrane and tetratricopeptide repeat containing 1 (TMTC1), mRNA" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5T4D3 TMTC4 "Transmembrane and TPR repeat-containing protein 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1921050 Tmtc4 "transmembrane and tetratricopeptide repeat containing 4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1SPX9 TMTC3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1C3P5 TMTC3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BG63 TMTC3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1306351 Tmtc3 "transmembrane and tetratricopeptide repeat containing 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|I3LN91 TMTC2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2QUG9 TMTC3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8BG19TMTC4_MOUSENo assigned EC number0.60340.86560.0782yesN/A
Q7K4B6TMTC3_DROMENo assigned EC number0.69760.64170.0464yesN/A
Q5T4D3TMTC4_HUMANNo assigned EC number0.69380.73130.0661yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

No hit with probability above 80.00