Psyllid ID: psy12549


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330------
MYTAQTVQLSEEGIIIPKHNVATRELSAKVVEGVSRSLSSLIDGNTVKYDWDSGYTCHQLGSGAILVQLGQPYMLDTERALDTMNFDALKGRPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKAMYDTFSAFGSILSCKVAQDEQGNSKGYGFVHFETEEAANKSIEKVNGMLLNSKIVFVGKFIPRKEREKELGEKAKLFTNVYIKNFGEDFNDEKLKEMFEPYGTITSYRVMNNDGKSRGFGFVAYESPEFAEKAVQAWNGKEVDGKILYVGRAQKKAERTQELKRRFEMLKIERLNRYQGVNLYVKNLDDSIDDERLRKEFTPFGTITSAK
ccccccccccccccccccccEEEccccccccHHHHHHHHccccccEEEEEccccccccccccccEEEEcccccHHHHHHHHHHccccccccEEEEEEEcccccccccccccEEEEccccccccHHHHHHHHHccccEEEEEEEEccccccccEEEEEEccHHHHHHHHHHHcccccccEEEEEEcccccHHHHHHHHcccccccEEEEccccccccHHHHHHHHcccccEEEEEEEcccccccEEEEEEcccHHHHHHHHHHHcccccccEEEEEEcccccHHHHHHHHHHHHHHHHHHcccccccEEEEEcccccccHHHHHHHHcccccEEEEc
cccccccccccccccccccEEEEccccccccccccccHHHHHHHHHHcccEEEEEEEEcccccEEEEEcccccHHHHHHHHHHHccccccccEEEEEcccccHHHHcccccEEEEEcccccccHHHHHHHHHHcccEEEEEEEEccccccccEEEEEcccHHHHHHHHHHHccccccccEEEEEEcccHHHHHHHHHHHHHHcccEEEEcccccccHHHHHHHHHHcccEEEEEEEEccccccccEEEEcccHHHHHHHHHHHcccccccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHcccccEcccc
mytaqtvqlseegiiipkhnvatRELSAKVVEGVSRSLsslidgntvkydwdsgytchqlgsgailvqlgqpymldTERALDTMnfdalkgrpirimwsqrdpslrksgvgnvFIKNLdksidnkamydtFSAFGSILSCKVaqdeqgnskgygfvhFETEEAANKSIEKVNGMLLNSKIVFVGKFIPRKEREKELGEKAKLFTNVYIKNFGEDFNDEKLKEmfepygtitsyrvmnndgksrgfgfvayespefAEKAVQAWngkevdgkiLYVGRAQKKAERTQELKRRFEMLKIERLNRYQGVNLYVknlddsidderlrkeftpfgtitsak
mytaqtvqlseegiiipkhnvatrELSAKVVEGVsrslsslidgnTVKYDWDSGYTCHQLGSGAILVQLGQPYMLDTERALDTMNfdalkgrpirimwsqrdpslrksgvgNVFIKNLDKSIDNKAMYDTFSAFGSILSCKVAQDEQGNSKGYGFVHFETEEAANKSIEKVNGMLLNSKIVfvgkfiprkerekelgekaklftNVYIKNfgedfndekLKEMFEPYGTITSYRVMNNDGKSRGFGFVAYESPEFAEKAVQAwngkevdgkilyvgraqkkaertqelKRRFEMLkierlnryqgvnlyvknlddsidderlrkeftpfgtitsak
MYTAQTVQLSEEGIIIPKHNVATRELSAKVVEGVSRSLSSLIDGNTVKYDWDSGYTCHQLGSGAILVQLGQPYMLDTERALDTMNFDALKGRPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKAMYDTFSAFGSILSCKVAQDEQGNSKGYGFVHFETEEAANKSIEKVNGMLLNSKIVFVGKFIPRKEREKELGEKAKLFTNVYIKNFGEDFNDEKLKEMFEPYGTITSYRVMNNDGKSRGFGFVAYESPEFAEKAVQAWNGKEVDGKILYVGRAQKKAERTQELKRRFEMLKIERLNRYQGVNLYVKNLDDSIDDERLRKEFTPFGTITSAK
************GIIIPKHNVATRELSAKVVEGVSRSLSSLIDGNTVKYDWDSGYTCHQLGSGAILVQLGQPYMLDTERALDTMNFDALKGRPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKAMYDTFSAFGSILSCKVAQDEQGNSKGYGFVHFETEEAANKSIEKVNGMLLNSKIVFVGKFIPRKER*KELGEKAKLFTNVYIKNFGEDFNDEKLKEMFEPYGTITSYRVMNNDGKSRGFGFVAYESPEFAEKAVQAWNGKEVDGKILYVGRAQ********LKRRFEMLKIERLNRYQGVNLYVKNLDDSI*******************
********************VATRELSAKVVEGVSRSLSSLIDGNTVKYDWDSGYTCHQLGSGAILVQLGQPYMLDTERALDTMNFDALKGRPIRI****************VFIKNLDKSIDNKAMYDTFSAFGSILSCKVAQDEQGNSKGYGFVHFETEEAANKSIEKVNGMLLNSKIVFV*********************NVYIKNFGEDFNDEKLKEMFEPYGTITSYRVMNNDGKSRGFGFVAYESPEFAEKAVQAWNGKEVDGKILYVG*****************************VNLYVKNLDDSIDDERLRKEFTPFGTITSAK
MYTAQTVQLSEEGIIIPKHNVATRELSAKVVEGVSRSLSSLIDGNTVKYDWDSGYTCHQLGSGAILVQLGQPYMLDTERALDTMNFDALKGRPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKAMYDTFSAFGSILSCKVAQDEQGNSKGYGFVHFETEEAANKSIEKVNGMLLNSKIVFVGKFIPRKEREKELGEKAKLFTNVYIKNFGEDFNDEKLKEMFEPYGTITSYRVMNNDGKSRGFGFVAYESPEFAEKAVQAWNGKEVDGKILYVGR********QELKRRFEMLKIERLNRYQGVNLYVKNLDDSIDDERLRKEFTPFGTITSAK
**************IIPKHNVATRELSAKVVEGVSRSLSSLIDGNTVKYDWDSGYTCHQLGSGAILVQLGQPYMLDTERALDTMNFDALKGRPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKAMYDTFSAFGSILSCKVAQDEQGNSKGYGFVHFETEEAANKSIEKVNGMLLNSKIVFVGKFIPRKEREKELGEKAKLFTNVYIKNFGEDFNDEKLKEMFEPYGTITSYRVMNNDGKSRGFGFVAYESPEFAEKAVQAWNGKEVDGKILYVGRAQKKAERTQELKRRFEMLKIERLNRYQGVNLYVKNLDDSIDDERLRKEFTPFGTIT***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYTAQTVQLSEEGIIIPKHNVATRELSAKVVEGVSRSLSSLIDGNTVKYDWDSGYTCHQLGSGAILVQLGQPYMLDTERALDTMNFDALKGRPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKAMYDTFSAFGSILSCKVAQDEQGNSKGYGFVHFETEEAANKSIEKVNGMLLNSKIVFVGKFIPRKEREKELGEKAKLFTNVYIKNFGEDFNDEKLKEMFEPYGTITSYRVMNNDGKSRGFGFVAYESPEFAEKAVQAWNGKEVDGKILYVGRxxxxxxxxxxxxxxxxxxxxxRLNRYQGVNLYVKNLDDSIDDERLRKEFTPFGTITSAK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query336 2.2.26 [Sep-21-2011]
P21187 634 Polyadenylate-binding pro yes N/A 0.809 0.429 0.760 1e-118
Q13310 644 Polyadenylate-binding pro yes N/A 0.806 0.420 0.723 1e-112
P20965 633 Polyadenylate-binding pro N/A N/A 0.806 0.428 0.72 1e-112
P29341 636 Polyadenylate-binding pro yes N/A 0.806 0.426 0.716 1e-112
Q9EPH8 636 Polyadenylate-binding pro yes N/A 0.806 0.426 0.716 1e-112
Q5R8F7 636 Polyadenylate-binding pro yes N/A 0.806 0.426 0.712 1e-111
P11940 636 Polyadenylate-binding pro no N/A 0.806 0.426 0.712 1e-111
P61286 636 Polyadenylate-binding pro no N/A 0.806 0.426 0.712 1e-111
Q6IP09 633 Polyadenylate-binding pro N/A N/A 0.806 0.428 0.716 1e-111
Q6DEY7 629 Embryonic polyadenylate-b no N/A 0.806 0.430 0.687 1e-108
>sp|P21187|PABP_DROME Polyadenylate-binding protein OS=Drosophila melanogaster GN=pAbp PE=1 SV=3 Back     alignment and function desciption
 Score =  424 bits (1089), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 210/276 (76%), Positives = 237/276 (85%), Gaps = 4/276 (1%)

Query: 63  GAILVQLGQPYMLDTERALDTMNFDALKGRPIRIMWSQRDPSLRKSGVGNVFIKNLDKSI 122
           G   V   QP   D ERALDTMNFD ++ +PIRIMWSQRDPSLR+SGVGNVFIKNLD++I
Sbjct: 44  GYAYVNFQQP--ADAERALDTMNFDLVRNKPIRIMWSQRDPSLRRSGVGNVFIKNLDRAI 101

Query: 123 DNKAMYDTFSAFGSILSCKVAQDEQGNSKGYGFVHFETEEAANKSIEKVNGMLLNSKIVF 182
           DNKA+YDTFSAFG+ILSCKVA DE+GNSKGYGFVHFETEEAAN SI+KVNGMLLN K V+
Sbjct: 102 DNKAIYDTFSAFGNILSCKVATDEKGNSKGYGFVHFETEEAANTSIDKVNGMLLNGKKVY 161

Query: 183 VGKFIPRKEREKELGEKAKLFTNVYIKNFGEDFNDEKLKEMFEPYGTITSYRVMNN-DGK 241
           VGKFIPRKEREKELGEKAKLFTNVY+KNF EDF+DEKLKE FEPYG ITSY+VM+  DGK
Sbjct: 162 VGKFIPRKEREKELGEKAKLFTNVYVKNFTEDFDDEKLKEFFEPYGKITSYKVMSKEDGK 221

Query: 242 SRGFGFVAYESPEFAEKAVQAWNGKEV-DGKILYVGRAQKKAERTQELKRRFEMLKIERL 300
           S+GFGFVA+E+ E AE AVQA NGK++ +GK LYV RAQKKAER QELKR+FE LK +R 
Sbjct: 222 SKGFGFVAFETTEAAEAAVQALNGKDMGEGKSLYVARAQKKAERQQELKRKFEELKQKRH 281

Query: 301 NRYQGVNLYVKNLDDSIDDERLRKEFTPFGTITSAK 336
               GVNLYVKNLDD+IDD+RLR  F+P+G ITSAK
Sbjct: 282 ESVFGVNLYVKNLDDTIDDDRLRIAFSPYGNITSAK 317




Binds the poly(A) tail of mRNA.
Drosophila melanogaster (taxid: 7227)
>sp|Q13310|PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 Back     alignment and function description
>sp|P20965|PABPA_XENLA Polyadenylate-binding protein 1-A OS=Xenopus laevis GN=pabpc1-a PE=1 SV=3 Back     alignment and function description
>sp|P29341|PABP1_MOUSE Polyadenylate-binding protein 1 OS=Mus musculus GN=Pabpc1 PE=1 SV=2 Back     alignment and function description
>sp|Q9EPH8|PABP1_RAT Polyadenylate-binding protein 1 OS=Rattus norvegicus GN=Pabpc1 PE=2 SV=1 Back     alignment and function description
>sp|Q5R8F7|PABP1_PONAB Polyadenylate-binding protein 1 OS=Pongo abelii GN=PABPC1 PE=2 SV=1 Back     alignment and function description
>sp|P11940|PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 Back     alignment and function description
>sp|P61286|PABP1_BOVIN Polyadenylate-binding protein 1 OS=Bos taurus GN=PABPC1 PE=2 SV=1 Back     alignment and function description
>sp|Q6IP09|PABPB_XENLA Polyadenylate-binding protein 1-B OS=Xenopus laevis GN=pabpc1-b PE=2 SV=1 Back     alignment and function description
>sp|Q6DEY7|EPAB_XENTR Embryonic polyadenylate-binding protein OS=Xenopus tropicalis GN=epabp PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query336
157125851 628 polyadenylate-binding protein [Aedes aeg 0.809 0.433 0.832 1e-129
91095037 607 PREDICTED: similar to poly A binding pro 0.809 0.448 0.826 1e-129
307165845 635 Polyadenylate-binding protein 1 [Campono 0.809 0.428 0.826 1e-129
340719918 630 PREDICTED: polyadenylate-binding protein 0.809 0.431 0.826 1e-128
380019828 630 PREDICTED: polyadenylate-binding protein 0.809 0.431 0.826 1e-128
340719922 621 PREDICTED: polyadenylate-binding protein 0.809 0.438 0.826 1e-128
332030568 678 Polyadenylate-binding protein 1 [Acromyr 0.788 0.390 0.821 1e-128
340719924 612 PREDICTED: polyadenylate-binding protein 0.809 0.444 0.826 1e-128
332374002 634 unknown [Dendroctonus ponderosae] 0.809 0.429 0.822 1e-128
170044609 628 polyadenylate-binding protein 1 [Culex q 0.809 0.433 0.825 1e-128
>gi|157125851|ref|XP_001654419.1| polyadenylate-binding protein [Aedes aegypti] gi|157125853|ref|XP_001654420.1| polyadenylate-binding protein [Aedes aegypti] gi|94468824|gb|ABF18261.1| polyadenylate-binding protein [Aedes aegypti] gi|108873484|gb|EAT37709.1| AAEL010318-PB [Aedes aegypti] gi|108873485|gb|EAT37710.1| AAEL010318-PA [Aedes aegypti] Back     alignment and taxonomy information
 Score =  468 bits (1204), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 229/275 (83%), Positives = 246/275 (89%), Gaps = 3/275 (1%)

Query: 63  GAILVQLGQPYMLDTERALDTMNFDALKGRPIRIMWSQRDPSLRKSGVGNVFIKNLDKSI 122
           G   V   QP   D ERALDTMNFD +KGRPIRIMWSQRDPSLRKSGVGNVFIKNLDK+I
Sbjct: 44  GYAYVNFQQP--ADAERALDTMNFDLIKGRPIRIMWSQRDPSLRKSGVGNVFIKNLDKNI 101

Query: 123 DNKAMYDTFSAFGSILSCKVAQDEQGNSKGYGFVHFETEEAANKSIEKVNGMLLNSKIVF 182
           DNKAMYDTFSAFG+ILSCKVAQDE+GNSKGYGFVHFETEE+AN SIEKVNGMLLN K V+
Sbjct: 102 DNKAMYDTFSAFGNILSCKVAQDEKGNSKGYGFVHFETEESANTSIEKVNGMLLNGKKVY 161

Query: 183 VGKFIPRKEREKELGEKAKLFTNVYIKNFGEDFNDEKLKEMFEPYGTITSYRVMNNDGKS 242
           VG+FIPRKEREKELGEKAKLFTNVY+KNFG++ NDE LKEMFE YGTITS+RVM  DGKS
Sbjct: 162 VGRFIPRKEREKELGEKAKLFTNVYVKNFGDELNDETLKEMFEKYGTITSHRVMIKDGKS 221

Query: 243 RGFGFVAYESPEFAEKAVQAWNGKEV-DGKILYVGRAQKKAERTQELKRRFEMLKIERLN 301
           RGFGFVA+E+PE AE AVQ  NGKE+ +GKILYVGRAQKK ER  ELKRRFE LK+ERL 
Sbjct: 222 RGFGFVAFENPESAEHAVQELNGKELGEGKILYVGRAQKKNERQMELKRRFEQLKMERLT 281

Query: 302 RYQGVNLYVKNLDDSIDDERLRKEFTPFGTITSAK 336
           RYQGVNLYVKNLDDSIDDERLRKEF+PFGTITSAK
Sbjct: 282 RYQGVNLYVKNLDDSIDDERLRKEFSPFGTITSAK 316




Source: Aedes aegypti

Species: Aedes aegypti

Genus: Aedes

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|91095037|ref|XP_975975.1| PREDICTED: similar to poly A binding protein isoform 4 [Tribolium castaneum] gi|270014772|gb|EFA11220.1| hypothetical protein TcasGA2_TC005185 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|307165845|gb|EFN60208.1| Polyadenylate-binding protein 1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|340719918|ref|XP_003398391.1| PREDICTED: polyadenylate-binding protein 1-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|380019828|ref|XP_003693803.1| PREDICTED: polyadenylate-binding protein 1-like [Apis florea] Back     alignment and taxonomy information
>gi|340719922|ref|XP_003398393.1| PREDICTED: polyadenylate-binding protein 1-like isoform 3 [Bombus terrestris] Back     alignment and taxonomy information
>gi|332030568|gb|EGI70256.1| Polyadenylate-binding protein 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|340719924|ref|XP_003398394.1| PREDICTED: polyadenylate-binding protein 1-like isoform 4 [Bombus terrestris] Back     alignment and taxonomy information
>gi|332374002|gb|AEE62142.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|170044609|ref|XP_001849934.1| polyadenylate-binding protein 1 [Culex quinquefasciatus] gi|167867688|gb|EDS31071.1| polyadenylate-binding protein 1 [Culex quinquefasciatus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query336
ZFIN|ZDB-GENE-050308-1 634 pabpc1b "poly A binding protei 0.806 0.427 0.723 1.4e-103
UNIPROTKB|B1ANR0 615 PABPC4 "Polyadenylate-binding 0.806 0.440 0.723 1.3e-102
UNIPROTKB|Q13310 644 PABPC4 "Polyadenylate-binding 0.806 0.420 0.723 1.3e-102
UNIPROTKB|P20965 633 pabpc1-a "Polyadenylate-bindin 0.806 0.428 0.72 1.3e-102
ZFIN|ZDB-GENE-030131-3238 634 pabpc1a "poly A binding protei 0.806 0.427 0.723 1.6e-102
UNIPROTKB|E2R9I0 631 PABPC4 "Uncharacterized protei 0.806 0.429 0.72 2e-102
UNIPROTKB|F1SV06 631 PABPC4 "Uncharacterized protei 0.806 0.429 0.72 2e-102
UNIPROTKB|A4IFC3 645 PABPC4 "Uncharacterized protei 0.806 0.420 0.72 2.6e-102
MGI|MGI:1349722 636 Pabpc1 "poly(A) binding protei 0.806 0.426 0.716 4.2e-102
RGD|619838 636 Pabpc1 "poly(A) binding protei 0.806 0.426 0.716 4.2e-102
ZFIN|ZDB-GENE-050308-1 pabpc1b "poly A binding protein, cytoplasmic 1 b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 1026 (366.2 bits), Expect = 1.4e-103, P = 1.4e-103
 Identities = 199/275 (72%), Positives = 230/275 (83%)

Query:    63 GAILVQLGQPYMLDTERALDTMNFDALKGRPIRIMWSQRDPSLRKSGVGNVFIKNLDKSI 122
             G   V   QP   D ERALDTMNFD +KGRP+RIMWSQRDPSLRKSGVGN+FIKNLDKSI
Sbjct:    53 GYAYVNFQQP--ADAERALDTMNFDVIKGRPVRIMWSQRDPSLRKSGVGNIFIKNLDKSI 110

Query:   123 DNKAMYDTFSAFGSILSCKVAQDEQGNSKGYGFVHFETEEAANKSIEKVNGMLLNSKIVF 182
             DNKA+YDTFSAFG+ILSCKV  DE G SKGYGFVHFET+EAA ++IEK+NGMLLN + VF
Sbjct:   111 DNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVF 169

Query:   183 VGKFIPRKEREKELGEKAKLFTNVYIKNFGEDFNDEKLKEMFEPYGTITSYRVMNND-GK 241
             VG+F  RKERE ELG +AK FTNVYIKNFGED +D+KLK++F  YG   S RVM ++ GK
Sbjct:   170 VGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDDKLKDIFSKYGNAMSIRVMTDENGK 229

Query:   242 SRGFGFVAYESPEFAEKAVQAWNGKEVDGKILYVGRAQKKAERTQELKRRFEMLKIERLN 301
             SRGFGFV++E  E A++AV   NGKE++GK++YVGRAQKK ER  ELKR+FE +K +R+ 
Sbjct:   230 SRGFGFVSFERHEDAQRAVDEMNGKEMNGKLIYVGRAQKKVERQTELKRKFEQMKQDRMT 289

Query:   302 RYQGVNLYVKNLDDSIDDERLRKEFTPFGTITSAK 336
             RYQGVNLYVKNLDD IDDERLRKEF+PFGTITSAK
Sbjct:   290 RYQGVNLYVKNLDDGIDDERLRKEFSPFGTITSAK 324


GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003723 "RNA binding" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
UNIPROTKB|B1ANR0 PABPC4 "Polyadenylate-binding protein 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q13310 PABPC4 "Polyadenylate-binding protein 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P20965 pabpc1-a "Polyadenylate-binding protein 1-A" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-3238 pabpc1a "poly A binding protein, cytoplasmic 1 a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2R9I0 PABPC4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SV06 PABPC4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|A4IFC3 PABPC4 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1349722 Pabpc1 "poly(A) binding protein, cytoplasmic 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|619838 Pabpc1 "poly(A) binding protein, cytoplasmic 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6CDH3PABP_YARLINo assigned EC number0.54190.77670.4149yesN/A
A2Q848PABP_ASPNCNo assigned EC number0.60680.77670.3570yesN/A
Q6FKG4PABP_CANGANo assigned EC number0.53100.76480.4438yesN/A
Q13310PABP4_HUMANNo assigned EC number0.72360.80650.4208yesN/A
Q6CSV3PABP_KLULANo assigned EC number0.52890.76780.4358yesN/A
Q4WK03PABP_ASPFUNo assigned EC number0.61060.77670.3466yesN/A
Q5R8F7PABP1_PONABNo assigned EC number0.71270.80650.4261yesN/A
P31209PABP_SCHPONo assigned EC number0.60220.78270.4027yesN/A
P0CP46PABP_CRYNJNo assigned EC number0.55720.77670.3878yesN/A
A3LXL0PABP_PICSTNo assigned EC number0.58710.78270.4161yesN/A
Q9EPH8PABP1_RATNo assigned EC number0.71630.80650.4261yesN/A
Q54BM2PAP1A_DICDINo assigned EC number0.59000.74400.4424yesN/A
P04147PABP_YEASTNo assigned EC number0.55980.76780.4471yesN/A
Q6BI95PABP_DEBHANo assigned EC number0.58390.77670.4162yesN/A
P29341PABP1_MOUSENo assigned EC number0.71630.80650.4261yesN/A
P21187PABP_DROMENo assigned EC number0.76080.80950.4290yesN/A
Q2UK72PABP_ASPORNo assigned EC number0.60680.77670.3411yesN/A
Q74ZS6PABP_ASHGONo assigned EC number0.55980.76780.4410yesN/A
Q5B630PABP_EMENINo assigned EC number0.60.77080.3538yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query336
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 1e-138
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 1e-56
cd1237977 cd12379, RRM2_I_PABPs, RNA recognition motif 2 fou 6e-52
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 5e-42
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 1e-41
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 1e-29
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 2e-23
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 5e-23
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 4e-21
cd1233583 cd12335, RRM2_SF3B4, RNA recognition motif 2 in sp 3e-20
smart0036073 smart00360, RRM, RNA recognition motif 1e-19
pfam0007670 pfam00076, RRM_1, RNA recognition motif 4e-19
cd1237977 cd12379, RRM2_I_PABPs, RNA recognition motif 2 fou 1e-18
TIGR01622 457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 2e-18
TIGR01661 352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 9e-18
pfam0007670 pfam00076, RRM_1, RNA recognition motif 1e-17
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 1e-17
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 3e-17
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 5e-17
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 6e-17
smart0036073 smart00360, RRM, RNA recognition motif 6e-17
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 1e-16
TIGR01645 612 TIGR01645, half-pint, poly-U binding splicing fact 1e-16
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 6e-16
TIGR01659346 TIGR01659, sex-lethal, sex-lethal family splicing 6e-16
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 3e-15
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 5e-15
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 1e-14
cd1240776 cd12407, RRM_FOX1_like, RNA recognition motif in v 4e-14
cd1238772 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 2e-13
cd1224371 cd12243, RRM1_MSSP, RNA recognition motif 1 in the 2e-13
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 6e-13
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 2e-12
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 2e-12
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 3e-12
cd1237177 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U 6e-12
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 6e-12
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 7e-12
cd1224479 cd12244, RRM2_MSSP, RNA recognition motif 2 in the 9e-12
cd1256576 cd12565, RRM1_MRD1, RNA recognition motif 1 in yea 9e-12
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 1e-11
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 1e-11
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 2e-11
cd1239092 cd12390, RRM3_RAVER, RNA recognition motif 3 in ri 2e-11
cd1261975 cd12619, RRM2_PUB1, RNA recognition motif 2 in yea 2e-11
cd1229778 cd12297, RRM2_Prp24, RNA recognition motif 2 in fu 2e-11
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 3e-11
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 3e-11
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 5e-11
cd1263979 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 6e-11
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 8e-11
cd1261282 cd12612, RRM2_SECp43, RNA recognition motif 2 in t 1e-10
cd1227371 cd12273, RRM1_NEFsp, RNA recognition motif 1 in ve 1e-10
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 2e-10
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 2e-10
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 2e-10
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 3e-10
cd1256576 cd12565, RRM1_MRD1, RNA recognition motif 1 in yea 4e-10
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 5e-10
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 6e-10
cd1265078 cd12650, RRM1_Hu, RNA recognition motif 1 in the H 6e-10
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 7e-10
cd1256476 cd12564, RRM1_RBM19, RNA recognition motif 1 in RN 7e-10
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 7e-10
cd1264981 cd12649, RRM1_SXL, RNA recognition motif 1 in Dros 7e-10
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 9e-10
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 9e-10
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 9e-10
cd1238772 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 1e-09
cd1237177 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U 1e-09
cd1261975 cd12619, RRM2_PUB1, RNA recognition motif 2 in yea 1e-09
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 1e-09
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 1e-09
cd1265279 cd12652, RRM2_Hu, RNA recognition motif 2 in the H 1e-09
cd1247588 cd12475, RRM2_RBMS3, RNA recognition motif 2 found 1e-09
TIGR01661 352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 2e-09
TIGR01645 612 TIGR01645, half-pint, poly-U binding splicing fact 2e-09
cd1224479 cd12244, RRM2_MSSP, RNA recognition motif 2 in the 2e-09
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 2e-09
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 3e-09
cd1247486 cd12474, RRM2_MSSP2, RNA recognition motif 2 found 3e-09
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 4e-09
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 4e-09
cd1247385 cd12473, RRM2_MSSP1, RNA recognition motif 2 found 4e-09
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 5e-09
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 5e-09
cd1265384 cd12653, RRM3_HuR, RNA recognition motif 3 in vert 5e-09
cd1263892 cd12638, RRM3_CELF1_2, RNA recognition motif 3 in 5e-09
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 5e-09
cd1233075 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in ye 6e-09
cd1234067 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in 6e-09
cd1264079 cd12640, RRM3_Bruno_like, RNA recognition motif 3 6e-09
cd1224371 cd12243, RRM1_MSSP, RNA recognition motif 1 in the 7e-09
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 7e-09
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 7e-09
cd1238674 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 7e-09
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 8e-09
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 8e-09
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 8e-09
cd1241875 cd12418, RRM_Aly_REF_like, RNA recognition motif i 8e-09
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 8e-09
TIGR01659 346 TIGR01659, sex-lethal, sex-lethal family splicing 1e-08
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 1e-08
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 1e-08
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 1e-08
cd1239092 cd12390, RRM3_RAVER, RNA recognition motif 3 in ri 2e-08
cd1264981 cd12649, RRM1_SXL, RNA recognition motif 1 in Dros 2e-08
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 2e-08
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 2e-08
cd1222384 cd12223, RRM_SR140, RNA recognition motif (RRM) in 2e-08
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 2e-08
cd1255277 cd12552, RRM_Nop15p, RNA recognition motif in yeas 2e-08
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 2e-08
cd1266277 cd12662, RRM3_MYEF2, RNA recognition motif 3 in ve 2e-08
cd1265279 cd12652, RRM2_Hu, RNA recognition motif 2 in the H 3e-08
cd1264079 cd12640, RRM3_Bruno_like, RNA recognition motif 3 3e-08
cd1223583 cd12235, RRM_PPIL4, RNA recognition motif in pepti 3e-08
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 4e-08
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 6e-08
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 7e-08
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 7e-08
cd1260869 cd12608, RRM1_CoAA, RNA recognition motif 1 in ver 9e-08
cd1233380 cd12333, RRM2_p54nrb_like, RNA recognition motif 2 9e-08
cd1237076 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U 9e-08
cd1267583 cd12675, RRM2_Nop4p, RNA recognition motif 2 in ye 9e-08
cd1232679 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 fou 9e-08
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 1e-07
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 1e-07
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 1e-07
cd1235272 cd12352, RRM1_TIA1_like, RNA recognition motif 1 i 1e-07
cd1266177 cd12661, RRM3_hnRNPM, RNA recognition motif 3 in v 1e-07
cd1233583 cd12335, RRM2_SF3B4, RNA recognition motif 2 in sp 2e-07
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 2e-07
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 2e-07
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 2e-07
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 2e-07
cd1247588 cd12475, RRM2_RBMS3, RNA recognition motif 2 found 2e-07
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 2e-07
cd1241875 cd12418, RRM_Aly_REF_like, RNA recognition motif i 2e-07
cd1260869 cd12608, RRM1_CoAA, RNA recognition motif 1 in ver 2e-07
cd1247086 cd12470, RRM1_MSSP1, RNA recognition motif 1 in ve 2e-07
cd1224273 cd12242, RRM_SLIRP, RNA recognition motif found in 2e-07
cd1257878 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 2e-07
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 2e-07
pfam1389356 pfam13893, RRM_5, RNA recognition motif 2e-07
cd1237679 cd12376, RRM2_Hu_like, RNA recognition motif 2 in 2e-07
TIGR01648 578 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonu 2e-07
cd1276181 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in 2e-07
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 3e-07
cd1247385 cd12473, RRM2_MSSP1, RNA recognition motif 2 found 3e-07
cd1238674 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 3e-07
cd1231577 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 3e-07
cd1247280 cd12472, RRM1_RBMS3, RNA recognition motif 1 found 3e-07
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 4e-07
cd1247175 cd12471, RRM1_MSSP2, RNA recognition motif 1 in ve 4e-07
cd1259375 cd12593, RRM_RBM11, RNA recognition motif in verte 4e-07
cd1277183 cd12771, RRM1_HuB, RNA recognition motif 1 in vert 4e-07
cd1257776 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in ye 5e-07
cd1265179 cd12651, RRM2_SXL, RNA recognition motif 2 in Dros 5e-07
cd1263979 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 6e-07
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 6e-07
cd1267381 cd12673, RRM_BOULE, RNA recognition motif in prote 6e-07
cd1240678 cd12406, RRM4_NCL, RNA recognition motif 4 in vert 7e-07
cd1265486 cd12654, RRM3_HuB, RNA recognition motif 3 in vert 7e-07
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 7e-07
TIGR01645 612 TIGR01645, half-pint, poly-U binding splicing fact 8e-07
cd1234672 cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti 8e-07
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 9e-07
cd1256476 cd12564, RRM1_RBM19, RNA recognition motif 1 in RN 9e-07
cd1263892 cd12638, RRM3_CELF1_2, RNA recognition motif 3 in 9e-07
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 9e-07
cd1265078 cd12650, RRM1_Hu, RNA recognition motif 1 in the H 1e-06
cd1247486 cd12474, RRM2_MSSP2, RNA recognition motif 2 found 1e-06
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 1e-06
cd1265384 cd12653, RRM3_HuR, RNA recognition motif 3 in vert 1e-06
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 1e-06
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 1e-06
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 1e-06
cd1229080 cd12290, RRM1_LARP7, RNA recognition motif 1 in La 1e-06
cd1263681 cd12636, RRM2_Bruno_like, RNA recognition motif 2 1e-06
cd1237977 cd12379, RRM2_I_PABPs, RNA recognition motif 2 fou 2e-06
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 2e-06
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 2e-06
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 2e-06
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 2e-06
cd1237679 cd12376, RRM2_Hu_like, RNA recognition motif 2 in 2e-06
cd1277183 cd12771, RRM1_HuB, RNA recognition motif 1 in vert 2e-06
cd1265179 cd12651, RRM2_SXL, RNA recognition motif 2 in Dros 2e-06
cd1277284 cd12772, RRM1_HuC, RNA recognition motif 1 in vert 2e-06
cd1236681 cd12366, RRM1_RBM45, RNA recognition motif 1 in RN 2e-06
cd1244684 cd12446, RRM_RBM25, RNA recognition motif in eukar 2e-06
cd1234580 cd12345, RRM2_SECp43_like, RNA recognition motif 2 2e-06
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 2e-06
cd1224978 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 2e-06
cd1231984 cd12319, RRM4_MRD1, RNA recognition motif 4 in yea 2e-06
cd1231577 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 3e-06
cd1277083 cd12770, RRM1_HuD, RNA recognition motif 1 in vert 3e-06
cd1248778 cd12487, RRM1_DND1, RNA recognition motif 1 found 3e-06
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 3e-06
cd1262174 cd12621, RRM3_TIA1, RNA recognition motif 3 in nuc 3e-06
cd1276981 cd12769, RRM1_HuR, RNA recognition motif 1 in vert 3e-06
cd1232076 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot 3e-06
cd1276381 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in 3e-06
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 4e-06
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 4e-06
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 4e-06
cd1237076 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U 4e-06
cd1260968 cd12609, RRM2_CoAA, RNA recognition motif 2 in ver 4e-06
cd1265976 cd12659, RRM2_hnRNPM, RNA recognition motif 2 in v 4e-06
cd1265686 cd12656, RRM3_HuD, RNA recognition motif 3 in vert 4e-06
cd1268075 cd12680, RRM_THOC4, RNA recognition motif in THO c 4e-06
cd1224177 cd12241, RRM_SF3B14, RNA recognition motif found i 4e-06
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 5e-06
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 5e-06
cd1255277 cd12552, RRM_Nop15p, RNA recognition motif in yeas 5e-06
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 5e-06
cd1229172 cd12291, RRM1_La, RNA recognition motif 1 in La au 5e-06
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 5e-06
cd1257675 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA- 5e-06
cd1238383 cd12383, RRM_RBM42, RNA recognition motif in RNA-b 5e-06
cd1257776 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in ye 6e-06
cd1230575 cd12305, RRM_NELFE, RNA recognition motif in negat 6e-06
cd1263780 cd12637, RRM2_FCA, RNA recognition motif 2 in plan 6e-06
cd1267381 cd12673, RRM_BOULE, RNA recognition motif in prote 7e-06
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 7e-06
cd1257980 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in 8e-06
cd1262073 cd12620, RRM3_TIAR, RNA recognition motif 3 in nuc 8e-06
cd1277083 cd12770, RRM1_HuD, RNA recognition motif 1 in vert 9e-06
cd1241774 cd12417, RRM_SAFB_like, RNA recognition motif in t 9e-06
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 9e-06
cd1240776 cd12407, RRM_FOX1_like, RNA recognition motif in v 1e-05
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 1e-05
cd1266177 cd12661, RRM3_hnRNPM, RNA recognition motif 3 in v 1e-05
cd1263681 cd12636, RRM2_Bruno_like, RNA recognition motif 2 1e-05
cd1276981 cd12769, RRM1_HuR, RNA recognition motif 1 in vert 1e-05
cd1261880 cd12618, RRM2_TIA1, RNA recognition motif 2 in nuc 1e-05
cd1261880 cd12618, RRM2_TIA1, RNA recognition motif 2 in nuc 1e-05
cd1258980 cd12589, RRM2_PSP1, RNA recognition motif 2 in ver 1e-05
cd1259080 cd12590, RRM2_PSF, RNA recognition motif 2 in vert 1e-05
cd1238576 cd12385, RRM1_hnRNPM_like, RNA recognition motif 1 1e-05
cd1232488 cd12324, RRM_RBM8, RNA recognition motif in RNA-bi 1e-05
cd1235873 cd12358, RRM1_VICKZ, RNA recognition motif 1 in th 1e-05
cd1223982 cd12239, RRM2_RBM40_like, RNA recognition motif 2 1e-05
cd1265585 cd12655, RRM3_HuC, RNA recognition motif 3 in vert 1e-05
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 1e-05
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 2e-05
cd1265486 cd12654, RRM3_HuB, RNA recognition motif 3 in vert 2e-05
cd1277284 cd12772, RRM1_HuC, RNA recognition motif 1 in vert 2e-05
cd1263780 cd12637, RRM2_FCA, RNA recognition motif 2 in plan 2e-05
cd1240984 cd12409, RRM1_RRT5, RNA recognition motif 1 in yea 2e-05
cd1259275 cd12592, RRM_RBM7, RNA recognition motif in verteb 2e-05
cd1233474 cd12334, RRM1_SF3B4, RNA recognition motif 1 in sp 2e-05
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 2e-05
cd1230979 cd12309, RRM2_Spen, RNA recognition motif 2 in the 2e-05
cd1228373 cd12283, RRM1_RBM39_like, RNA recognition motif 1 2e-05
cd1232177 cd12321, RRM1_TDP43, RNA recognition motif 1 in TA 2e-05
cd1240572 cd12405, RRM3_NCL, RNA recognition motif 3 in vert 2e-05
cd1222981 cd12229, RRM_G3BP, RNA recognition motif (RRM) in 2e-05
cd1277681 cd12776, RRM2_HuC, RNA recognition motif 2 in vert 2e-05
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 3e-05
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 3e-05
pfam1389356 pfam13893, RRM_5, RNA recognition motif 3e-05
TIGR01648 578 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonu 3e-05
cd1231984 cd12319, RRM4_MRD1, RNA recognition motif 4 in yea 3e-05
cd1265976 cd12659, RRM2_hnRNPM, RNA recognition motif 2 in v 3e-05
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 3e-05
cd1277681 cd12776, RRM2_HuC, RNA recognition motif 2 in vert 3e-05
cd1277384 cd12773, RRM2_HuR, RNA recognition motif 2 in vert 3e-05
cd1277384 cd12773, RRM2_HuR, RNA recognition motif 2 in vert 3e-05
cd1275674 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in h 3e-05
cd1256779 cd12567, RRM3_RBM19, RNA recognition motif 3 in RN 3e-05
cd1277481 cd12774, RRM2_HuD, RNA recognition motif 2 in vert 3e-05
cd1233675 cd12336, RRM_RBM7_like, RNA recognition motif in R 3e-05
cd1252477 cd12524, RRM1_MEI2_like, RNA recognition motif 1 i 3e-05
cd1233075 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in ye 4e-05
cd1265686 cd12656, RRM3_HuD, RNA recognition motif 3 in vert 4e-05
cd1233675 cd12336, RRM_RBM7_like, RNA recognition motif in R 4e-05
cd1266076 cd12660, RRM2_MYEF2, RNA recognition motif 2 in ve 4e-05
cd1248578 cd12485, RRM1_RBM47, RNA recognition motif 1 found 4e-05
cd1275876 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in h 4e-05
cd1222577 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 4e-05
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 5e-05
cd1277590 cd12775, RRM2_HuB, RNA recognition motif 2 in vert 5e-05
cd1245386 cd12453, RRM1_RIM4_like, RNA recognition motif 1 i 5e-05
cd1246380 cd12463, RRM_G3BP1, RNA recognition motif found in 5e-05
cd1223370 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition m 5e-05
cd1240477 cd12404, RRM2_NCL, RNA recognition motif 2 in vert 5e-05
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 6e-05
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 6e-05
cd1228081 cd12280, RRM_FET, RNA recognition motif in the FET 6e-05
smart0036073 smart00360, RRM, RNA recognition motif 7e-05
cd1267282 cd12672, RRM_DAZL, RNA recognition motif in verteb 7e-05
cd1261780 cd12617, RRM2_TIAR, RNA recognition motif 2 in nuc 7e-05
cd1223873 cd12238, RRM1_RBM40_like, RNA recognition motif 1 7e-05
cd1264279 cd12642, RRM_TRA2A, RNA recognition motif in trans 7e-05
cd1259180 cd12591, RRM2_p54nrb, RNA recognition motif 2 in v 7e-05
cd1259872 cd12598, RRM1_SRSF9, RNA recognition motif 1 in ve 7e-05
cd1261474 cd12614, RRM1_PUB1, RNA recognition motif 1 in yea 7e-05
cd1234067 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in 8e-05
cd1265585 cd12655, RRM3_HuC, RNA recognition motif 3 in vert 8e-05
cd1277481 cd12774, RRM2_HuD, RNA recognition motif 2 in vert 8e-05
cd1245179 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nu 8e-05
cd1227272 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Ar 8e-05
cd1241698 cd12416, RRM4_RBM28_like, RNA recognition motif 4 8e-05
cd1263581 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 8e-05
cd1225379 cd12253, RRM_PIN4_like, RNA recognition motif in y 8e-05
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 9e-05
cd1277590 cd12775, RRM2_HuB, RNA recognition motif 2 in vert 9e-05
cd1239773 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 9e-05
cd1266277 cd12662, RRM3_MYEF2, RNA recognition motif 3 in ve 1e-04
cd1261780 cd12617, RRM2_TIAR, RNA recognition motif 2 in nuc 1e-04
cd1263581 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 1e-04
cd1246670 cd12466, RRM2_AtRSp31_like, RNA recognition motif 1e-04
cd1248478 cd12484, RRM1_RBM46, RNA recognition motif 1 found 1e-04
cd1259773 cd12597, RRM1_SRSF1, RNA recognition motif 1 in se 1e-04
cd1232780 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in D 1e-04
cd1241189 cd12411, RRM_ist3_like, RNA recognition motif in i 1e-04
cd1236774 cd12367, RRM2_RBM45, RNA recognition motif 2 in RN 1e-04
cd1227884 cd12278, RRM_eIF3B, RNA recognition motif in eukar 1e-04
cd1222384 cd12223, RRM_SR140, RNA recognition motif (RRM) in 2e-04
cd1244684 cd12446, RRM_RBM25, RNA recognition motif in eukar 2e-04
cd1224177 cd12241, RRM_SF3B14, RNA recognition motif found i 2e-04
cd1266076 cd12660, RRM2_MYEF2, RNA recognition motif 2 in ve 2e-04
cd1227884 cd12278, RRM_eIF3B, RNA recognition motif in eukar 2e-04
cd1264189 cd12641, RRM_TRA2B, RNA recognition motif in Trans 2e-04
cd1264189 cd12641, RRM_TRA2B, RNA recognition motif in Trans 2e-04
cd1248379 cd12483, RRM1_hnRNPQ, RNA recognition motif 1 in v 2e-04
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 2e-04
cd1233872 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 2e-04
cd1260667 cd12606, RRM1_RBM4, RNA recognition motif 1 in ver 2e-04
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 3e-04
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 3e-04
cd1262073 cd12620, RRM3_TIAR, RNA recognition motif 3 in nuc 3e-04
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 3e-04
cd1222981 cd12229, RRM_G3BP, RNA recognition motif (RRM) in 3e-04
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 3e-04
cd1257574 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 3e-04
cd1226777 cd12267, RRM_YRA1_MLO3, RNA recognition motif in y 3e-04
cd1249472 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in v 3e-04
cd1232374 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- 3e-04
cd1257179 cd12571, RRM6_RBM19, RNA recognition motif 6 in RN 3e-04
cd1262174 cd12621, RRM3_TIA1, RNA recognition motif 3 in nuc 4e-04
cd1268075 cd12680, RRM_THOC4, RNA recognition motif in THO c 4e-04
cd1276281 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 i 4e-04
cd1222777 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in 4e-04
cd1266577 cd12665, RRM2_RAVER1, RNA recognition motif 2 foun 4e-04
TIGR01622 457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 5e-04
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 5e-04
cd1266577 cd12665, RRM2_RAVER1, RNA recognition motif 2 foun 5e-04
cd1224678 cd12246, RRM1_U1A_like, RNA recognition motif 1 in 5e-04
cd1257076 cd12570, RRM5_MRD1, RNA recognition motif 5 in yea 5e-04
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 6e-04
cd1264677 cd12646, RRM_SRSF7, RNA recognition motif in verte 6e-04
TIGR01648 578 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonu 7e-04
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 7e-04
cd1264279 cd12642, RRM_TRA2A, RNA recognition motif in trans 7e-04
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 7e-04
cd1258671 cd12586, RRM1_PSP1, RNA recognition motif 1 in ver 7e-04
cd1235976 cd12359, RRM2_VICKZ, RNA recognition motif 2 in th 7e-04
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 8e-04
cd1266898 cd12668, RRM3_RAVER2, RNA recognition motif 3 foun 8e-04
cd1275775 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in 8e-04
cd1222474 cd12224, RRM_RBM22, RNA recognition motif (RRM) fo 8e-04
cd1226586 cd12265, RRM_SLT11, RNA recognition motif of pre-m 9e-04
cd1228893 cd12288, RRM_La_like_plant, RNA recognition motif 9e-04
cd1249572 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in v 9e-04
cd1228585 cd12285, RRM3_RBM39_like, RNA recognition motif 3 9e-04
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 0.001
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 0.001
cd1256476 cd12564, RRM1_RBM19, RNA recognition motif 1 in RN 0.001
cd1235272 cd12352, RRM1_TIA1_like, RNA recognition motif 1 i 0.001
cd1247086 cd12470, RRM1_MSSP1, RNA recognition motif 1 in ve 0.001
cd1247280 cd12472, RRM1_RBMS3, RNA recognition motif 1 found 0.001
cd1259375 cd12593, RRM_RBM11, RNA recognition motif in verte 0.001
cd1234672 cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti 0.001
cd1232076 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot 0.001
cd1260968 cd12609, RRM2_CoAA, RNA recognition motif 2 in ver 0.001
cd1257980 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in 0.001
cd1232177 cd12321, RRM1_TDP43, RNA recognition motif 1 in TA 0.001
cd1261474 cd12614, RRM1_PUB1, RNA recognition motif 1 in yea 0.001
cd1257076 cd12570, RRM5_MRD1, RNA recognition motif 5 in yea 0.001
cd1223289 cd12232, RRM3_U2AF65, RNA recognition motif 3 foun 0.001
cd1266677 cd12666, RRM2_RAVER2, RNA recognition motif 2 in v 0.001
cd1255587 cd12555, RRM2_RBM15, RNA recognition motif 2 in ve 0.001
cd1248279 cd12482, RRM1_hnRNPR, RNA recognition motif 1 in v 0.001
cd1260476 cd12604, RRM_RALY, RNA recognition motif in verteb 0.001
cd1229574 cd12295, RRM_YRA2, RNA recognition motif in yeast 0.001
cd1252378 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA 0.001
cd1258180 cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 i 0.001
cd1263481 cd12634, RRM2_CELF1_2, RNA recognition motif 2 in 0.001
cd1247175 cd12471, RRM1_MSSP2, RNA recognition motif 1 in ve 0.002
cd1238383 cd12383, RRM_RBM42, RNA recognition motif in RNA-b 0.002
cd1238576 cd12385, RRM1_hnRNPM_like, RNA recognition motif 1 0.002
cd1232488 cd12324, RRM_RBM8, RNA recognition motif in RNA-bi 0.002
cd1235873 cd12358, RRM1_VICKZ, RNA recognition motif 1 in th 0.002
cd1232374 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- 0.002
cd1222777 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in 0.002
cd1226586 cd12265, RRM_SLT11, RNA recognition motif of pre-m 0.002
cd1252378 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA 0.002
cd1258280 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in 0.002
cd1252279 cd12522, RRM4_MRN1, RNA recognition motif 4 of RNA 0.002
cd1261084 cd12610, RRM1_SECp43, RNA recognition motif 1 in t 0.002
cd12676107 cd12676, RRM3_Nop4p, RNA recognition motif 3 in ye 0.002
cd1265876 cd12658, RRM1_MYEF2, RNA recognition motif 1 in ve 0.002
cd1256576 cd12565, RRM1_MRD1, RNA recognition motif 1 in yea 0.003
cd1223583 cd12235, RRM_PPIL4, RNA recognition motif in pepti 0.003
cd1267583 cd12675, RRM2_Nop4p, RNA recognition motif 2 in ye 0.003
cd1232679 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 fou 0.003
cd1245179 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nu 0.003
cd1239773 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 0.003
cd1275775 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in 0.003
cd1261574 cd12615, RRM1_TIA1, RNA recognition motif 1 in nuc 0.003
cd1259972 cd12599, RRM1_SF2_plant_like, RNA recognition moti 0.003
cd1245980 cd12459, RRM1_CID8_like, RNA recognition motif 1 i 0.003
cd1258077 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in 0.003
cd1237276 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif 0.003
cd1255685 cd12556, RRM2_RBM15B, RNA recognition motif 2 in p 0.003
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 0.004
cd1241698 cd12416, RRM4_RBM28_like, RNA recognition motif 4 0.004
cd1236774 cd12367, RRM2_RBM45, RNA recognition motif 2 in RN 0.004
cd1257482 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in D 0.004
cd1248678 cd12486, RRM1_ACF, RNA recognition motif 1 found i 0.004
cd1235789 cd12357, RRM_PPARGC1A_like, RNA recognition motif 0.004
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
 Score =  403 bits (1036), Expect = e-138
 Identities = 165/266 (62%), Positives = 204/266 (76%), Gaps = 8/266 (3%)

Query: 76  DTERALDTMNFDALKGRPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKAMYDTFSAFG 135
           D ERAL+TMNF  L G+PIRIMWSQRDPSLR+SGVGN+F+KNLDKS+DNKA++DTFS FG
Sbjct: 54  DAERALETMNFKRLGGKPIRIMWSQRDPSLRRSGVGNIFVKNLDKSVDNKALFDTFSKFG 113

Query: 136 SILSCKVAQDEQGNSKGYGFVHFETEEAANKSIEKVNGMLLNSKIVFVGKFIPRKEREKE 195
           +ILSCKVA DE G S+GYGFVHFE EE+A  +I+KVNGMLLN K V+VG+FI + ERE  
Sbjct: 114 NILSCKVATDENGKSRGYGFVHFEKEESAKAAIQKVNGMLLNDKEVYVGRFIKKHERE-- 171

Query: 196 LGEKAKLFTNVYIKNFGEDFNDEKLKEMFEPYGTITSYRVM-NNDGKSRGFGFVAYESPE 254
                K FTN+Y+KN     N++KL+E+F  +G ITS  VM +  G+SRGF FV +E  E
Sbjct: 172 -AAPLKKFTNLYVKNLDPSVNEDKLRELFAKFGEITSAAVMKDGSGRSRGFAFVNFEKHE 230

Query: 255 FAEKAVQAWNGKEVD----GKILYVGRAQKKAERTQELKRRFEMLKIERLNRYQGVNLYV 310
            A KAV+  NGK++     GK LYVGRAQK+AER  EL+R+FE L+ ER  + QGVNLYV
Sbjct: 231 DAAKAVEEMNGKKIGLAKEGKKLYVGRAQKRAEREAELRRKFEELQQERKMKAQGVNLYV 290

Query: 311 KNLDDSIDDERLRKEFTPFGTITSAK 336
           KNLDD++ DE+LR+ F+  G ITSAK
Sbjct: 291 KNLDDTVTDEKLRELFSECGEITSAK 316


These eukaryotic proteins recognize the poly-A of mRNA and consists of four tandem RNA recognition domains at the N-terminus (rrm: pfam00076) followed by a PABP-specific domain (pfam00658) at the C-terminus. The protein is involved in the transport of mRNA's from the nucleus to the cytoplasm. There are four paralogs in Homo sapiens which are expressed in testis (GP:11610605_PABP3 ), platelets (SP:Q13310_PABP4 ), broadly expressed (SP:P11940_PABP1) and of unknown tissue range (SP:Q15097_PABP2). Length = 562

>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA binding protein fox-1 homologs and similar proteins Back     alignment and domain information
>gnl|CDD|240833 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|240689 cd12243, RRM1_MSSP, RNA recognition motif 1 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|240690 cd12244, RRM2_MSSP, RNA recognition motif 2 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240836 cd12390, RRM3_RAVER, RNA recognition motif 3 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241063 cd12619, RRM2_PUB1, RNA recognition motif 2 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240743 cd12297, RRM2_Prp24, RNA recognition motif 2 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|241083 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|241056 cd12612, RRM2_SECp43, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) Back     alignment and domain information
>gnl|CDD|240719 cd12273, RRM1_NEFsp, RNA recognition motif 1 in vertebrate putative RNA exonuclease NEF-sp Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|241008 cd12564, RRM1_RBM19, RNA recognition motif 1 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|240833 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|241063 cd12619, RRM2_PUB1, RNA recognition motif 2 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|241096 cd12652, RRM2_Hu, RNA recognition motif 2 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240919 cd12475, RRM2_RBMS3, RNA recognition motif 2 found in vertebrate RNA-binding motif, single-stranded-interacting protein 3 (RBMS3) Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|240690 cd12244, RRM2_MSSP, RNA recognition motif 2 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|240918 cd12474, RRM2_MSSP2, RNA recognition motif 2 found in vertebrate single-stranded DNA-binding protein MSSP-2 Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240917 cd12473, RRM2_MSSP1, RNA recognition motif 2 found in vertebrate single-stranded DNA-binding protein MSSP-1 Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|241097 cd12653, RRM3_HuR, RNA recognition motif 3 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|241082 cd12638, RRM3_CELF1_2, RNA recognition motif 3 in CUGBP Elav-like family member CELF-1, CELF-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240786 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in yeast nucleolar protein 3 (Npl3p) and similar proteins Back     alignment and domain information
>gnl|CDD|241084 cd12640, RRM3_Bruno_like, RNA recognition motif 3 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|240689 cd12243, RRM1_MSSP, RNA recognition motif 1 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|240832 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family Back     alignment and domain information
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|240836 cd12390, RRM3_RAVER, RNA recognition motif 3 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated protein SR140 and similar proteins Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|241106 cd12662, RRM3_MYEF2, RNA recognition motif 3 in vertebrate myelin expression factor 2 (MEF-2) Back     alignment and domain information
>gnl|CDD|241096 cd12652, RRM2_Hu, RNA recognition motif 2 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|241084 cd12640, RRM3_Bruno_like, RNA recognition motif 3 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) and similar proteins Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|240779 cd12333, RRM2_p54nrb_like, RNA recognition motif 2 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|241119 cd12675, RRM2_Nop4p, RNA recognition motif 2 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240772 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 found in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|241105 cd12661, RRM3_hnRNPM, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein M (hnRNP M) Back     alignment and domain information
>gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|240919 cd12475, RRM2_RBMS3, RNA recognition motif 2 found in vertebrate RNA-binding motif, single-stranded-interacting protein 3 (RBMS3) Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family Back     alignment and domain information
>gnl|CDD|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|240914 cd12470, RRM1_MSSP1, RNA recognition motif 1 in vertebrate single-stranded DNA-binding protein MSSP-1 Back     alignment and domain information
>gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins Back     alignment and domain information
>gnl|CDD|241022 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240822 cd12376, RRM2_Hu_like, RNA recognition motif 2 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|233507 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>gnl|CDD|241205 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240917 cd12473, RRM2_MSSP1, RNA recognition motif 2 found in vertebrate single-stranded DNA-binding protein MSSP-1 Back     alignment and domain information
>gnl|CDD|240832 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|240761 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 in RNA-binding protein 19 (RBM19), yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240916 cd12472, RRM1_RBMS3, RNA recognition motif 1 found in vertebrate RNA-binding motif, single-stranded-interacting protein 3 (RBMS3) Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240915 cd12471, RRM1_MSSP2, RNA recognition motif 1 in vertebrate single-stranded DNA-binding protein MSSP-2 Back     alignment and domain information
>gnl|CDD|241037 cd12593, RRM_RBM11, RNA recognition motif in vertebrate RNA-binding protein 11 (RBM11) Back     alignment and domain information
>gnl|CDD|241215 cd12771, RRM1_HuB, RNA recognition motif 1 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|241021 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|241083 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|241117 cd12673, RRM_BOULE, RNA recognition motif in protein BOULE Back     alignment and domain information
>gnl|CDD|240852 cd12406, RRM4_NCL, RNA recognition motif 4 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|241098 cd12654, RRM3_HuB, RNA recognition motif 3 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|241008 cd12564, RRM1_RBM19, RNA recognition motif 1 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|241082 cd12638, RRM3_CELF1_2, RNA recognition motif 3 in CUGBP Elav-like family member CELF-1, CELF-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240918 cd12474, RRM2_MSSP2, RNA recognition motif 2 found in vertebrate single-stranded DNA-binding protein MSSP-2 Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|241097 cd12653, RRM3_HuR, RNA recognition motif 3 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins Back     alignment and domain information
>gnl|CDD|241080 cd12636, RRM2_Bruno_like, RNA recognition motif 2 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|240822 cd12376, RRM2_Hu_like, RNA recognition motif 2 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|241215 cd12771, RRM1_HuB, RNA recognition motif 1 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|241216 cd12772, RRM1_HuC, RNA recognition motif 1 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240812 cd12366, RRM1_RBM45, RNA recognition motif 1 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240892 cd12446, RRM_RBM25, RNA recognition motif in eukaryotic RNA-binding protein 25 and similar proteins Back     alignment and domain information
>gnl|CDD|240791 cd12345, RRM2_SECp43_like, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240695 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240765 cd12319, RRM4_MRD1, RNA recognition motif 4 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240761 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 in RNA-binding protein 19 (RBM19), yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|241214 cd12770, RRM1_HuD, RNA recognition motif 1 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240931 cd12487, RRM1_DND1, RNA recognition motif 1 found in vertebrate dead end protein homolog 1 (DND1) Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|241065 cd12621, RRM3_TIA1, RNA recognition motif 3 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241213 cd12769, RRM1_HuR, RNA recognition motif 1 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|241207 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|241053 cd12609, RRM2_CoAA, RNA recognition motif 2 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|241103 cd12659, RRM2_hnRNPM, RNA recognition motif 2 in vertebrate heterogeneous nuclear ribonucleoprotein M (hnRNP M) Back     alignment and domain information
>gnl|CDD|241100 cd12656, RRM3_HuD, RNA recognition motif 3 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|241124 cd12680, RRM_THOC4, RNA recognition motif in THO complex subunit 4 (THOC4) and similar proteins Back     alignment and domain information
>gnl|CDD|240687 cd12241, RRM_SF3B14, RNA recognition motif found in pre-mRNA branch site protein p14 (SF3B14) and similar proteins Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240737 cd12291, RRM1_La, RNA recognition motif 1 in La autoantigen (La or LARP3) and similar proteins Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|241020 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA-binding protein Musashi homolog Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240829 cd12383, RRM_RBM42, RNA recognition motif in RNA-binding protein 42 (RBM42) and similar proteins Back     alignment and domain information
>gnl|CDD|241021 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240751 cd12305, RRM_NELFE, RNA recognition motif in negative elongation factor E (NELF-E) and similar proteins Back     alignment and domain information
>gnl|CDD|241081 cd12637, RRM2_FCA, RNA recognition motif 2 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|241117 cd12673, RRM_BOULE, RNA recognition motif in protein BOULE Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|241023 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|241064 cd12620, RRM3_TIAR, RNA recognition motif 3 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|241214 cd12770, RRM1_HuD, RNA recognition motif 1 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240863 cd12417, RRM_SAFB_like, RNA recognition motif in the scaffold attachment factor (SAFB) family Back     alignment and domain information
>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA binding protein fox-1 homologs and similar proteins Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|241105 cd12661, RRM3_hnRNPM, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein M (hnRNP M) Back     alignment and domain information
>gnl|CDD|241080 cd12636, RRM2_Bruno_like, RNA recognition motif 2 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|241213 cd12769, RRM1_HuR, RNA recognition motif 1 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|241062 cd12618, RRM2_TIA1, RNA recognition motif 2 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241062 cd12618, RRM2_TIA1, RNA recognition motif 2 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241033 cd12589, RRM2_PSP1, RNA recognition motif 2 in vertebrate paraspeckle protein 1 (PSP1 or PSPC1) Back     alignment and domain information
>gnl|CDD|241034 cd12590, RRM2_PSF, RNA recognition motif 2 in vertebrate polypyrimidine tract-binding protein (PTB)-associated-splicing factor (PSF) Back     alignment and domain information
>gnl|CDD|240831 cd12385, RRM1_hnRNPM_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins Back     alignment and domain information
>gnl|CDD|240804 cd12358, RRM1_VICKZ, RNA recognition motif 1 in the VICKZ family proteins Back     alignment and domain information
>gnl|CDD|240685 cd12239, RRM2_RBM40_like, RNA recognition motif 2 in RNA-binding protein 40 (RBM40) and similar proteins Back     alignment and domain information
>gnl|CDD|241099 cd12655, RRM3_HuC, RNA recognition motif 3 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|241098 cd12654, RRM3_HuB, RNA recognition motif 3 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|241216 cd12772, RRM1_HuC, RNA recognition motif 1 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|241081 cd12637, RRM2_FCA, RNA recognition motif 2 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|240855 cd12409, RRM1_RRT5, RNA recognition motif 1 in yeast regulator of rDNA transcription protein 5 (RRT5) and similar proteins Back     alignment and domain information
>gnl|CDD|241036 cd12592, RRM_RBM7, RNA recognition motif in vertebrate RNA-binding protein 7 (RBM7) Back     alignment and domain information
>gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|240755 cd12309, RRM2_Spen, RNA recognition motif 2 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|240851 cd12405, RRM3_NCL, RNA recognition motif 3 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras GTPase-activating protein-binding protein G3BP1, G3BP2 and similar proteins Back     alignment and domain information
>gnl|CDD|241220 cd12776, RRM2_HuC, RNA recognition motif 2 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|233507 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>gnl|CDD|240765 cd12319, RRM4_MRD1, RNA recognition motif 4 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|241103 cd12659, RRM2_hnRNPM, RNA recognition motif 2 in vertebrate heterogeneous nuclear ribonucleoprotein M (hnRNP M) Back     alignment and domain information
>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|241220 cd12776, RRM2_HuC, RNA recognition motif 2 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|241217 cd12773, RRM2_HuR, RNA recognition motif 2 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|241217 cd12773, RRM2_HuR, RNA recognition motif 2 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|241200 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins Back     alignment and domain information
>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|241218 cd12774, RRM2_HuD, RNA recognition motif 2 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins Back     alignment and domain information
>gnl|CDD|240968 cd12524, RRM1_MEI2_like, RNA recognition motif 1 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241100 cd12656, RRM3_HuD, RNA recognition motif 3 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins Back     alignment and domain information
>gnl|CDD|241104 cd12660, RRM2_MYEF2, RNA recognition motif 2 in vertebrate myelin expression factor 2 (MEF-2) Back     alignment and domain information
>gnl|CDD|240929 cd12485, RRM1_RBM47, RNA recognition motif 1 found in vertebrate RNA-binding protein 47 (RBM47) Back     alignment and domain information
>gnl|CDD|241202 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP D-like or hnRNP DL) and similar proteins Back     alignment and domain information
>gnl|CDD|240671 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 and 2 (RRM1, RRM2) in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|241219 cd12775, RRM2_HuB, RNA recognition motif 2 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240899 cd12453, RRM1_RIM4_like, RNA recognition motif 1 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240909 cd12463, RRM_G3BP1, RNA recognition motif found in ras GTPase-activating protein-binding protein 1 (G3BP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240679 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition motif found in fission yeast pre-mRNA-splicing factor Srp1p, Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins Back     alignment and domain information
>gnl|CDD|240850 cd12404, RRM2_NCL, RNA recognition motif 2 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240726 cd12280, RRM_FET, RNA recognition motif in the FET family of RNA-binding proteins Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|241116 cd12672, RRM_DAZL, RNA recognition motif in vertebrate deleted in azoospermia-like (DAZL) proteins Back     alignment and domain information
>gnl|CDD|241061 cd12617, RRM2_TIAR, RNA recognition motif 2 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|240684 cd12238, RRM1_RBM40_like, RNA recognition motif 1 in RNA-binding protein 40 (RBM40) and similar proteins Back     alignment and domain information
>gnl|CDD|241086 cd12642, RRM_TRA2A, RNA recognition motif in transformer-2 protein homolog alpha (TRA-2 alpha) and similar proteins Back     alignment and domain information
>gnl|CDD|241035 cd12591, RRM2_p54nrb, RNA recognition motif 2 in vertebrate 54 kDa nuclear RNA- and DNA-binding protein (p54nrb) Back     alignment and domain information
>gnl|CDD|241042 cd12598, RRM1_SRSF9, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 9 (SRSF9) Back     alignment and domain information
>gnl|CDD|241058 cd12614, RRM1_PUB1, RNA recognition motif 1 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240786 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in yeast nucleolar protein 3 (Npl3p) and similar proteins Back     alignment and domain information
>gnl|CDD|241099 cd12655, RRM3_HuC, RNA recognition motif 3 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|241218 cd12774, RRM2_HuD, RNA recognition motif 2 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240897 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240718 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240862 cd12416, RRM4_RBM28_like, RNA recognition motif 4 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|241079 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240699 cd12253, RRM_PIN4_like, RNA recognition motif in yeast RNA-binding protein PIN4, fission yeast RNA-binding post-transcriptional regulators cip1, cip2 and similar proteins Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|241219 cd12775, RRM2_HuB, RNA recognition motif 2 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast nucleolar protein 13 (Nop13p) and similar proteins Back     alignment and domain information
>gnl|CDD|241106 cd12662, RRM3_MYEF2, RNA recognition motif 3 in vertebrate myelin expression factor 2 (MEF-2) Back     alignment and domain information
>gnl|CDD|241061 cd12617, RRM2_TIAR, RNA recognition motif 2 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|241079 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240912 cd12466, RRM2_AtRSp31_like, RNA recognition motif 2 in Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins from plants Back     alignment and domain information
>gnl|CDD|240928 cd12484, RRM1_RBM46, RNA recognition motif 1 found in vertebrate RNA-binding protein 46 (RBM46) Back     alignment and domain information
>gnl|CDD|241041 cd12597, RRM1_SRSF1, RNA recognition motif 1 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins Back     alignment and domain information
>gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family Back     alignment and domain information
>gnl|CDD|240813 cd12367, RRM2_RBM45, RNA recognition motif 2 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240724 cd12278, RRM_eIF3B, RNA recognition motif in eukaryotic translation initiation factor 3 subunit B (eIF-3B) and similar proteins Back     alignment and domain information
>gnl|CDD|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated protein SR140 and similar proteins Back     alignment and domain information
>gnl|CDD|240892 cd12446, RRM_RBM25, RNA recognition motif in eukaryotic RNA-binding protein 25 and similar proteins Back     alignment and domain information
>gnl|CDD|240687 cd12241, RRM_SF3B14, RNA recognition motif found in pre-mRNA branch site protein p14 (SF3B14) and similar proteins Back     alignment and domain information
>gnl|CDD|241104 cd12660, RRM2_MYEF2, RNA recognition motif 2 in vertebrate myelin expression factor 2 (MEF-2) Back     alignment and domain information
>gnl|CDD|240724 cd12278, RRM_eIF3B, RNA recognition motif in eukaryotic translation initiation factor 3 subunit B (eIF-3B) and similar proteins Back     alignment and domain information
>gnl|CDD|241085 cd12641, RRM_TRA2B, RNA recognition motif in Transformer-2 protein homolog beta (TRA-2 beta) and similar proteins Back     alignment and domain information
>gnl|CDD|241085 cd12641, RRM_TRA2B, RNA recognition motif in Transformer-2 protein homolog beta (TRA-2 beta) and similar proteins Back     alignment and domain information
>gnl|CDD|240927 cd12483, RRM1_hnRNPQ, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|240784 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins Back     alignment and domain information
>gnl|CDD|241050 cd12606, RRM1_RBM4, RNA recognition motif 1 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|241064 cd12620, RRM3_TIAR, RNA recognition motif 3 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras GTPase-activating protein-binding protein G3BP1, G3BP2 and similar proteins Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|241019 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|240713 cd12267, RRM_YRA1_MLO3, RNA recognition motif in yeast RNA annealing protein YRA1 (Yra1p), yeast mRNA export protein mlo3 and similar proteins Back     alignment and domain information
>gnl|CDD|240938 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) Back     alignment and domain information
>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241015 cd12571, RRM6_RBM19, RNA recognition motif 6 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|241065 cd12621, RRM3_TIA1, RNA recognition motif 3 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241124 cd12680, RRM_THOC4, RNA recognition motif in THO complex subunit 4 (THOC4) and similar proteins Back     alignment and domain information
>gnl|CDD|241206 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins Back     alignment and domain information
>gnl|CDD|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 4 (SCAF4), SR-related and CTD-associated factor 8 (SCAF8) and similar proteins Back     alignment and domain information
>gnl|CDD|241109 cd12665, RRM2_RAVER1, RNA recognition motif 2 found in vertebrate ribonucleoprotein PTB-binding 1 (raver-1) Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|241109 cd12665, RRM2_RAVER1, RNA recognition motif 2 found in vertebrate ribonucleoprotein PTB-binding 1 (raver-1) Back     alignment and domain information
>gnl|CDD|240692 cd12246, RRM1_U1A_like, RNA recognition motif 1 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|241014 cd12570, RRM5_MRD1, RNA recognition motif 5 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|241090 cd12646, RRM_SRSF7, RNA recognition motif in vertebrate serine/arginine-rich splicing factor 7 (SRSF7) Back     alignment and domain information
>gnl|CDD|233507 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|241086 cd12642, RRM_TRA2A, RNA recognition motif in transformer-2 protein homolog alpha (TRA-2 alpha) and similar proteins Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|241030 cd12586, RRM1_PSP1, RNA recognition motif 1 in vertebrate paraspeckle protein 1 (PSP1) Back     alignment and domain information
>gnl|CDD|240805 cd12359, RRM2_VICKZ, RNA recognition motif 2 in the VICKZ family proteins Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|241112 cd12668, RRM3_RAVER2, RNA recognition motif 3 found in vertebrate ribonucleoprotein PTB-binding 2 (raver-2) Back     alignment and domain information
>gnl|CDD|241201 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|240670 cd12224, RRM_RBM22, RNA recognition motif (RRM) found in Pre-mRNA-splicing factor RBM22 and similar proteins Back     alignment and domain information
>gnl|CDD|240711 cd12265, RRM_SLT11, RNA recognition motif of pre-mRNA-splicing factor SLT11 and similar proteins Back     alignment and domain information
>gnl|CDD|240734 cd12288, RRM_La_like_plant, RNA recognition motif in plant proteins related to the La autoantigen Back     alignment and domain information
>gnl|CDD|240939 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) Back     alignment and domain information
>gnl|CDD|240731 cd12285, RRM3_RBM39_like, RNA recognition motif 3 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|241008 cd12564, RRM1_RBM19, RNA recognition motif 1 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240914 cd12470, RRM1_MSSP1, RNA recognition motif 1 in vertebrate single-stranded DNA-binding protein MSSP-1 Back     alignment and domain information
>gnl|CDD|240916 cd12472, RRM1_RBMS3, RNA recognition motif 1 found in vertebrate RNA-binding motif, single-stranded-interacting protein 3 (RBMS3) Back     alignment and domain information
>gnl|CDD|241037 cd12593, RRM_RBM11, RNA recognition motif in vertebrate RNA-binding protein 11 (RBM11) Back     alignment and domain information
>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|241053 cd12609, RRM2_CoAA, RNA recognition motif 2 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|241023 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|241058 cd12614, RRM1_PUB1, RNA recognition motif 1 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|241014 cd12570, RRM5_MRD1, RNA recognition motif 5 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240678 cd12232, RRM3_U2AF65, RNA recognition motif 3 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|241110 cd12666, RRM2_RAVER2, RNA recognition motif 2 in vertebrate ribonucleoprotein PTB-binding 2 (raver-2) Back     alignment and domain information
>gnl|CDD|240999 cd12555, RRM2_RBM15, RNA recognition motif 2 in vertebrate RNA binding motif protein 15 (RBM15) Back     alignment and domain information
>gnl|CDD|240926 cd12482, RRM1_hnRNPR, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) Back     alignment and domain information
>gnl|CDD|241048 cd12604, RRM_RALY, RNA recognition motif in vertebrate RNA-binding protein Raly Back     alignment and domain information
>gnl|CDD|240741 cd12295, RRM_YRA2, RNA recognition motif in yeast RNA annealing protein YRA2 (Yra2p) and similar proteins Back     alignment and domain information
>gnl|CDD|240967 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|241025 cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins Back     alignment and domain information
>gnl|CDD|241078 cd12634, RRM2_CELF1_2, RNA recognition motif 2 in CUGBP Elav-like family member CELF-1, CELF-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240915 cd12471, RRM1_MSSP2, RNA recognition motif 1 in vertebrate single-stranded DNA-binding protein MSSP-2 Back     alignment and domain information
>gnl|CDD|240829 cd12383, RRM_RBM42, RNA recognition motif in RNA-binding protein 42 (RBM42) and similar proteins Back     alignment and domain information
>gnl|CDD|240831 cd12385, RRM1_hnRNPM_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins Back     alignment and domain information
>gnl|CDD|240804 cd12358, RRM1_VICKZ, RNA recognition motif 1 in the VICKZ family proteins Back     alignment and domain information
>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 4 (SCAF4), SR-related and CTD-associated factor 8 (SCAF8) and similar proteins Back     alignment and domain information
>gnl|CDD|240711 cd12265, RRM_SLT11, RNA recognition motif of pre-mRNA-splicing factor SLT11 and similar proteins Back     alignment and domain information
>gnl|CDD|240967 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|241026 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins Back     alignment and domain information
>gnl|CDD|240966 cd12522, RRM4_MRN1, RNA recognition motif 4 of RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|241054 cd12610, RRM1_SECp43, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) Back     alignment and domain information
>gnl|CDD|241120 cd12676, RRM3_Nop4p, RNA recognition motif 3 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241102 cd12658, RRM1_MYEF2, RNA recognition motif 1 in vertebrate myelin expression factor 2 (MEF-2) Back     alignment and domain information
>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) and similar proteins Back     alignment and domain information
>gnl|CDD|241119 cd12675, RRM2_Nop4p, RNA recognition motif 2 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240772 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 found in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240897 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast nucleolar protein 13 (Nop13p) and similar proteins Back     alignment and domain information
>gnl|CDD|241201 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|241059 cd12615, RRM1_TIA1, RNA recognition motif 1 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241043 cd12599, RRM1_SF2_plant_like, RNA recognition motif 1 in plant pre-mRNA-splicing factor SF2 and similar proteins Back     alignment and domain information
>gnl|CDD|240905 cd12459, RRM1_CID8_like, RNA recognition motif 1 in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins Back     alignment and domain information
>gnl|CDD|241024 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|240818 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif of pre-mRNA cleavage factor Im 68 kDa subunit (CFIm68 or CPSF6), pre-mRNA cleavage factor Im 59 kDa subunit (CFIm59 or CPSF7), and similar proteins Back     alignment and domain information
>gnl|CDD|241000 cd12556, RRM2_RBM15B, RNA recognition motif 2 in putative RNA binding motif protein 15B (RBM15B) from vertebrate Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240862 cd12416, RRM4_RBM28_like, RNA recognition motif 4 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240813 cd12367, RRM2_RBM45, RNA recognition motif 2 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|241018 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240930 cd12486, RRM1_ACF, RNA recognition motif 1 found in vertebrate APOBEC-1 complementation factor (ACF) Back     alignment and domain information
>gnl|CDD|240803 cd12357, RRM_PPARGC1A_like, RNA recognition motif in the peroxisome proliferator-activated receptor gamma coactivator 1A (PGC-1alpha) family of regulated coactivators Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 336
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 100.0
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 100.0
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 100.0
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 100.0
KOG0145|consensus360 100.0
KOG0123|consensus369 100.0
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 100.0
KOG0117|consensus 506 100.0
KOG0127|consensus 678 100.0
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 100.0
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 100.0
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 100.0
TIGR01661 352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 100.0
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 100.0
KOG0148|consensus321 100.0
KOG0117|consensus 506 100.0
KOG0144|consensus510 100.0
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 100.0
KOG0145|consensus360 100.0
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 100.0
KOG0123|consensus369 99.98
KOG0127|consensus 678 99.98
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.98
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.97
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.97
KOG0110|consensus725 99.97
KOG0110|consensus725 99.97
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.97
KOG0124|consensus544 99.96
KOG0144|consensus 510 99.96
KOG0148|consensus321 99.96
KOG0147|consensus549 99.94
KOG0131|consensus203 99.94
KOG4212|consensus 608 99.93
KOG0131|consensus203 99.93
KOG1190|consensus492 99.93
KOG0109|consensus 346 99.92
KOG4211|consensus510 99.9
KOG0124|consensus 544 99.9
KOG0146|consensus371 99.89
KOG0109|consensus346 99.86
KOG0147|consensus 549 99.85
KOG0146|consensus371 99.84
KOG4205|consensus311 99.82
KOG0120|consensus500 99.82
KOG1190|consensus492 99.8
KOG4205|consensus311 99.77
KOG0105|consensus241 99.76
KOG4206|consensus221 99.75
KOG1365|consensus508 99.74
KOG1457|consensus284 99.71
KOG1548|consensus382 99.7
KOG1456|consensus494 99.7
KOG4206|consensus221 99.69
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.69
KOG0105|consensus241 99.68
KOG1456|consensus494 99.68
KOG4211|consensus 510 99.68
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.66
KOG4212|consensus 608 99.66
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.63
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.61
KOG0106|consensus216 99.61
KOG1548|consensus382 99.58
KOG4307|consensus 944 99.55
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.55
KOG0122|consensus270 99.54
KOG0122|consensus270 99.54
KOG1457|consensus284 99.54
KOG0125|consensus 376 99.53
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.52
KOG0125|consensus376 99.5
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.47
PLN03120 260 nucleic acid binding protein; Provisional 99.45
PLN03120260 nucleic acid binding protein; Provisional 99.45
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.45
KOG0106|consensus216 99.43
KOG0107|consensus195 99.43
KOG0114|consensus124 99.43
KOG0121|consensus153 99.42
smart0036272 RRM_2 RNA recognition motif. 99.42
KOG0114|consensus124 99.41
KOG0149|consensus247 99.41
smart0036272 RRM_2 RNA recognition motif. 99.4
PLN03213 759 repressor of silencing 3; Provisional 99.4
PLN03213 759 repressor of silencing 3; Provisional 99.39
KOG0121|consensus153 99.38
PLN03121243 nucleic acid binding protein; Provisional 99.38
KOG0107|consensus195 99.38
KOG4207|consensus 256 99.37
KOG4307|consensus 944 99.37
KOG0113|consensus335 99.36
KOG0149|consensus 247 99.36
KOG0126|consensus219 99.36
KOG1365|consensus508 99.36
KOG0126|consensus219 99.35
PLN03121 243 nucleic acid binding protein; Provisional 99.35
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.34
KOG0113|consensus335 99.34
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.34
smart0036071 RRM RNA recognition motif. 99.33
KOG0111|consensus 298 99.33
KOG4207|consensus256 99.32
KOG0120|consensus500 99.31
KOG0130|consensus170 99.31
smart0036071 RRM RNA recognition motif. 99.31
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.3
KOG0111|consensus298 99.26
KOG4660|consensus 549 99.22
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.22
KOG0130|consensus170 99.21
KOG0108|consensus 435 99.19
smart0036170 RRM_1 RNA recognition motif. 99.18
KOG0108|consensus 435 99.18
smart0036170 RRM_1 RNA recognition motif. 99.18
KOG0128|consensus881 99.17
KOG0129|consensus520 99.16
KOG0129|consensus520 99.13
KOG4454|consensus267 99.12
KOG0112|consensus 975 99.05
KOG4454|consensus267 99.01
KOG0128|consensus881 98.98
KOG4208|consensus214 98.97
KOG0226|consensus290 98.97
KOG0226|consensus290 98.96
KOG0132|consensus 894 98.91
KOG0112|consensus 975 98.91
KOG0415|consensus 479 98.9
KOG0415|consensus479 98.89
KOG4210|consensus285 98.88
KOG0132|consensus 894 98.84
KOG4208|consensus214 98.83
KOG4210|consensus285 98.82
KOG0153|consensus377 98.75
KOG4661|consensus 940 98.74
KOG0153|consensus377 98.72
KOG0533|consensus243 98.68
KOG4660|consensus 549 98.56
KOG4676|consensus 479 98.54
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 98.54
KOG0533|consensus243 98.52
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 98.52
KOG4661|consensus 940 98.46
KOG0116|consensus419 98.39
KOG0151|consensus 877 98.38
KOG0151|consensus 877 98.35
KOG2193|consensus 584 98.34
KOG0116|consensus419 98.32
KOG4209|consensus231 98.27
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 98.2
KOG2193|consensus 584 98.19
KOG4209|consensus231 98.11
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 98.06
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 97.92
KOG4676|consensus 479 97.91
KOG0115|consensus275 97.79
COG5175 480 MOT2 Transcriptional repressor [Transcription] 97.77
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 97.67
COG5175 480 MOT2 Transcriptional repressor [Transcription] 97.65
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 97.63
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 97.56
KOG0115|consensus 275 97.47
KOG2314|consensus 698 97.47
KOG1995|consensus 351 97.38
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 97.31
KOG2202|consensus260 97.2
KOG2314|consensus 698 97.11
KOG1995|consensus351 97.05
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 96.96
KOG3152|consensus278 96.94
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 96.94
KOG1996|consensus378 96.9
KOG2202|consensus260 96.89
KOG3152|consensus278 96.85
KOG1855|consensus484 96.82
KOG1996|consensus378 96.62
KOG4849|consensus 498 96.58
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 96.55
KOG4849|consensus 498 96.54
KOG1855|consensus 484 96.52
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 95.96
KOG2591|consensus 684 95.95
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 95.72
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 95.68
KOG2416|consensus718 95.61
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 95.5
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 95.47
PF15023166 DUF4523: Protein of unknown function (DUF4523) 95.41
KOG2416|consensus 718 95.4
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 95.38
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 95.23
KOG2591|consensus 684 94.95
PF15023166 DUF4523: Protein of unknown function (DUF4523) 94.86
PF0729288 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 94.74
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 94.66
KOG0804|consensus 493 94.09
KOG2068|consensus327 94.04
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 93.95
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 93.51
KOG4285|consensus350 93.29
KOG0804|consensus 493 93.07
PF0729288 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 92.76
KOG2068|consensus 327 92.59
PF14111153 DUF4283: Domain of unknown function (DUF4283) 91.3
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 91.04
PF10567309 Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IP 90.86
KOG2135|consensus526 88.77
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 88.27
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 87.92
KOG2135|consensus526 85.82
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 85.27
KOG4574|consensus 1007 84.35
PF14111153 DUF4283: Domain of unknown function (DUF4283) 82.81
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
Probab=100.00  E-value=1.2e-53  Score=408.55  Aligned_cols=310  Identities=56%  Similarity=0.883  Sum_probs=279.8

Q ss_pred             ceeeeecCchhhhhhhHHhhh-cccCCceEEEeCCCCcccccCCceEEEEEeCCcchhhHHHHHhhcCccccCCeeeEEE
Q psy12549         19 HNVATRELSAKVVEGVSRSLS-SLIDGNTVKYDWDSGYTCHQLGSGAILVQLGQPYMLDTERALDTMNFDALKGRPIRIM   97 (336)
Q Consensus        19 ~~v~v~~lp~~~~e~~l~~~f-~~~~~~~v~~~~~~~~~~~g~~~g~afV~f~~~~~~~A~~A~~~~~~~~~~g~~i~v~   97 (336)
                      .+|||+|||+++||++|+++| .+|.+.+|++.++.   .|++++|||||+|.+.  ++|++|++.+++..+.|++|+|.
T Consensus         1 ~sl~VgnLp~~vte~~L~~~F~~~G~v~~v~v~~d~---~t~~s~G~afV~F~~~--~~A~~Al~~ln~~~i~gk~i~i~   75 (562)
T TIGR01628         1 ASLYVGDLDPDVTEAKLYDLFKPFGPVLSVRVCRDS---VTRRSLGYGYVNFQNP--ADAERALETMNFKRLGGKPIRIM   75 (562)
T ss_pred             CeEEEeCCCCCCCHHHHHHHHHhcCCEEEEEEEecC---CCCCcceEEEEEECCH--HHHHHHHHHhCCCEECCeeEEee
Confidence            379999999999999999999 77788999999988   4789999999999999  99999999999999999999999


Q ss_pred             eccCCCCcCCCCCceEEEcCCCCCCCHHHHHHHhhccCCeeEEEEeeCCCCCcccEEEEEeCCHHHHHHHHHHhCCceeC
Q psy12549         98 WSQRDPSLRKSGVGNVFIKNLDKSIDNKAMYDTFSAFGSILSCKVAQDEQGNSKGYGFVHFETEEAANKSIEKVNGMLLN  177 (336)
Q Consensus        98 ~~~~~~~~~~~~~~~l~v~nlp~~~t~~~l~~~f~~~G~v~~~~~~~~~~~~~~g~afV~F~~~~~a~~a~~~l~~~~~~  177 (336)
                      |+..++........+|||+|||.++++++|+++|+.||.|.+|++..+..|+++|||||+|.+.++|.+|++.++|..+.
T Consensus        76 ~s~~~~~~~~~~~~~vfV~nLp~~~~~~~L~~~F~~~G~i~~~~i~~~~~g~skg~afV~F~~~e~A~~Ai~~lng~~~~  155 (562)
T TIGR01628        76 WSQRDPSLRRSGVGNIFVKNLDKSVDNKALFDTFSKFGNILSCKVATDENGKSRGYGFVHFEKEESAKAAIQKVNGMLLN  155 (562)
T ss_pred             cccccccccccCCCceEEcCCCccCCHHHHHHHHHhcCCcceeEeeecCCCCcccEEEEEECCHHHHHHHHHHhcccEec
Confidence            99888777777778999999999999999999999999999999999998999999999999999999999999999999


Q ss_pred             CeEEEEeeccCchhhhHhhhccccccceEEEcCCCCCCcHHHHHHhhccCCceeEEEEeC-CCCccceEEEEEeCCHHHH
Q psy12549        178 SKIVFVGKFIPRKEREKELGEKAKLFTNVYIKNFGEDFNDEKLKEMFEPYGTITSYRVMN-NDGKSRGFGFVAYESPEFA  256 (336)
Q Consensus       178 ~~~i~v~~~~~~~~~~~~~~~~~~~~~~l~V~nlp~~~t~~~l~~~f~~~g~i~~~~i~~-~~~~~~g~afV~F~~~~~a  256 (336)
                      |+.+.+....+.....   .......++|||+|||.++++++|+++|+.||.|.++.+.. .++.++|+|||+|.+.++|
T Consensus       156 ~~~i~v~~~~~~~~~~---~~~~~~~~~l~V~nl~~~~tee~L~~~F~~fG~i~~~~i~~~~~g~~~G~afV~F~~~e~A  232 (562)
T TIGR01628       156 DKEVYVGRFIKKHERE---AAPLKKFTNLYVKNLDPSVNEDKLRELFAKFGEITSAAVMKDGSGRSRGFAFVNFEKHEDA  232 (562)
T ss_pred             CceEEEeccccccccc---cccccCCCeEEEeCCCCcCCHHHHHHHHHhcCCEEEEEEEECCCCCcccEEEEEECCHHHH
Confidence            9999998766554432   11233447899999999999999999999999999999987 6788899999999999999


Q ss_pred             HHHHHHhCCceec----CEEEEEeecccchhhHHHHHHHHHHHHHHhhcCCCCceEEEecCCCCCCHHHHHHhcCCCCCe
Q psy12549        257 EKAVQAWNGKEVD----GKILYVGRAQKKAERTQELKRRFEMLKIERLNRYQGVNLYVKNLDDSIDDERLRKEFTPFGTI  332 (336)
Q Consensus       257 ~~a~~~l~g~~~~----g~~l~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~v~nlp~~~t~~~l~~~F~~~G~V  332 (336)
                      .+|++.++|..+.    |+.+.|.++..+.......................+++|||+||+..+++++|+++|++||.|
T Consensus       233 ~~Av~~l~g~~i~~~~~g~~l~v~~a~~k~er~~~~~~~~~~~~~~~~~~~~~~~l~V~nl~~~~~~~~L~~~F~~~G~i  312 (562)
T TIGR01628       233 AKAVEEMNGKKIGLAKEGKKLYVGRAQKRAEREAELRRKFEELQQERKMKAQGVNLYVKNLDDTVTDEKLRELFSECGEI  312 (562)
T ss_pred             HHHHHHhCCcEecccccceeeEeecccChhhhHHHHHhhHHhhhhhhhcccCCCEEEEeCCCCccCHHHHHHHHHhcCCe
Confidence            9999999999999    999999999888777666666666555555566778899999999999999999999999999


Q ss_pred             eecC
Q psy12549        333 TSAK  336 (336)
Q Consensus       333 ~~vk  336 (336)
                      .+||
T Consensus       313 ~~~~  316 (562)
T TIGR01628       313 TSAK  316 (562)
T ss_pred             EEEE
Confidence            9875



There are four paralogs in Homo sapiens which are expressed in testis, platelets, broadly expressed, or of unknown tissue range.

>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>KOG0226|consensus Back     alignment and domain information
>KOG0226|consensus Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG4676|consensus Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG4676|consensus Back     alignment and domain information
>KOG0115|consensus Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG0115|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG1995|consensus Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG2202|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG1995|consensus Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG3152|consensus Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG1996|consensus Back     alignment and domain information
>KOG2202|consensus Back     alignment and domain information
>KOG3152|consensus Back     alignment and domain information
>KOG1855|consensus Back     alignment and domain information
>KOG1996|consensus Back     alignment and domain information
>KOG4849|consensus Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG4849|consensus Back     alignment and domain information
>KOG1855|consensus Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>KOG2591|consensus Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>KOG2416|consensus Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>KOG2416|consensus Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>KOG2591|consensus Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>PF07292 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 This entry represents a domain of approximately 90 residues that is tandemly repeated within interferon-induced 35 kDa protein (IFP 35) and the homologous N-myc-interactor (Nmi) Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>KOG2068|consensus Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information
>KOG4285|consensus Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>PF07292 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 This entry represents a domain of approximately 90 residues that is tandemly repeated within interferon-induced 35 kDa protein (IFP 35) and the homologous N-myc-interactor (Nmi) Back     alignment and domain information
>KOG2068|consensus Back     alignment and domain information
>PF14111 DUF4283: Domain of unknown function (DUF4283) Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>PF10567 Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IPR018885 This conserved domain is found in fungal proteins and appears to be involved in RNA-processing Back     alignment and domain information
>KOG2135|consensus Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>KOG2135|consensus Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information
>KOG4574|consensus Back     alignment and domain information
>PF14111 DUF4283: Domain of unknown function (DUF4283) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query336
1cvj_A190 X-Ray Crystal Structure Of The Poly(A)-Binding Prot 4e-56
1cvj_A190 X-Ray Crystal Structure Of The Poly(A)-Binding Prot 5e-19
1cvj_A190 X-Ray Crystal Structure Of The Poly(A)-Binding Prot 3e-09
4f02_A213 Crystal Structure Of The Pabp-Binding Site Of Eif4g 5e-56
4f02_A213 Crystal Structure Of The Pabp-Binding Site Of Eif4g 5e-19
4f02_A213 Crystal Structure Of The Pabp-Binding Site Of Eif4g 4e-09
4f25_A115 Crystal Structure Of The Second Rrm Domain Of Human 4e-41
4f25_A115 Crystal Structure Of The Second Rrm Domain Of Human 2e-11
2k8g_A95 Solution Structure Of Rrm2 Domain Of Pabp1 Length = 7e-38
2k8g_A95 Solution Structure Of Rrm2 Domain Of Pabp1 Length = 2e-10
2d9p_A103 Solution Structure Of Rna Binding Domain 4 In Polya 2e-18
2d9p_A103 Solution Structure Of Rna Binding Domain 4 In Polya 5e-13
2kxf_A199 Solution Structure Of The First Two Rrm Domains Of 5e-17
2kxf_A199 Solution Structure Of The First Two Rrm Domains Of 1e-07
2qfj_A216 Crystal Structure Of First Two Rrm Domains Of Fir B 6e-17
2qfj_A216 Crystal Structure Of First Two Rrm Domains Of Fir B 4e-08
3uwt_A200 Crystal Structure Of A Rna Binding Domain Of Poly-U 4e-16
3uwt_A200 Crystal Structure Of A Rna Binding Domain Of Poly-U 5e-07
1b7f_A168 Sxl-Lethal ProteinRNA COMPLEX Length = 168 2e-15
1b7f_A168 Sxl-Lethal ProteinRNA COMPLEX Length = 168 9e-08
3sxl_A184 Sex-Lethal Rna Recognition Domains 1 And 2 From Dro 7e-15
3sxl_A184 Sex-Lethal Rna Recognition Domains 1 And 2 From Dro 2e-06
4egl_A177 Crystal Structure Of Two Tandem Rna Recognition Mot 1e-14
4egl_A177 Crystal Structure Of Two Tandem Rna Recognition Mot 8e-06
4ed5_A177 Crystal Structure Of The Two N-Terminal Rrm Domains 1e-14
4ed5_A177 Crystal Structure Of The Two N-Terminal Rrm Domains 8e-06
1fxl_A167 Crystal Structure Of Hud And Au-Rich Element Of The 1e-14
1fxl_A167 Crystal Structure Of Hud And Au-Rich Element Of The 4e-07
1fnx_H174 Solution Structure Of The Huc Rbd1-Rbd2 Complexed W 6e-14
1fnx_H174 Solution Structure Of The Huc Rbd1-Rbd2 Complexed W 1e-06
1x5t_A96 Solution Structure Of The Second Rrm Domain In Spli 9e-13
2cjk_A167 Structure Of The Rna Binding Domain Of Hrp1 In Comp 1e-12
2cjk_A167 Structure Of The Rna Binding Domain Of Hrp1 In Comp 3e-06
3md3_A166 Crystal Structure Of The First Two Rrm Domains Of Y 3e-12
3md3_A166 Crystal Structure Of The First Two Rrm Domains Of Y 2e-06
1l3k_A196 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 9e-09
1l3k_A196 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 1e-06
1ha1_A184 Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 1e-08
1ha1_A184 Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 2e-06
1pgz_A195 Crystal Structure Of Up1 Complexed With D(Ttagggtta 1e-08
1pgz_A195 Crystal Structure Of Up1 Complexed With D(Ttagggtta 2e-06
1up1_A182 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 1e-08
1up1_A182 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 2e-06
2up1_A183 Structure Of Up1-Telomeric Dna Complex Length = 183 1e-08
2up1_A183 Structure Of Up1-Telomeric Dna Complex Length = 183 2e-06
2lyv_A197 Solution Structure Of The Two Rrm Domains Of Hnrnp 1e-08
2lyv_A197 Solution Structure Of The Two Rrm Domains Of Hnrnp 2e-06
2jrs_A108 Solution Nmr Structure Of Caper Rrm2 Domain. Northe 9e-08
1x5s_A102 Solution Structure Of Rrm Domain In A18 Hnrnp Lengt 1e-07
2cpz_A115 Solution Structure Of Rna Binding Domain 3 In Cug T 1e-07
3smz_A284 Human Raver1 Rrm1-3 Domains (Residues 39-320) Lengt 2e-07
3h2u_B283 Human Raver1 Rrm1, Rrm2, And Rrm3 Domains In Comple 2e-07
3vf0_B285 Raver1 In Complex With Metavinculin L954 Deletion M 2e-07
1x5o_A114 Solution Structure Of Rrm Domain In Rna Binding Mot 2e-07
1fje_B175 Solution Structure Of Nucleolin Rbd12 In Complex Wi 3e-07
2khc_A118 Bruno Rrm3+ Length = 118 9e-07
3sde_A261 Crystal Structure Of A Paraspeckle-Protein Heterodi 1e-06
3sde_A 261 Crystal Structure Of A Paraspeckle-Protein Heterodi 2e-06
1p1t_A104 Nmr Structure Of The N-Terminal Rrm Domain Of Cleav 2e-06
2dgv_A92 Solution Structure Of The Rna Binding Domain In Het 2e-06
2dh9_A89 Solution Structure Of The C-Terminal Rna Binding Do 2e-06
2dnz_A95 Solution Structure Of The Second Rna Binding Domain 2e-06
3md1_A83 Crystal Structure Of The Second Rrm Domain Of Yeast 3e-06
3md1_A83 Crystal Structure Of The Second Rrm Domain Of Yeast 4e-05
2cpf_A98 Solution Structure Of The Penultimate Rna Recogniti 3e-06
2fy1_A116 A Dual Mode Of Rna Recognition By The Rbmy Protein 5e-06
2g4b_A172 Structure Of U2af65 Variant With Polyuridine Tract 9e-06
3vaf_A174 Structure Of U2af65 Variant With Bru3 Dna Length = 1e-05
2err_A109 Nmr Structure Of The Rna Binding Domain Of Human Fo 1e-05
3hi9_A84 The X-Ray Crystal Structure Of The First Rna Recogn 1e-05
3hi9_A84 The X-Ray Crystal Structure Of The First Rna Recogn 4e-04
2cq3_A103 Solution Structure Of Rna Binding Domain In Rna Bin 1e-05
2sxl_A88 Sex-Lethal Rbd1, Nmr, Minimized Average Structure L 2e-05
2sxl_A88 Sex-Lethal Rbd1, Nmr, Minimized Average Structure L 2e-04
2do0_A114 Solution Structure Of The Rna Binding Domain Of Het 2e-05
2do0_A114 Solution Structure Of The Rna Binding Domain Of Het 9e-04
2krr_A180 Solution Structure Of The Rbd1,2 Domains From Human 2e-05
1d8z_A89 Solution Structure Of The First Rna-Binding Domain 3e-05
1d8z_A89 Solution Structure Of The First Rna-Binding Domain 6e-05
2dgo_A115 Solution Structure Of The Rna Binding Domain In Cyt 4e-05
1whw_A99 Solution Structure Of The N-Terminal Rna Binding Do 4e-05
2jvo_A108 Segmental Isotope Labeling Of Npl3 Length = 108 5e-05
4fxv_A99 Crystal Structure Of An Elav-Like Protein 1 (Elavl1 5e-05
3sde_B261 Crystal Structure Of A Paraspeckle-Protein Heterodi 7e-05
3sde_B 261 Crystal Structure Of A Paraspeckle-Protein Heterodi 2e-04
2dhg_A104 Solution Structure Of The C-Terminal Rna Recognitio 8e-05
1u6f_A139 Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit 8e-05
1sxl_A97 Resonance Assignments And Solution Structure Of The 9e-05
1x4e_A85 Solution Structure Of Rrm Domain In Rna Binding Mot 1e-04
1d9a_A85 Solution Structure Of The Second Rna-Binding Domain 1e-04
1d9a_A85 Solution Structure Of The Second Rna-Binding Domain 7e-04
2fc8_A102 Solution Structure Of The Rrm_1 Domain Of Ncl Prote 1e-04
1fjc_A96 Solution Structure Of Nucleolin Rbd2 Length = 96 2e-04
1hd0_A75 Heterogeneous Nuclear Ribonucleoprotein D0 (Hnrnp D 2e-04
1x4b_A116 Solution Structure Of Rrm Domain In Heterogeneous N 2e-04
2ywk_A95 Crystal Structure Of Rrm-Domain Derived From Human 2e-04
2dh7_A105 Solution Structure Of The Second Rna Binding Domain 2e-04
2osq_A74 Nmr Structure Of Rrm-1 Of Yeast Npl3 Protein Length 2e-04
2dno_A102 Solution Structure Of Rna Binding Domain In Trinucl 2e-04
2rrb_A96 Refinement Of Rna Binding Domain In Human Tra2 Beta 3e-04
2kxn_B129 Nmr Structure Of Human Tra2beta1 Rrm In Complex Wit 3e-04
2cq0_A103 Solution Structure Of Rna Binding Domain In Eukaryo 3e-04
1x4g_A109 Solution Structure Of Rrm Domain In Nucleolysin Tia 3e-04
2xs5_A87 Crystal Structure Of The Rrm Domain Of Mouse Delete 4e-04
2xs2_A102 Crystal Structure Of The Rrm Domain Of Mouse Delete 4e-04
2xsf_A89 Crystal Structure Of The Rrm Domain Of Mouse Delete 4e-04
2ku7_A140 Solution Structure Of Mll1 Phd3-Cyp33 Rrm Chimeric 5e-04
3cw1_K216 Crystal Structure Of Human Spliceosomal U1 Snrnp Le 6e-04
2cqb_A102 Solution Structure Of The Rna Recognition Motif In 8e-04
1no8_A106 Solution Structure Of The Nuclear Factor Aly Rbd Do 9e-04
>pdb|1CVJ|A Chain A, X-Ray Crystal Structure Of The Poly(A)-Binding Protein In Complex With Polyadenylate Rna Length = 190 Back     alignment and structure

Iteration: 1

Score = 214 bits (546), Expect = 4e-56, Method: Compositional matrix adjust. Identities = 105/141 (74%), Positives = 118/141 (83%), Gaps = 3/141 (2%) Query: 63 GAILVQLGQPYMLDTERALDTMNFDALKGRPIRIMWSQRDPSLRKSGVGNVFIKNLDKSI 122 G V QP D ERALDTMNFD +KG+P+RIMWSQRDPSLRKSGVGN+FIKNLDKSI Sbjct: 53 GYAYVNFQQP--ADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSI 110 Query: 123 DNKAMYDTFSAFGSILSCKVAQDEQGNSKGYGFVHFETEEAANKSIEKVNGMLLNSKIVF 182 DNKA+YDTFSAFG+ILSCKV DE G SKGYGFVHFET+EAA ++IEK+NGMLLN + VF Sbjct: 111 DNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVF 169 Query: 183 VGKFIPRKEREKELGEKAKLF 203 VG+F RKERE ELG +AK F Sbjct: 170 VGRFKSRKEREAELGARAKEF 190
>pdb|1CVJ|A Chain A, X-Ray Crystal Structure Of The Poly(A)-Binding Protein In Complex With Polyadenylate Rna Length = 190 Back     alignment and structure
>pdb|1CVJ|A Chain A, X-Ray Crystal Structure Of The Poly(A)-Binding Protein In Complex With Polyadenylate Rna Length = 190 Back     alignment and structure
>pdb|4F02|A Chain A, Crystal Structure Of The Pabp-Binding Site Of Eif4g In Complex With Rrm1-2 Of Pabp And Poly(A) Length = 213 Back     alignment and structure
>pdb|4F02|A Chain A, Crystal Structure Of The Pabp-Binding Site Of Eif4g In Complex With Rrm1-2 Of Pabp And Poly(A) Length = 213 Back     alignment and structure
>pdb|4F02|A Chain A, Crystal Structure Of The Pabp-Binding Site Of Eif4g In Complex With Rrm1-2 Of Pabp And Poly(A) Length = 213 Back     alignment and structure
>pdb|4F25|A Chain A, Crystal Structure Of The Second Rrm Domain Of Human Pabpc1 At Ph 6.0 Length = 115 Back     alignment and structure
>pdb|4F25|A Chain A, Crystal Structure Of The Second Rrm Domain Of Human Pabpc1 At Ph 6.0 Length = 115 Back     alignment and structure
>pdb|2K8G|A Chain A, Solution Structure Of Rrm2 Domain Of Pabp1 Length = 95 Back     alignment and structure
>pdb|2K8G|A Chain A, Solution Structure Of Rrm2 Domain Of Pabp1 Length = 95 Back     alignment and structure
>pdb|2D9P|A Chain A, Solution Structure Of Rna Binding Domain 4 In Polyadenylation Binding Protein 3 Length = 103 Back     alignment and structure
>pdb|2D9P|A Chain A, Solution Structure Of Rna Binding Domain 4 In Polyadenylation Binding Protein 3 Length = 103 Back     alignment and structure
>pdb|2KXF|A Chain A, Solution Structure Of The First Two Rrm Domains Of Fbp-Interacting Repressor (Fir) Length = 199 Back     alignment and structure
>pdb|2KXF|A Chain A, Solution Structure Of The First Two Rrm Domains Of Fbp-Interacting Repressor (Fir) Length = 199 Back     alignment and structure
>pdb|2QFJ|A Chain A, Crystal Structure Of First Two Rrm Domains Of Fir Bound To Ssdna From A Portion Of Fuse Length = 216 Back     alignment and structure
>pdb|2QFJ|A Chain A, Crystal Structure Of First Two Rrm Domains Of Fir Bound To Ssdna From A Portion Of Fuse Length = 216 Back     alignment and structure
>pdb|3UWT|A Chain A, Crystal Structure Of A Rna Binding Domain Of Poly-U Binding Splicing Factor 60kda (Puf60) From Homo Sapiens At 2.50 A Resolution Length = 200 Back     alignment and structure
>pdb|3UWT|A Chain A, Crystal Structure Of A Rna Binding Domain Of Poly-U Binding Splicing Factor 60kda (Puf60) From Homo Sapiens At 2.50 A Resolution Length = 200 Back     alignment and structure
>pdb|1B7F|A Chain A, Sxl-Lethal ProteinRNA COMPLEX Length = 168 Back     alignment and structure
>pdb|1B7F|A Chain A, Sxl-Lethal ProteinRNA COMPLEX Length = 168 Back     alignment and structure
>pdb|3SXL|A Chain A, Sex-Lethal Rna Recognition Domains 1 And 2 From Drosophila Melanogaster Length = 184 Back     alignment and structure
>pdb|3SXL|A Chain A, Sex-Lethal Rna Recognition Domains 1 And 2 From Drosophila Melanogaster Length = 184 Back     alignment and structure
>pdb|4EGL|A Chain A, Crystal Structure Of Two Tandem Rna Recognition Motifs Of Human Antigen R Length = 177 Back     alignment and structure
>pdb|4EGL|A Chain A, Crystal Structure Of Two Tandem Rna Recognition Motifs Of Human Antigen R Length = 177 Back     alignment and structure
>pdb|4ED5|A Chain A, Crystal Structure Of The Two N-Terminal Rrm Domains Of Hur Complexed With Rna Length = 177 Back     alignment and structure
>pdb|4ED5|A Chain A, Crystal Structure Of The Two N-Terminal Rrm Domains Of Hur Complexed With Rna Length = 177 Back     alignment and structure
>pdb|1FXL|A Chain A, Crystal Structure Of Hud And Au-Rich Element Of The C-Fos Rna Length = 167 Back     alignment and structure
>pdb|1FXL|A Chain A, Crystal Structure Of Hud And Au-Rich Element Of The C-Fos Rna Length = 167 Back     alignment and structure
>pdb|1FNX|H Chain H, Solution Structure Of The Huc Rbd1-Rbd2 Complexed With The Au-Rich Element Length = 174 Back     alignment and structure
>pdb|1FNX|H Chain H, Solution Structure Of The Huc Rbd1-Rbd2 Complexed With The Au-Rich Element Length = 174 Back     alignment and structure
>pdb|1X5T|A Chain A, Solution Structure Of The Second Rrm Domain In Splicing Factor 3b Length = 96 Back     alignment and structure
>pdb|2CJK|A Chain A, Structure Of The Rna Binding Domain Of Hrp1 In Complex With Rna Length = 167 Back     alignment and structure
>pdb|2CJK|A Chain A, Structure Of The Rna Binding Domain Of Hrp1 In Complex With Rna Length = 167 Back     alignment and structure
>pdb|3MD3|A Chain A, Crystal Structure Of The First Two Rrm Domains Of Yeast Poly Binding Protein (Pub1) Length = 166 Back     alignment and structure
>pdb|3MD3|A Chain A, Crystal Structure Of The First Two Rrm Domains Of Yeast Poly Binding Protein (Pub1) Length = 166 Back     alignment and structure
>pdb|1L3K|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 196 Back     alignment and structure
>pdb|1L3K|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 196 Back     alignment and structure
>pdb|1HA1|A Chain A, Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 Back     alignment and structure
>pdb|1HA1|A Chain A, Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 Back     alignment and structure
>pdb|1PGZ|A Chain A, Crystal Structure Of Up1 Complexed With D(Ttagggttag(6-Mi) G); A Human Telomeric Repeat Containing 6-Methyl-8-(2- Deoxy-Beta-Ribofuranosyl)isoxanthopteridine (6-Mi) Length = 195 Back     alignment and structure
>pdb|1PGZ|A Chain A, Crystal Structure Of Up1 Complexed With D(Ttagggttag(6-Mi) G); A Human Telomeric Repeat Containing 6-Methyl-8-(2- Deoxy-Beta-Ribofuranosyl)isoxanthopteridine (6-Mi) Length = 195 Back     alignment and structure
>pdb|1UP1|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 182 Back     alignment and structure
>pdb|1UP1|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 182 Back     alignment and structure
>pdb|2UP1|A Chain A, Structure Of Up1-Telomeric Dna Complex Length = 183 Back     alignment and structure
>pdb|2UP1|A Chain A, Structure Of Up1-Telomeric Dna Complex Length = 183 Back     alignment and structure
>pdb|2LYV|A Chain A, Solution Structure Of The Two Rrm Domains Of Hnrnp A1 (up1) Using Segmental Isotope Labeling Length = 197 Back     alignment and structure
>pdb|2LYV|A Chain A, Solution Structure Of The Two Rrm Domains Of Hnrnp A1 (up1) Using Segmental Isotope Labeling Length = 197 Back     alignment and structure
>pdb|2JRS|A Chain A, Solution Nmr Structure Of Caper Rrm2 Domain. Northeast Structural Genomics Target Hr4730a Length = 108 Back     alignment and structure
>pdb|1X5S|A Chain A, Solution Structure Of Rrm Domain In A18 Hnrnp Length = 102 Back     alignment and structure
>pdb|2CPZ|A Chain A, Solution Structure Of Rna Binding Domain 3 In Cug Triplet Repeat Rna-Binding Protein 1 Length = 115 Back     alignment and structure
>pdb|3SMZ|A Chain A, Human Raver1 Rrm1-3 Domains (Residues 39-320) Length = 284 Back     alignment and structure
>pdb|3H2U|B Chain B, Human Raver1 Rrm1, Rrm2, And Rrm3 Domains In Complex With Human Vinculin Tail Domain Vt Length = 283 Back     alignment and structure
>pdb|3VF0|B Chain B, Raver1 In Complex With Metavinculin L954 Deletion Mutant Length = 285 Back     alignment and structure
>pdb|1X5O|A Chain A, Solution Structure Of Rrm Domain In Rna Binding Motif, Single-Stranded Interacting Protein 1 Length = 114 Back     alignment and structure
>pdb|1FJE|B Chain B, Solution Structure Of Nucleolin Rbd12 In Complex With Snre Rna Length = 175 Back     alignment and structure
>pdb|2KHC|A Chain A, Bruno Rrm3+ Length = 118 Back     alignment and structure
>pdb|3SDE|A Chain A, Crystal Structure Of A Paraspeckle-Protein Heterodimer, Pspc1NONO Length = 261 Back     alignment and structure
>pdb|3SDE|A Chain A, Crystal Structure Of A Paraspeckle-Protein Heterodimer, Pspc1NONO Length = 261 Back     alignment and structure
>pdb|1P1T|A Chain A, Nmr Structure Of The N-Terminal Rrm Domain Of Cleavage Stimulation Factor 64 Kda Subunit Length = 104 Back     alignment and structure
>pdb|2DGV|A Chain A, Solution Structure Of The Rna Binding Domain In Heterogeneous Nuclear Ribonucleoprotein M Length = 92 Back     alignment and structure
>pdb|2DH9|A Chain A, Solution Structure Of The C-Terminal Rna Binding Domain In Heterogeneous Nuclear Ribonucleoprotein M Length = 89 Back     alignment and structure
>pdb|2DNZ|A Chain A, Solution Structure Of The Second Rna Binding Domain Of Rna Binding Motif Protein 23 Length = 95 Back     alignment and structure
>pdb|3MD1|A Chain A, Crystal Structure Of The Second Rrm Domain Of Yeast Poly(U)-Binding Protein (Pub1) Length = 83 Back     alignment and structure
>pdb|3MD1|A Chain A, Crystal Structure Of The Second Rrm Domain Of Yeast Poly(U)-Binding Protein (Pub1) Length = 83 Back     alignment and structure
>pdb|2CPF|A Chain A, Solution Structure Of The Penultimate Rna Recognition Motif Of Hypothetical Rna-Binding Protein Rbm19 Length = 98 Back     alignment and structure
>pdb|2FY1|A Chain A, A Dual Mode Of Rna Recognition By The Rbmy Protein Length = 116 Back     alignment and structure
>pdb|2G4B|A Chain A, Structure Of U2af65 Variant With Polyuridine Tract Length = 172 Back     alignment and structure
>pdb|3VAF|A Chain A, Structure Of U2af65 Variant With Bru3 Dna Length = 174 Back     alignment and structure
>pdb|2ERR|A Chain A, Nmr Structure Of The Rna Binding Domain Of Human Fox-1 In Complex With Ugcaugu Length = 109 Back     alignment and structure
>pdb|3HI9|A Chain A, The X-Ray Crystal Structure Of The First Rna Recognition Motif (Rrm1) Of The Au-Rich Element (Are) Binding Protein Hur At 2.0 Angstrom Resolution Length = 84 Back     alignment and structure
>pdb|3HI9|A Chain A, The X-Ray Crystal Structure Of The First Rna Recognition Motif (Rrm1) Of The Au-Rich Element (Are) Binding Protein Hur At 2.0 Angstrom Resolution Length = 84 Back     alignment and structure
>pdb|2CQ3|A Chain A, Solution Structure Of Rna Binding Domain In Rna Binding Motif Protein 9 Length = 103 Back     alignment and structure
>pdb|2SXL|A Chain A, Sex-Lethal Rbd1, Nmr, Minimized Average Structure Length = 88 Back     alignment and structure
>pdb|2SXL|A Chain A, Sex-Lethal Rbd1, Nmr, Minimized Average Structure Length = 88 Back     alignment and structure
>pdb|2DO0|A Chain A, Solution Structure Of The Rna Binding Domain Of Heterogeneous Nuclear Ribonucleoprotein M Length = 114 Back     alignment and structure
>pdb|2DO0|A Chain A, Solution Structure Of The Rna Binding Domain Of Heterogeneous Nuclear Ribonucleoprotein M Length = 114 Back     alignment and structure
>pdb|2KRR|A Chain A, Solution Structure Of The Rbd1,2 Domains From Human Nucleoli Length = 180 Back     alignment and structure
>pdb|1D8Z|A Chain A, Solution Structure Of The First Rna-Binding Domain (Rbd1) Of Hu Antigen C (Huc) Length = 89 Back     alignment and structure
>pdb|1D8Z|A Chain A, Solution Structure Of The First Rna-Binding Domain (Rbd1) Of Hu Antigen C (Huc) Length = 89 Back     alignment and structure
>pdb|2DGO|A Chain A, Solution Structure Of The Rna Binding Domain In Cytotoxic Granule-Associated Rna Binding Protein 1 Length = 115 Back     alignment and structure
>pdb|1WHW|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain From Hypothetical Protein Bab23448 Length = 99 Back     alignment and structure
>pdb|2JVO|A Chain A, Segmental Isotope Labeling Of Npl3 Length = 108 Back     alignment and structure
>pdb|4FXV|A Chain A, Crystal Structure Of An Elav-Like Protein 1 (Elavl1) From Homo Sapiens At 1.90 A Resolution Length = 99 Back     alignment and structure
>pdb|3SDE|B Chain B, Crystal Structure Of A Paraspeckle-Protein Heterodimer, Pspc1NONO Length = 261 Back     alignment and structure
>pdb|3SDE|B Chain B, Crystal Structure Of A Paraspeckle-Protein Heterodimer, Pspc1NONO Length = 261 Back     alignment and structure
>pdb|2DHG|A Chain A, Solution Structure Of The C-Terminal Rna Recognition Motif In Trna Selenocysteine Associated Protein Length = 104 Back     alignment and structure
>pdb|1U6F|A Chain A, Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit From Trypanosoma Cruzi Length = 139 Back     alignment and structure
>pdb|1SXL|A Chain A, Resonance Assignments And Solution Structure Of The Second Rna-Binding Domain Of Sex-Lethal Determined By Multidimensional Heteronuclear Magnetic Resonance Spectroscopy Length = 97 Back     alignment and structure
>pdb|1X4E|A Chain A, Solution Structure Of Rrm Domain In Rna Binding Motif, Single-Stranded Interacting Protein 2 Length = 85 Back     alignment and structure
>pdb|1D9A|A Chain A, Solution Structure Of The Second Rna-Binding Domain (Rbd2) Of Hu Antigen C (Huc) Length = 85 Back     alignment and structure
>pdb|1D9A|A Chain A, Solution Structure Of The Second Rna-Binding Domain (Rbd2) Of Hu Antigen C (Huc) Length = 85 Back     alignment and structure
>pdb|2FC8|A Chain A, Solution Structure Of The Rrm_1 Domain Of Ncl Protein Length = 102 Back     alignment and structure
>pdb|1FJC|A Chain A, Solution Structure Of Nucleolin Rbd2 Length = 96 Back     alignment and structure
>pdb|1HD0|A Chain A, Heterogeneous Nuclear Ribonucleoprotein D0 (Hnrnp D0 Rbd1), Nmr Length = 75 Back     alignment and structure
>pdb|1X4B|A Chain A, Solution Structure Of Rrm Domain In Heterogeneous Nuclear Ribonucleaoproteins A2B1 Length = 116 Back     alignment and structure
>pdb|2YWK|A Chain A, Crystal Structure Of Rrm-Domain Derived From Human Putative Rna-Binding Protein 11 Length = 95 Back     alignment and structure
>pdb|2DH7|A Chain A, Solution Structure Of The Second Rna Binding Domain In Nucleolysin Tiar Length = 105 Back     alignment and structure
>pdb|2OSQ|A Chain A, Nmr Structure Of Rrm-1 Of Yeast Npl3 Protein Length = 74 Back     alignment and structure
>pdb|2DNO|A Chain A, Solution Structure Of Rna Binding Domain In Trinucleotide Repeat Containing 4 Variant Length = 102 Back     alignment and structure
>pdb|2RRB|A Chain A, Refinement Of Rna Binding Domain In Human Tra2 Beta Protein Length = 96 Back     alignment and structure
>pdb|2KXN|B Chain B, Nmr Structure Of Human Tra2beta1 Rrm In Complex With Aagaac Rna Length = 129 Back     alignment and structure
>pdb|2CQ0|A Chain A, Solution Structure Of Rna Binding Domain In Eukaryotic Translation Initiation Factor 3 Subunit 4 Length = 103 Back     alignment and structure
>pdb|1X4G|A Chain A, Solution Structure Of Rrm Domain In Nucleolysin Tiar Length = 109 Back     alignment and structure
>pdb|2XS5|A Chain A, Crystal Structure Of The Rrm Domain Of Mouse Deleted In Azoospermia-Like In Complex With Mvh Rna, Uguuc Length = 87 Back     alignment and structure
>pdb|2XS2|A Chain A, Crystal Structure Of The Rrm Domain Of Mouse Deleted In Azoospermia-Like In Complex With Rna, Uuguucuu Length = 102 Back     alignment and structure
>pdb|2XSF|A Chain A, Crystal Structure Of The Rrm Domain Of Mouse Deleted In Azoospermia-Like Length = 89 Back     alignment and structure
>pdb|2KU7|A Chain A, Solution Structure Of Mll1 Phd3-Cyp33 Rrm Chimeric Protein Length = 140 Back     alignment and structure
>pdb|3CW1|K Chain K, Crystal Structure Of Human Spliceosomal U1 Snrnp Length = 216 Back     alignment and structure
>pdb|2CQB|A Chain A, Solution Structure Of The Rna Recognition Motif In Peptidyl- Prolyl Cis-Trans Isomerase E Length = 102 Back     alignment and structure
>pdb|1NO8|A Chain A, Solution Structure Of The Nuclear Factor Aly Rbd Domain Length = 106 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query336
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 1e-92
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 1e-54
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 6e-84
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 3e-73
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 1e-31
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 3e-82
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 4e-42
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 1e-35
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 1e-73
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 1e-35
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 9e-28
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 9e-69
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 2e-58
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 3e-27
4f02_A 213 Polyadenylate-binding protein 1; mRNA, eukaryotic 1e-04
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 3e-59
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 1e-39
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 4e-25
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 3e-59
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 1e-54
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 7e-42
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 8e-59
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 6e-44
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 1e-39
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 6e-54
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 8e-36
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 1e-08
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-52
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-48
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-32
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 1e-50
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 6e-45
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 2e-37
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 7e-50
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 2e-33
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 5e-23
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 1e-46
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 2e-34
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 2e-23
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 6e-39
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 7e-22
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 2e-06
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 5e-38
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 2e-22
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 2e-14
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 6e-37
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 3e-24
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 3e-35
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 4e-26
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 5e-35
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 4e-26
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 2e-16
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 2e-34
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 1e-19
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 5e-17
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 4e-34
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 5e-27
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 5e-07
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 3e-33
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 3e-24
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 6e-33
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 2e-25
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 4e-11
1x5o_A114 RNA binding motif, single-stranded interacting pro 3e-32
1x5o_A114 RNA binding motif, single-stranded interacting pro 8e-28
1x5o_A114 RNA binding motif, single-stranded interacting pro 3e-21
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 1e-31
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 3e-21
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 3e-06
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 3e-31
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 7e-20
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 6e-31
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 6e-18
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 2e-04
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 7e-31
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 2e-18
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 3e-09
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 9e-31
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 3e-23
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 1e-13
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 8e-30
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 2e-19
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 2e-29
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 8e-19
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 1e-15
2kt5_A124 RNA and export factor-binding protein 2; chaperone 6e-29
2kt5_A124 RNA and export factor-binding protein 2; chaperone 2e-21
2kt5_A124 RNA and export factor-binding protein 2; chaperone 2e-12
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 5e-28
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 7e-24
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 1e-17
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 8e-28
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 1e-21
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 9e-10
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 3e-27
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 2e-26
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 2e-06
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 2e-26
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 7e-20
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 8e-14
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 5e-26
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 1e-19
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 1e-06
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 6e-26
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 9e-20
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 3e-09
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 9e-26
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 2e-19
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 6e-09
2f3j_A177 RNA and export factor binding protein 2; RRM domai 2e-25
2f3j_A177 RNA and export factor binding protein 2; RRM domai 5e-19
2f3j_A177 RNA and export factor binding protein 2; RRM domai 4e-15
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 4e-25
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 2e-17
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 1e-14
1x4e_A85 RNA binding motif, single-stranded interacting pro 1e-24
1x4e_A85 RNA binding motif, single-stranded interacting pro 3e-17
1x4e_A85 RNA binding motif, single-stranded interacting pro 2e-07
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 2e-24
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 8e-23
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 3e-08
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 7e-24
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-18
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 4e-07
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 9e-24
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 2e-15
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 5e-07
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 1e-23
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 1e-18
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 4e-05
2cpj_A99 Non-POU domain-containing octamer-binding protein; 1e-23
2cpj_A99 Non-POU domain-containing octamer-binding protein; 5e-14
2cpj_A99 Non-POU domain-containing octamer-binding protein; 1e-05
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 1e-23
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 3e-14
1x5p_A97 Negative elongation factor E; structure genomics, 1e-22
1x5p_A97 Negative elongation factor E; structure genomics, 6e-15
1x5p_A97 Negative elongation factor E; structure genomics, 9e-08
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 1e-22
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 9e-16
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 5e-04
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 2e-22
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 3e-17
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 2e-06
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 4e-22
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 5e-14
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 1e-05
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 6e-22
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 2e-16
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 1e-04
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 1e-21
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 2e-17
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 1e-04
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 4e-21
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 3e-14
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 3e-04
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 6e-21
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 9e-16
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 7e-21
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 4e-14
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 2e-04
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 1e-20
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 9e-17
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 6e-04
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 1e-20
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 1e-16
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 4e-06
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 9e-06
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 2e-20
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 5e-16
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 2e-05
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 4e-20
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 1e-13
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 5e-20
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 3e-11
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 7e-20
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 1e-15
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 9e-08
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 3e-05
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 8e-20
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 6e-15
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 6e-04
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 1e-19
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 2e-13
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 2e-05
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 1e-19
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 3e-15
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 2e-19
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 2e-13
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 2e-19
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 2e-13
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 1e-06
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 5e-05
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 4e-19
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 6e-13
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 3e-04
3q2s_C229 Cleavage and polyadenylation specificity factor S; 5e-19
3q2s_C229 Cleavage and polyadenylation specificity factor S; 2e-15
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 7e-19
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 9e-14
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 1e-18
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 4e-13
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 3e-04
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 1e-18
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 1e-13
2cph_A107 RNA binding motif protein 19; RNA recognition moti 1e-18
2cph_A107 RNA binding motif protein 19; RNA recognition moti 1e-11
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 1e-18
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 4e-13
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 2e-04
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 2e-18
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 1e-13
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 2e-18
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 3e-14
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 1e-04
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 2e-18
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 2e-13
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 5e-18
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 2e-14
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 3e-04
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 6e-18
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 2e-13
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 7e-18
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 3e-14
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 5e-04
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 9e-18
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 1e-10
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 1e-17
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 2e-13
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 1e-17
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 2e-13
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 7e-04
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-17
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-14
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 7e-05
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 2e-17
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 4e-14
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 1e-09
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 2e-05
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 2e-17
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 6e-13
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 4e-17
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 2e-12
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 5e-17
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 6e-11
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 5e-17
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 3e-12
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 6e-17
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 2e-15
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 2e-07
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 1e-04
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 7e-17
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 5e-13
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 8e-17
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 4e-11
3p5t_L90 Cleavage and polyadenylation specificity factor S; 8e-17
3p5t_L90 Cleavage and polyadenylation specificity factor S; 9e-13
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 8e-17
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 6e-13
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 9e-17
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 9e-09
3n9u_C156 Cleavage and polyadenylation specificity factor S; 1e-16
3n9u_C156 Cleavage and polyadenylation specificity factor S; 5e-13
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 1e-16
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 3e-12
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 2e-16
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 1e-12
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 3e-05
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 2e-16
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 3e-11
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 4e-16
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 4e-11
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 5e-16
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 2e-13
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 7e-16
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 3e-08
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 8e-16
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 1e-11
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 9e-16
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 1e-09
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 1e-15
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 4e-09
2cqd_A116 RNA-binding region containing protein 1; RNA recog 1e-15
2cqd_A116 RNA-binding region containing protein 1; RNA recog 4e-12
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 1e-15
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 1e-11
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 7e-05
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 2e-15
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 9e-09
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 2e-15
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 3e-10
2div_A99 TRNA selenocysteine associated protein; structural 3e-15
2div_A99 TRNA selenocysteine associated protein; structural 7e-12
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 3e-15
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 6e-13
2i2y_A150 Fusion protein consists of immunoglobin G- binding 5e-15
2i2y_A150 Fusion protein consists of immunoglobin G- binding 1e-08
2i2y_A150 Fusion protein consists of immunoglobin G- binding 5e-07
2la6_A99 RNA-binding protein FUS; structural genomics, nort 7e-15
2la6_A99 RNA-binding protein FUS; structural genomics, nort 3e-10
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 1e-14
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 1e-10
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 1e-14
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 1e-10
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 2e-14
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 3e-08
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 2e-14
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 2e-11
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 3e-14
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 6e-10
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 3e-14
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 5e-09
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 4e-14
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 3e-06
2krb_A81 Eukaryotic translation initiation factor 3 subunit 4e-14
2krb_A81 Eukaryotic translation initiation factor 3 subunit 3e-08
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 5e-14
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 2e-06
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 7e-14
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 9e-10
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 1e-13
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 6e-11
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 1e-13
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 2e-08
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 1e-13
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 7e-10
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 2e-13
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 2e-08
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 2e-13
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 7e-08
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 2e-13
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 9e-08
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 3e-13
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 1e-05
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 4e-13
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 2e-11
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 7e-04
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 5e-13
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 4e-08
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 6e-13
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 5e-08
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 1e-12
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 3e-07
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 2e-12
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 1e-07
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 3e-12
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 1e-10
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 5e-12
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 1e-08
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 5e-12
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 5e-09
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 7e-12
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 5e-11
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 9e-12
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 3e-09
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 9e-12
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 4e-08
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 2e-11
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 1e-06
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 2e-11
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 4e-07
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 3e-11
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 3e-09
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 3e-11
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 2e-08
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 3e-11
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 2e-08
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 4e-11
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 2e-08
2dis_A109 Unnamed protein product; structural genomics, RRM 4e-11
2dis_A109 Unnamed protein product; structural genomics, RRM 4e-09
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 1e-10
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 7e-08
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 2e-10
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 1e-09
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 5e-10
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 4e-09
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 1e-09
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 8e-09
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 3e-09
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 5e-06
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 3e-09
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 4e-07
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 3e-09
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 8e-09
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 6e-04
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 1e-08
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 2e-06
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 2e-08
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 4e-06
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 2e-08
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 4e-08
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 4e-08
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 2e-06
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 5e-08
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 4e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 1e-07
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 2e-07
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 2e-07
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 8e-07
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 3e-07
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 2e-06
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 6e-07
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 1e-06
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 2e-06
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 1e-06
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 3e-06
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 2e-05
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 1e-05
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 1e-04
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 2e-05
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 1e-04
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 2e-05
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 3e-04
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 2e-05
2dnl_A114 Cytoplasmic polyadenylation element binding protei 2e-05
2dnl_A114 Cytoplasmic polyadenylation element binding protei 5e-05
2dit_A112 HIV TAT specific factor 1 variant; structural geno 1e-04
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 2e-04
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 2e-04
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 4e-04
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 5e-04
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 7e-04
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
 Score =  276 bits (709), Expect = 1e-92
 Identities = 50/267 (18%), Positives = 96/267 (35%), Gaps = 41/267 (15%)

Query: 76  DTERALDTMNFDALKGRPIRIMWSQRDPS---LRKSGVGNVFIKNLDKSIDNKAMYDTFS 132
           D++R LD       +G P     + +  +    R   +  V +KNL KS +   +Y  F 
Sbjct: 11  DSKRPLD-------EGSPAAAGLTSKKANEALTRNRELTTVLVKNLPKSYNQNKVYKYFK 63

Query: 133 AFGSILSCKVAQDEQGNSKGYGFVHFETEEAANKSIEKVNGMLLNSKIVFVGKFIPRKER 192
             G I+   VA      +  +  + F   + A  +I K + + +    + V         
Sbjct: 64  HCGPIIHVDVADSL-KKNFRFARIEFARYDGALAAITKTHKV-VGQNEIIVSHLT----- 116

Query: 193 EKELGEKAKLFTNVYIKNFGEDFNDEKLKEMFEPYGTITSYRVM--NNDGKSRGFGFVAY 250
                        +++ NF   +    ++++ +    +     +       SR F ++  
Sbjct: 117 ----------ECTLWMTNFPPSYTQRNIRDLLQDINVVALSIRLPSLRFNTSRRFAYIDV 166

Query: 251 ESPEFAEKAVQAWNGKEVDGKILYVGRAQKKAERTQELKRRFEMLKIERLNRYQGVNLYV 310
            S E A   V+  NG +++G  L             ++    E  K       +G  + +
Sbjct: 167 TSKEDARYCVEKLNGLKIEGYTLVT-----------KVSNPLEKSKRTDSATLEGREIMI 215

Query: 311 KNLDDSIDDER-LRKEFTPFGTITSAK 336
           +NL   + DE  LR+ F  FG+I    
Sbjct: 216 RNLSTELLDENLLRESFEGFGSIEKIN 242


>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Length = 240 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Length = 240 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Length = 104 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Length = 104 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Length = 105 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Length = 105 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Length = 114 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query336
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 100.0
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 100.0
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 100.0
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 100.0
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 100.0
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 100.0
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 100.0
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 100.0
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 100.0
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 100.0
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 100.0
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 100.0
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 100.0
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 100.0
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 100.0
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 100.0
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 100.0
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.98
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.97
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.97
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.97
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.97
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.97
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.97
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.97
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.97
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.97
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.97
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.97
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.97
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.96
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.96
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.96
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.96
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.96
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.96
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.89
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.89
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.87
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.87
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.85
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.84
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.82
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.81
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.77
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.77
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.77
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.76
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.75
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.75
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.75
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.75
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.75
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.75
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.75
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.75
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.75
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.74
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.74
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.74
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.74
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.73
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.73
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.73
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.73
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.73
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.73
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.73
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.73
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.73
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.73
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.73
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.73
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.73
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.73
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.72
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.72
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.72
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.72
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.72
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.72
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.72
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.72
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.72
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.72
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.72
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.72
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.72
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.72
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.72
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.71
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.71
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.71
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.71
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.71
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.71
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.71
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.71
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.71
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.71
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.71
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.71
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.71
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.71
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.71
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.71
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.71
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.71
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.71
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.71
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.71
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.71
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.71
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.71
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.71
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.7
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.7
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.7
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.7
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.7
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.7
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.7
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.7
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.7
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.7
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.7
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.7
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.7
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.7
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.7
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.7
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.7
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.7
2div_A99 TRNA selenocysteine associated protein; structural 99.7
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.7
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.7
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.69
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.69
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.69
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.69
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.69
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.69
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.69
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.69
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.69
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.69
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.69
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.69
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.69
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.69
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.69
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.69
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.69
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.69
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.69
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.69
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.69
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.68
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.68
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.68
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.68
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.68
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.68
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.68
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.68
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.68
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.68
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.68
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.68
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.68
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.68
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.68
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.68
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.68
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.68
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.68
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.68
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.68
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.68
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.68
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.68
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.68
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.67
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.67
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.67
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.67
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.67
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.67
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.67
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.67
2div_A99 TRNA selenocysteine associated protein; structural 99.67
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.67
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.67
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.67
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.67
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.67
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.67
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.67
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.67
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.67
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.67
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.67
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.67
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.67
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.67
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.66
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.66
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.66
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.66
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.66
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.66
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.66
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.66
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.66
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.66
2dis_A109 Unnamed protein product; structural genomics, RRM 99.66
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.66
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.66
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.66
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.66
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.66
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.66
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.66
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.66
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.65
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.65
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.65
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.65
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.65
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.65
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.65
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.65
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.65
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.65
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.65
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.65
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.65
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.65
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.65
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.65
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.65
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.65
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.65
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.65
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.64
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.64
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.64
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.64
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.64
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.64
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.64
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.64
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.64
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.64
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.64
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.64
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.64
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.64
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.64
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.64
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.64
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.64
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.64
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.63
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.63
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.63
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.63
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.63
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.63
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.63
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.63
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.63
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.63
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.63
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.63
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.63
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.63
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.63
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.63
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.63
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.63
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.63
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.63
2dis_A109 Unnamed protein product; structural genomics, RRM 99.63
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.62
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.62
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.62
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.62
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.62
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.62
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.62
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.62
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.62
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.62
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.61
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.61
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.6
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.6
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.6
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.6
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.6
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.6
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.6
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.6
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.6
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.59
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.59
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.59
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.59
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.59
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.59
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.59
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.59
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.59
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.59
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.59
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.58
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.58
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.58
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.58
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.58
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.36
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.58
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.58
1x5p_A97 Negative elongation factor E; structure genomics, 99.58
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.57
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.57
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.57
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.35
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.57
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.57
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.57
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.57
1x5p_A97 Negative elongation factor E; structure genomics, 99.56
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.56
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.56
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.56
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.56
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.56
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.56
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.55
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.55
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.54
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.54
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.54
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.54
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.54
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.53
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.52
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.52
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.52
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.5
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.49
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.49
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.49
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.49
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.48
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.47
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.46
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.44
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.42
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.42
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.42
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.41
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.4
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.34
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.33
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.27
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 99.24
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.23
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.21
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 99.19
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 99.05
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 99.04
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 98.92
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 98.87
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.81
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.8
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.71
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.67
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.63
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.48
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 98.35
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 98.09
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 98.01
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 97.76
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 97.7
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 97.46
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 97.46
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 97.45
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 97.19
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 96.98
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 96.91
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 96.84
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 96.75
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 96.37
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 96.29
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 95.67
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 95.52
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 95.14
3d45_A507 Poly(A)-specific ribonuclease PARN; CAP analogue, 86.07
4eyt_A129 Telomerase associated protein P65; RNA, LA protein 81.94
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
Probab=100.00  E-value=1.1e-46  Score=330.60  Aligned_cols=253  Identities=20%  Similarity=0.273  Sum_probs=226.3

Q ss_pred             cccCceeeeecCchhhhhhhHHhhhcccCCceEEEeCCCCcccccCCceEEEEEeCCcchhhHHHHHhhcCccccCCeee
Q psy12549         15 IIPKHNVATRELSAKVVEGVSRSLSSLIDGNTVKYDWDSGYTCHQLGSGAILVQLGQPYMLDTERALDTMNFDALKGRPI   94 (336)
Q Consensus        15 ~~p~~~v~v~~lp~~~~e~~l~~~f~~~~~~~v~~~~~~~~~~~g~~~g~afV~f~~~~~~~A~~A~~~~~~~~~~g~~i   94 (336)
                      ..++++|||+|||+++|+++|+++|+..++.++.+         +.++|||||+|.++  ++|++|++.+++..+.|++|
T Consensus        19 ~~~~~~l~V~nLp~~~te~~l~~~F~~~Gi~~~~~---------~~~~g~afV~f~~~--~~A~~A~~~l~~~~~~g~~i   87 (284)
T 3smz_A           19 FRNRRKILIRGLPGDVTNQEVHDLLSDYELKYCFV---------DKYKGTAFVTLLNG--EQAEAAINAFHQSRLREREL   87 (284)
T ss_dssp             HHCCCEEEEECCCTTCCHHHHHHHTTTSCEEEEEE---------ETTTTEEEEEESSH--HHHHHHHHHHTTCEETTEEC
T ss_pred             CCCCCEEEEeCCCCCCCHHHHHHHHHHcCCEEEEE---------ecCCCEEEEEeCCH--HHHHHHHHHcCCCeeCCeEE
Confidence            45788999999999999999999995555777766         34678999999999  99999999999999999999


Q ss_pred             EEEeccCCCCcCCCCCceEEEcCCCCCCCHHHHHHHhhccCCeeEEEEeeCC-CCCcccEEEEEeCCHHHHHHHHHHhCC
Q psy12549         95 RIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKAMYDTFSAFGSILSCKVAQDE-QGNSKGYGFVHFETEEAANKSIEKVNG  173 (336)
Q Consensus        95 ~v~~~~~~~~~~~~~~~~l~v~nlp~~~t~~~l~~~f~~~G~v~~~~~~~~~-~~~~~g~afV~F~~~~~a~~a~~~l~~  173 (336)
                      .|.++..        .++|||+|||.++++++|+++|+.||.|..+.++.++ +|.++|||||+|.+.++|.+|+..|+|
T Consensus        88 ~v~~~~~--------~~~l~v~nlp~~~t~~~l~~~f~~~G~i~~~~i~~~~~~g~~~g~afV~f~~~~~a~~A~~~l~~  159 (284)
T 3smz_A           88 SVQLQPT--------DALLCVANLPPSLTQQQFEELVRPFGSLERCFLVYSERTGQSKGYGFAEYMKKDSAARAKSDLLG  159 (284)
T ss_dssp             EEEECCC--------SCEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHHHHTT
T ss_pred             EEEecCC--------CCEEEEcCCCCcCCHHHHHHHHHhcCCeeEEEEEeeCCCCccceEEEEEECCHHHHHHHHHHhCC
Confidence            9999643        3689999999999999999999999999999999987 889999999999999999999999999


Q ss_pred             ceeCCeEEEEeeccCchhhhHhhhccccccceEEEcCCCCCC-cHHHHHHhhccCCceeEEEEeC-CCCccceEEEEEeC
Q psy12549        174 MLLNSKIVFVGKFIPRKEREKELGEKAKLFTNVYIKNFGEDF-NDEKLKEMFEPYGTITSYRVMN-NDGKSRGFGFVAYE  251 (336)
Q Consensus       174 ~~~~~~~i~v~~~~~~~~~~~~~~~~~~~~~~l~V~nlp~~~-t~~~l~~~f~~~g~i~~~~i~~-~~~~~~g~afV~F~  251 (336)
                      ..+.|+.|.|.++.+....     ......++|||+|||..+ ++++|+++|+.||.|..+.+.. .+|.++|+|||+|.
T Consensus       160 ~~~~g~~i~v~~a~~~~~~-----~~~~~~~~l~v~nlp~~~~~~~~l~~~f~~~G~i~~v~i~~~~~g~~~g~afV~f~  234 (284)
T 3smz_A          160 KPLGPRTLYVHWTDAGQLT-----PALLHSRCLCVDRLPPGFNDVDALCRALSAVHSPTFCQLACGQDGQLKGFAVLEYE  234 (284)
T ss_dssp             CEETTEECEEEECCGGGCC-----TTTTSCSEEEEECCCTTCCCHHHHHHHTCSSSCCSEEEEEECSSCCEEEEEEEECS
T ss_pred             CEeCCcEEEEEECCCCCCC-----cccCCccEEEEecCCcccCCHHHHHHHhhCCCCeEEEEEEECCCCCcccEEEEEeC
Confidence            9999999999998765432     122345789999999995 9999999999999999999887 77889999999999


Q ss_pred             CHHHHHHHHHHhCCceecCEEEEEeecccchhhHHHHHHH
Q psy12549        252 SPEFAEKAVQAWNGKEVDGKILYVGRAQKKAERTQELKRR  291 (336)
Q Consensus       252 ~~~~a~~a~~~l~g~~~~g~~l~v~~~~~~~~~~~~~~~~  291 (336)
                      +.++|.+|+..|||..++|+.|.|.|+.++..........
T Consensus       235 ~~~~A~~A~~~l~g~~~~g~~l~v~~a~~~~~~~~~~~~~  274 (284)
T 3smz_A          235 TAEMAEEAQQQADGLSLGGSHLRVSFCAPGPPGRSMLAAL  274 (284)
T ss_dssp             SHHHHHHHHHHHTTCEETTEECEEEECCSSSCHHHHHHHH
T ss_pred             CHHHHHHHHHHhCCCccCCeEEEEEEecCCCcccchhhhh
Confidence            9999999999999999999999999999887765554443



>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} Back     alignment and structure
>4eyt_A Telomerase associated protein P65; RNA, LA protein, LARP7, RRM, XRRM, RNA binding protein; 2.50A {Tetrahymena thermophila} PDB: 4erd_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 336
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 1e-22
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 2e-09
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 1e-08
d1u1qa_ 183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 0.003
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 6e-20
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 7e-18
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 4e-19
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 5e-15
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 1e-15
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 5e-11
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 1e-15
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 2e-10
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 1e-15
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 1e-11
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 1e-04
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 0.001
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 3e-15
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 7e-12
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 3e-15
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 2e-11
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 3e-04
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 5e-15
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 6e-10
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 5e-15
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 6e-10
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 0.002
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 6e-15
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-11
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 2e-14
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 6e-10
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 2e-14
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 5e-11
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 6e-04
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 3e-14
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 3e-10
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 4e-14
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 3e-09
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 8e-14
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 4e-09
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 0.003
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 1e-13
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 4e-09
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 2e-13
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 3e-09
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 2e-13
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 1e-08
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 2e-04
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 2e-13
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 7e-10
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 0.001
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 3e-13
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 2e-10
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 5e-13
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 5e-09
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 5e-13
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 5e-09
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 5e-13
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 9e-12
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 6e-13
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 3e-11
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 0.003
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 1e-12
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 1e-09
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 1e-12
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 2e-08
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 1e-12
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 9e-10
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 2e-12
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 1e-07
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 2e-12
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 2e-07
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 2e-12
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 5e-08
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 2e-12
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 4e-09
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 3e-12
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 3e-09
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 3e-12
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 1e-09
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 3e-12
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 6e-12
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 3e-12
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 8e-10
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 5e-12
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 1e-09
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 6e-12
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 4e-09
d1owxa_113 d.58.7.1 (A:) Lupus LA protein {Human (Homo sapien 6e-12
d1owxa_113 d.58.7.1 (A:) Lupus LA protein {Human (Homo sapien 6e-07
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 7e-12
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 3e-07
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 7e-12
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 2e-10
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 7e-12
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 2e-07
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 1e-11
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 2e-10
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 3e-11
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-08
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 3e-11
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 4e-09
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 3e-11
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 3e-08
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 4e-11
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 4e-07
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 1e-10
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 2e-10
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 1e-10
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 4e-08
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 7e-04
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 1e-10
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 1e-08
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 1e-10
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 8e-09
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 2e-10
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 2e-10
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 3e-05
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 4e-10
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 6e-07
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 5e-10
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 5e-05
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 0.002
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 5e-10
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 7e-07
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 7e-10
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 4e-06
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 7e-10
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 5e-08
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 1e-09
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 7e-07
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 5e-09
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 3e-06
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 8e-09
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 1e-05
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 9e-09
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 4e-04
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 1e-08
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 0.001
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 3e-08
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 2e-05
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 4e-08
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 1e-04
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 4e-08
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 1e-05
d1whxa_111 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 1e-07
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 2e-07
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 0.002
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 2e-07
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 5e-04
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 2e-07
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 1e-06
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 3e-07
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 6e-05
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 3e-07
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 2e-04
d1x4da189 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [ 4e-07
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 7e-07
d1weza_102 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-06
d1wi6a175 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 3e-06
d1wi6a175 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 0.004
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 3e-06
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 7e-04
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 4e-06
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 0.003
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 4e-06
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 7e-05
d2b0ga183 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosoph 2e-05
d2b0ga183 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosoph 0.001
d3begb187 d.58.7.1 (B:121-207) Splicing factor, arginine/ser 2e-05
d3begb187 d.58.7.1 (B:121-207) Splicing factor, arginine/ser 0.002
d1x4fa199 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) 3e-05
d2cq1a188 d.58.7.1 (A:51-138) Polypyrimidine tract-binding p 5e-05
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 3e-04
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 91.2 bits (225), Expect = 1e-22
 Identities = 43/188 (22%), Positives = 77/188 (40%), Gaps = 13/188 (6%)

Query: 101 RDPS-LRKSGVGNVFIKNLDKSIDNKAMYDTFSAFGSILSCKVAQDEQ-GNSKGYGFVHF 158
           ++P  LRK     +FI  L     ++++   F  +G++  C V +D     S+G+GFV +
Sbjct: 1   KEPEQLRK-----LFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTY 55

Query: 159 ETEEAANKSIEKVNGMLLNSKIVFVGKFIPRKEREKELGEKAKLFTNVYIKNFGEDFNDE 218
            T E  + ++      +    +            + +          +++    ED  + 
Sbjct: 56  ATVEEVDAAMNARPHKVDGRVVEP---KRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEH 112

Query: 219 KLKEMFEPYGTITSYRVM--NNDGKSRGFGFVAYESPEFAEKAVQAWNGKEVDGKILYVG 276
            L++ FE YG I    +M     GK RGF FV ++  +  +K V       V+G    V 
Sbjct: 113 HLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQ-KYHTVNGHNCEVR 171

Query: 277 RAQKKAER 284
           +A  K E 
Sbjct: 172 KALSKQEM 179


>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Length = 83 Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Length = 83 Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query336
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.98
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.97
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.82
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.81
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.81
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.81
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.81
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.81
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.8
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.8
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.8
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.8
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.8
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.8
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.79
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.79
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.79
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.78
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.78
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.78
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.78
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.78
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.78
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.78
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.78
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.78
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.78
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.78
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.78
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.78
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.78
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.78
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.78
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.78
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.78
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.77
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.77
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.77
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.77
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.77
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.77
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.76
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.76
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.76
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.76
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.76
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.76
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.76
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.75
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.75
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.75
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.75
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.75
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.75
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.75
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.75
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.75
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.75
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.75
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.75
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.75
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.75
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.75
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.74
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.74
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.74
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.74
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.74
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.73
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.73
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.73
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.73
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.73
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.73
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.73
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.73
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.72
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.72
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.72
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.72
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.72
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.72
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.72
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.72
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.72
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.71
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.71
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.71
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.71
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.71
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.7
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.7
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.7
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.7
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.7
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.7
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.7
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.7
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.7
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.69
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.69
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.69
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.69
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.69
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.69
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.69
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.68
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.68
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.68
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.68
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.68
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.68
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.68
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.68
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.68
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.67
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.67
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.67
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.67
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.66
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.66
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.66
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.66
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.66
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.66
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.66
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.66
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.66
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.65
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.65
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.65
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.65
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.65
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.65
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.65
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.64
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.64
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.64
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.64
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.64
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.63
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.63
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.63
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.63
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.63
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.62
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.62
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.62
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.61
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.61
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.6
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.6
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.59
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.58
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.58
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.58
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.54
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.54
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.51
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.51
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.51
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.49
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.48
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.43
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.43
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.4
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.38
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.37
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.33
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.32
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.32
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.22
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 97.78
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 97.76
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 97.73
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 97.57
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 97.51
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 97.48
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 95.44
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 95.07
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.98  E-value=5.3e-31  Score=213.75  Aligned_cols=171  Identities=24%  Similarity=0.494  Sum_probs=150.6

Q ss_pred             CceEEEcCCCCCCCHHHHHHHhhccCCeeEEEEeeCC-CCCcccEEEEEeCCHHHHHHHHHHhCCceeCCeEEEEeeccC
Q psy12549        110 VGNVFIKNLDKSIDNKAMYDTFSAFGSILSCKVAQDE-QGNSKGYGFVHFETEEAANKSIEKVNGMLLNSKIVFVGKFIP  188 (336)
Q Consensus       110 ~~~l~v~nlp~~~t~~~l~~~f~~~G~v~~~~~~~~~-~~~~~g~afV~F~~~~~a~~a~~~l~~~~~~~~~i~v~~~~~  188 (336)
                      .++|||+|||+++|+++|+++|++||.|..+.++.+. +|.++|||||+|.+.++|.+|+. +++..+.++.+.+.+..+
T Consensus         6 ~r~lfV~nLp~~~te~~L~~~F~~~G~v~~~~~~~~~~~~~~~g~afv~f~~~~~a~~a~~-~~~~~~~~~~~~~~~~~~   84 (183)
T d1u1qa_           6 LRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMN-ARPHKVDGRVVEPKRAVS   84 (183)
T ss_dssp             HHEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHH-TCSCEETTEECEEEECCC
T ss_pred             CCEEEEECCCCCCCHHHHHHHHHHcCCEEEEEeeecccCCCccCceecccCCHHHHHHHHH-hcCCcccccchhhhhhhh
Confidence            3789999999999999999999999999999999986 78899999999999999999999 577788888888877765


Q ss_pred             chhhhHhhhccccccceEEEcCCCCCCcHHHHHHhhccCCceeEEEEeC--CCCccceEEEEEeCCHHHHHHHHHHhCCc
Q psy12549        189 RKEREKELGEKAKLFTNVYIKNFGEDFNDEKLKEMFEPYGTITSYRVMN--NDGKSRGFGFVAYESPEFAEKAVQAWNGK  266 (336)
Q Consensus       189 ~~~~~~~~~~~~~~~~~l~V~nlp~~~t~~~l~~~f~~~g~i~~~~i~~--~~~~~~g~afV~F~~~~~a~~a~~~l~g~  266 (336)
                      .......  ......++|||+|||..+++++|+++|+.||.|..+.+..  .+|.++|+|||+|.++++|.+|++ +++.
T Consensus        85 ~~~~~~~--~~~~~~~~i~V~~lp~~~te~~L~~~f~~~G~v~~~~i~~~~~~~~~~g~~fV~f~~~e~A~~Al~-~~~~  161 (183)
T d1u1qa_          85 REDSQRP--GAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVI-QKYH  161 (183)
T ss_dssp             TTGGGST--TTTCCCSEEEEECCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESCHHHHHHHHT-SSCE
T ss_pred             ccccccc--ccccccceeEEccCCCcCCHHHHhhhhccCCceeeeeeecccccCccceeEEEEECCHHHHHHHHH-hCCC
Confidence            5443322  2233447899999999999999999999999999998886  668899999999999999999997 7999


Q ss_pred             eecCEEEEEeecccchhh
Q psy12549        267 EVDGKILYVGRAQKKAER  284 (336)
Q Consensus       267 ~~~g~~l~v~~~~~~~~~  284 (336)
                      .+.|+.|+|.+|.++.+.
T Consensus       162 ~~~G~~i~V~~A~~k~e~  179 (183)
T d1u1qa_         162 TVNGHNCEVRKALSKQEM  179 (183)
T ss_dssp             EETTEEEEEEECCCHHHH
T ss_pred             eECCEEEEEEecCCcccc
Confidence            999999999999887544



>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure