Psyllid ID: psy12711

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------64
MLIEYLDSKILKKYRFQLFHSERQDNTSSTSTSIHRSKVQVQLLYMTEEQQLKPGLEQWCFCFSIPTSTSSVNTSLCINYMESKQLENSSPVWELRDNTLNVKPNCRTFVFEKEGHTFGSVITHILQSYPEVDFAGYSVPHPADFQIFIRIQVKDGYDSIDILKKGIKELESACDRITETFNDAMQCKVILKLTLLVIQKASKNLRVLVIGSQKHSMMQCRNMDSNHDVEKYRYEDSMDYIKIPIEAIRPKTRQVLNDKLCDIKQLMSPENYQRDYRGLADLMDIKAPPNPNCEDLMKKMFEDWTKSSTLDRSVFNIATFLHFLECIDRFDVYDDCIGFIEEDCLYYENTRLGNSISKNGACMDDPSVITIEDVKSLNLGCGLAHYDALLLYDEADFDLAKQFNTQLNKMGFTVCDKDNSFLTGQFEHSAFIQVMDRCTCVIVLMSTHFMNNSLLHSLTQYAEAKHIDHTIHSKIIPILCSDDYFSVGFLQYCVKLKLNHYASNMEQFWDRLYYSLKGVGKGVPEWDFASNMEQFWDRLYYSLKGVGKGSQKQAIQFQTTPTSMPVAPPDYTLSQQAVAPPDYTLPQQATNSQSITNNMSEEKKDSMKKPMLMLTLQNGIRNTLKVFKPNKKKTKALCS
cHHHHHHHHHHHHHHHHHccccccccccccccHHccccccEEEEEEHHHHHcccccccccccccccccccccccccccccccccccccccccEEEEEccccccccEEEEEEccccccHHHHHHHHHHHcccEEEEEccccccccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccEEcccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHccccHHHHccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccEEEEEEEccccHHHHHHHHHHccccccEEEEEcccccccccHHHHHHHHHHHccEEEEEEcccccccHHHHHHHHHHHHHcccccccEEEEEEEcccccccHHccccEEEEccccccccHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccEEEEEEcccccccEEEEcccccccccccc
cHHHHHHHHHHHHHHHEEEcccccccccccccccccccEEEEEEEEcHHHHcccccccccccccccccccccccHHccccccHHHHccccccEEEEccccccccccEEEEEEcccccHHHHHHHHHHccccEEEEEEcccccccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEHccHHcEEEEccccccccEEEEEEccccccccccEEEccHHHHHHHHHHcccccEccccccccccHHHHHHHcccccccccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHccccHHHcHHHHHHHHHHHHHHHHccccccccccccccccEEEHcHHHHHHcccccHHHHHEEEEcHHHHHHHHHHHHHHHHcccEEEEcccccccccHHHHHHHHHHHHccEEEEEEcHHHHcccHHHHHHHHHHHHHHHHHHHccEcEEEEEcccccccHEEEEEEccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccccccHEEEEEcccccccccccccccccHcccccccccccccccccccccccccHHcccccccHHHHHHHHHcHHHHHEEccccccccHHccc
MLIEYLDSKILKKYRFQLFhserqdntsststsiHRSKVQVQLLYMTEeqqlkpgleqwcfcfsiptstssvnTSLCINYMeskqlensspvwelrdntlnvkpncrtfvfekeghtfGSVITHILqsypevdfagysvphpadfqIFIRIQVKDGYDSIDILKKGIKELESACDRITETFNDAMQCKVILKLTLLVIQKASKNLRVLVIGSqkhsmmqcrnmdsnhdvekyryedsmdyikipieairpkTRQVLNDKLcdikqlmspenyqrDYRGLadlmdikappnpnceDLMKKMFEDwtksstldrsvFNIATFLHFLecidrfdvyddciGFIEEDCLYYENTrlgnsiskngacmddpsvitiedvkslnlgcglaHYDALLLYDEADFDLAKQFNTQLNKMgftvcdkdnsfltgqfehSAFIQVMDRCTCVIVLMSTHFMNNSLLHSLTQYAeakhidhtihskiipilcsddyfsVGFLQYCVKLKLNHYASNMEQFWDRLYYSLKgvgkgvpewdfasNMEQFWDRLYYSLkgvgkgsqkqaiqfqttptsmpvappdytlsqqavappdytlpqqatnsqsitnnmseekkdsmkkpmLMLTLQNGIRNtlkvfkpnkkktkalcs
MLIEYLDSKILKKYRFQLFHserqdntsststsihRSKVQVQLLYMTEEQQLKPGLEQWCFCFSIPTSTSSVNTSLCINYMESKQLENSSPVWELRDNTLNVKPNCRTFVFEKEGHTFGSVITHILQSYPEVDFAGYSVPHPADFQIFIRIQVKDGYDSIDILKKGIKELESACDRITETFNDAMQCKVILKLTLLVIQKASKNLRVLVigsqkhsmmqcrnMDSNHDVEKYRYEDSMDYIKIPieairpktrqVLNDKLCDIKQLMSPENYQRDYRGLADLMDIKAPPNPNCEDLMKKMFEDWTKSSTLDRSVFNIATFLHFLECIDRFDVYDDCIGFIEEDCLYYENTRLGNSISKNGACMDDPSVITIEDVKSLNLGCGLAHYDALLLYDEADFDLAKQFNTQLNKMGFTVCDKDNSFLTGQFEHSAFIQVMDRCTCVIVLMSTHFMNNSLLHSLTQYAEAKHIDHTIHSKIIPILCSDDYFSVGFLQYCVKLKLNHYASNMEQFWDRLYYSLKGVGKGVPEWDFASNMEQFWDRLYYSLKGVGKGSQKQAIQFQTTPTSMPVAPPDYTLSQQAVAPPDYTLPQQATNSQSITNNMSEEKKDSMKKPMLMLTLQNGirntlkvfkpnkkktkalcs
MLIEYLDSKILKKYRFQLFHSERQDNTSSTSTSIHRSKVQVQLLYMTEEQQLKPGLEQWCFCFSIPTSTSSVNTSLCINYMESKQLENSSPVWELRDNTLNVKPNCRTFVFEKEGHTFGSVITHILQSYPEVDFAGYSVPHPADFQIFIRIQVKDGYDSIDILKKGIKELESACDRITETFNDAMQCKVILKLTLLVIQKASKNLRVLVIGSQKHSMMQCRNMDSNHDVEKYRYEDSMDYIKIPIEAIRPKTRQVLNDKLCDIKQLMSPENYQRDYRGLADLMDIKAPPNPNCEDLMKKMFEDWTKSSTLDRSVFNIATFLHFLECIDRFDVYDDCIGFIEEDCLYYENTRLGNSISKNGACMDDPSVITIEDVKSLNLGCGLAHYDALLLYDEADFDLAKQFNTQLNKMGFTVCDKDNSFLTGQFEHSAFIQVMDRCTCVIVLMSTHFMNNSLLHSLTQYAEAKHIDHTIHSKIIPILCSDDYFSVGFLQYCVKLKLNHYASNMEQFWDRLYYSLKGVGKGVPEWDFASNMEQFWDRLYYSLKGVGKGSQKQAIQFQTTPTSMPVAPPDYTLSQQAVAPPDYTLPQQATNSQSITNNMSEEKKDSMKKPMLMLTLQNGIRNTLKVFKPNKKKTKALCS
**IEYLDSKILKKYRFQLF*******************VQVQLLYMTEEQQLKPGLEQWCFCFSIPTSTSSVNTSLCINYMESKQLENSSPVWELRDNTLNVKPNCRTFVFEKEGHTFGSVITHILQSYPEVDFAGYSVPHPADFQIFIRIQVKDGYDSIDILKKGIKELESACDRITETFNDAMQCKVILKLTLLVIQKASKNLRVLVIGSQKH*MM*C*******DVEKYRYEDSMDYIKIPIEAIRPKTRQVLNDKLCDIKQLMSPENYQRDYRGLADLMDIK******CEDLMKKMFEDWTKSSTLDRSVFNIATFLHFLECIDRFDVYDDCIGFIEEDCLYYENTRLGNSISKNGACMDDPSVITIEDVKSLNLGCGLAHYDALLLYDEADFDLAKQFNTQLNKMGFTVCDKDNSFLTGQFEHSAFIQVMDRCTCVIVLMSTHFMNNSLLHSLTQYAEAKHIDHTIHSKIIPILCSDDYFSVGFLQYCVKLKLNHYASNMEQFWDRLYYSLKGVGKGVPEWDFASNMEQFWDRLYYSLKGVG********************************************************************L*NGIRNTL***************
*LIEYLDSKILKKYRFQ************************QLLYMTEEQQ**PGLEQWCF*********************************LRDNTLNVKPNCRTFVFEKEGHTFGSVITHILQSYPEVDFAGYSVPHPADFQIFIRIQVKDGYDSIDILKKGIKELESACDRITETFNDAMQCKVILKLT****************GSQKH***********HDVEKYRYEDSMDYIKIPIEAIRPKTRQVLNDKLCDIKQLMSPENYQRDYRGLADLMDIKAPPNPNCEDLMKKMFEDWTKSSTLDRSVFNIATFLHFLECIDRFDVYDDCIGFIEEDCL***********************************CGLAHYDALLLYDEADFDLAKQFNTQLNKMGFTVCDKDNSFLTGQFEHSAFIQVMDRCTCVIVLMSTHFMNNSLLHSLTQYAEAKHIDHTIHSKIIPILCSDDYFSVGFLQYCVKLKLNHYASNMEQFWDRLYYSL******************FWDRLYYSL**********************************************************************LTLQNGIRNTLKVFKPNKK****LC*
MLIEYLDSKILKKYRFQLFHSE*************RSKVQVQLLYMTEEQQLKPGLEQWCFCFSIPTSTSSVNTSLCINYMESKQLENSSPVWELRDNTLNVKPNCRTFVFEKEGHTFGSVITHILQSYPEVDFAGYSVPHPADFQIFIRIQVKDGYDSIDILKKGIKELESACDRITETFNDAMQCKVILKLTLLVIQKASKNLRVLVIGSQKHSMMQCRNMDSNHDVEKYRYEDSMDYIKIPIEAIRPKTRQVLNDKLCDIKQLMSPENYQRDYRGLADLMDIKAPPNPNCEDLMKKMFEDWTKSSTLDRSVFNIATFLHFLECIDRFDVYDDCIGFIEEDCLYYENTRLGNSISKNGACMDDPSVITIEDVKSLNLGCGLAHYDALLLYDEADFDLAKQFNTQLNKMGFTVCDKDNSFLTGQFEHSAFIQVMDRCTCVIVLMSTHFMNNSLLHSLTQYAEAKHIDHTIHSKIIPILCSDDYFSVGFLQYCVKLKLNHYASNMEQFWDRLYYSLKGVGKGVPEWDFASNMEQFWDRLYYSLKG***********FQTTPTSMPVAPPDYTLSQQAVAPPDYTLPQQATNSQSIT**********MKKPMLMLTLQNGIRNTLKVFKPNK********
MLIEYLDSKILKKYRFQLFHS**************RSKVQVQLLYMTEEQQLKPGLEQWC***************************NSSPVWELRDNTLNVKPNCRTFVFEKEGHTFGSVITHILQSYPEVDFAGYSVPHPADFQIFIRIQVKDGYDSIDILKKGIKELESACDRITETFNDAMQCKVILKLTLLVIQKASKNLRVLVIGSQKHSMMQCRNMDSNHDVEKYRYEDSMDYIKIPIEAIRPKTRQVLNDKLCDIKQLMSPENYQRDYRGLADLMDIKAPPNPNCEDLMKKMFEDWTKSSTLDRSVFNIATFLHFLECIDRFDVYDDCIGFIEEDCLYYENTRLGNSISKNGACMDDPSVITIEDVKSLNLGCGLAHYDALLLYDEADFDLAKQFNTQLNKMGFTVCDKDNSFLTGQFEHSAFIQVMDRCTCVIVLMSTHFMNNSLLHSLTQYAEAKHIDHTIHSKIIPILCSDDYFSVGFLQYCVKLKLNHYASNMEQFWDRLYYSLKGVGKGVPEWDFASNMEQFWDRLYYSLKGVGKGSQKQAIQFQTTPTSMPVAPPDYTLSQQAVAPPDYTLP*******************SMKKPMLMLTLQNGIRNTLKVFKPNKKK******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLIEYLDSKILKKYRFQLFHSERQDNTSSTSTSIHRSKVQVQLLYMTEEQQLKPGLEQWCFCFSIPTSTSSVNTSLCINYMESKQLENSSPVWELRDNTLNVKPNCRTFVFEKEGHTFGSVITHILQSYPEVDFAGYSVPHPADFQIFIRIQVKDGYDSxxxxxxxxxxxxxxxxxxxxxFNDAMQCKVILKLTLLVIQKASKNLRVLVIGSQKHSMMQCRNMDSNHDVEKYRYEDSMDYIKIPIEAIRPKTRQVLNDKLCDIKQLMSPENYQRDYRGLADLMDIKAPPNPNCEDLMKKMFEDWTKSSTLDRSVFNIATFLHFLECIDRFDVYDDCIGFIEEDCLYYENTRLGNSISKNGACMDDPSVITIEDVKSLNLGCGLAHYDALLLYDEADFDLAKQFNTQLNKMGFTVCDKDNSFLTGQFEHSAFIQVMDRCTCVIVLMSTHFMNNSLLHSLTQYAEAKHIDHTIHSKIIPILCSDDYFSVGFLQYCVKLKLNHYASNMEQFWDRLYYSLKGVGKGVPEWDFASNMEQFWDRLYYSLKGVGKGSQKQAIQFQTTPTSMPVAPPDYTLSQQAVAPPDYTLPQQATNSQSITNNMSEEKKDSMKKPMLMLTLQNGIRNTLKVFKPNKKKTKALCS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query639 2.2.26 [Sep-21-2011]
Q9VIZ0105 Probable DNA-directed RNA no N/A 0.122 0.742 0.481 6e-16
Q54ES6116 DNA-directed RNA polymera yes N/A 0.129 0.715 0.397 4e-14
Q09177125 DNA-directed RNA polymera yes N/A 0.122 0.624 0.384 1e-12
Q5XK67114 DNA-directed RNA polymera N/A N/A 0.128 0.719 0.341 2e-11
P34476144 Probable DNA-directed RNA yes N/A 0.176 0.784 0.310 6e-11
Q61IX2145 Probable DNA-directed RNA N/A N/A 0.129 0.572 0.373 2e-10
Q6DRI4112 DNA-directed RNA polymera yes N/A 0.128 0.732 0.341 4e-10
P97304133 DNA-directed RNA polymera yes N/A 0.126 0.609 0.333 4e-10
Q9Y2S0133 DNA-directed RNA polymera yes N/A 0.128 0.616 0.304 1e-09
P28000142 DNA-directed RNA polymera yes N/A 0.123 0.556 0.341 2e-09
>sp|Q9VIZ0|RPAC2_DROME Probable DNA-directed RNA polymerases I and III subunit RPAC2 OS=Drosophila melanogaster GN=l(2)37Cg PE=3 SV=1 Back     alignment and function desciption
 Score = 86.7 bits (213), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 38/79 (48%), Positives = 52/79 (65%), Gaps = 1/79 (1%)

Query: 107 RTFVFEKEGHTFGSVITHILQSYPEVDFAGYSVPHPADFQIFIRIQVKDGYDSIDILKKG 166
           RTFVF  EGHT G+ +  I+  YPEVDF GY++PHP + ++  RIQ +    +IDILK+G
Sbjct: 18  RTFVFTNEGHTLGNALKTIIARYPEVDFCGYTIPHPTEQKLHFRIQSRRD-RAIDILKRG 76

Query: 167 IKELESACDRITETFNDAM 185
           +++LE  CD    TF   M
Sbjct: 77  LEDLEGLCDHTIVTFEKEM 95
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common core component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively.
Drosophila melanogaster (taxid: 7227)
>sp|Q54ES6|RPC19_DICDI DNA-directed RNA polymerases I and III subunit rpc19 OS=Dictyostelium discoideum GN=rpc19 PE=3 SV=1 Back     alignment and function description
>sp|Q09177|RPAC2_SCHPO DNA-directed RNA polymerases I and III subunit RPAC2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpc19 PE=2 SV=1 Back     alignment and function description
>sp|Q5XK67|RPAC2_XENLA DNA-directed RNA polymerases I and III subunit RPAC2 OS=Xenopus laevis GN=polr1d PE=3 SV=1 Back     alignment and function description
>sp|P34476|RPAC2_CAEEL Probable DNA-directed RNA polymerases I and III subunit RPAC2 OS=Caenorhabditis elegans GN=F58A4.9 PE=3 SV=1 Back     alignment and function description
>sp|Q61IX2|RPAC2_CAEBR Probable DNA-directed RNA polymerases I and III subunit RPAC2 OS=Caenorhabditis briggsae GN=CBG10036 PE=3 SV=1 Back     alignment and function description
>sp|Q6DRI4|RPAC2_DANRE DNA-directed RNA polymerases I and III subunit RPAC2 OS=Danio rerio GN=polr1d PE=3 SV=1 Back     alignment and function description
>sp|P97304|RPAC2_MOUSE DNA-directed RNA polymerases I and III subunit RPAC2 OS=Mus musculus GN=Polr1d PE=2 SV=1 Back     alignment and function description
>sp|Q9Y2S0|RPAC2_HUMAN DNA-directed RNA polymerases I and III subunit RPAC2 OS=Homo sapiens GN=POLR1D PE=1 SV=1 Back     alignment and function description
>sp|P28000|RPAC2_YEAST DNA-directed RNA polymerases I and III subunit RPAC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPC19 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query639
242022271461 Myeloid differentiation primary response 0.406 0.563 0.282 2e-20
399574162475 myeloid differentiation factor 88 [Litop 0.395 0.532 0.277 5e-19
307203736287 Myeloid differentiation primary response 0.427 0.951 0.288 2e-18
408368245477 myeloid differentiation factor 88 [Fenne 0.395 0.530 0.277 4e-18
158292884462 AGAP005252-PA [Anopheles gambiae str. PE 0.430 0.595 0.260 4e-18
399574166475 myeloid differentiation factor 88 [Litop 0.394 0.530 0.282 8e-18
270004856400 Myd88 [Tribolium castaneum] 0.416 0.665 0.296 2e-17
157107641103 DNA-directed RNA polymerase I 16 kDa pol 0.133 0.825 0.494 5e-17
322786972428 hypothetical protein SINV_03562 [Solenop 0.424 0.633 0.279 7e-17
312371539 758 hypothetical protein AND_21955 [Anophele 0.422 0.356 0.283 8e-17
>gi|242022271|ref|XP_002431564.1| Myeloid differentiation primary response protein MyD88, putative [Pediculus humanus corporis] gi|212516867|gb|EEB18826.1| Myeloid differentiation primary response protein MyD88, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  107 bits (267), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 85/301 (28%), Positives = 144/301 (47%), Gaps = 41/301 (13%)

Query: 237 SMDYIKIPIEAIRPKTRQVLNDKLCDIKQLMSPENYQRDYRGLADLMD--------IKAP 288
           ++DY KIP+ A++  T+ +L+  L   K + + +   RD+RGL  L+         I+A 
Sbjct: 5   TLDYSKIPLIALKKTTQNILSAGLNQHKIIPNNDGIPRDWRGLGHLIGLNGVEMGWIEAT 64

Query: 289 PNPNCEDLMKKMFEDWTKSSTLDRSVFNIATFLHFLECIDRFDVYDDCIGFIEEDCL-YY 347
           P+P        +   W K+        N+    ++L+ IDRFDV DD   FIE + L Y 
Sbjct: 65  PDP-----FSALLNHWGKNG-------NLNLLQNYLKIIDRFDVLDDAKQFIESNSLEYA 112

Query: 348 ENTRLGNSISKNGACMDDPSVITIEDVKSLNLGCGLAHYDALLLYDEADFDLAKQ-FNTQ 406
           +N    N+   N     D  ++T +DV  L  G     YDA +LY E D + A +   T 
Sbjct: 113 KNLNSLNTSVANVNLESDKVILTTDDVIRLENGMEPQIYDAYILYAEEDVNFATEIIETM 172

Query: 407 LNKMGFTVCDKDNSFLTG-QFEHSAFIQ-VMDRCTCVIVLMSTHFMNNSLLHSLTQYAEA 464
            +K    +C +D   + G QFEH A  + + +RC  ++V++S +F+ +        +A+A
Sbjct: 173 ESKYNLKLCVRDRDLIGGVQFEHDAITKLIAERCKRLVVVVSPNFLKSKANKFFVTFAQA 232

Query: 465 KHIDHTIHSKIIPILCSDDYFSVGFLQYCVKLKLNHY-------ASNMEQFWDRLYYSLK 517
             +D     K+IPIL         + +  V  +L++Y       A+ +  FW++L  S++
Sbjct: 233 LGLD-IRERKVIPIL---------YEKCIVPPELSYYFCLDYSRANKLWNFWEKLRDSIQ 282

Query: 518 G 518
            
Sbjct: 283 A 283

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|399574162|gb|AFP49300.1| myeloid differentiation factor 88 [Litopenaeus vannamei] Back     alignment and taxonomy information
>gi|307203736|gb|EFN82696.1| Myeloid differentiation primary response protein MyD88 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|408368245|gb|AFU61120.1| myeloid differentiation factor 88 [Fenneropenaeus chinensis] Back     alignment and taxonomy information
>gi|158292884|ref|XP_314167.4| AGAP005252-PA [Anopheles gambiae str. PEST] gi|157017202|gb|EAA09478.4| AGAP005252-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|399574166|gb|AFP49302.1| myeloid differentiation factor 88 [Litopenaeus vannamei] Back     alignment and taxonomy information
>gi|270004856|gb|EFA01304.1| Myd88 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|157107641|ref|XP_001649871.1| DNA-directed RNA polymerase I 16 kDa polypeptide [Aedes aegypti] gi|157131975|ref|XP_001662388.1| DNA-directed RNA polymerase I 16 kDa polypeptide [Aedes aegypti] gi|108868667|gb|EAT32892.1| AAEL014869-PA [Aedes aegypti] gi|108871328|gb|EAT35553.1| AAEL012284-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|322786972|gb|EFZ13196.1| hypothetical protein SINV_03562 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|312371539|gb|EFR19699.1| hypothetical protein AND_21955 [Anopheles darlingi] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query639
FB|FBgn0086447105 l(2)37Cg "lethal (2) 37Cg" [Dr 0.122 0.742 0.481 1.9e-15
FB|FBgn0033402537 Myd88 "Myd88" [Drosophila mela 0.256 0.305 0.306 1.2e-14
DICTYBASE|DDB_G0291362116 rpc19 "putative RNA polymerase 0.129 0.715 0.397 1.4e-14
POMBASE|SPAC1687.01125 rpc19 "DNA-directed RNA polyme 0.122 0.624 0.384 1.3e-13
ASPGD|ASPL0000003267137 AN6558 [Emericella nidulans (t 0.120 0.562 0.402 1.5e-12
WB|WBGene00010230144 rpac-19 [Caenorhabditis elegan 0.179 0.798 0.305 3.2e-12
GENEDB_PFALCIPARUM|PF14_015096 PF14_0150 "RNA polymerase smal 0.122 0.812 0.443 8.7e-12
UNIPROTKB|Q8ILU496 PF14_0150 "RNA polymerase smal 0.122 0.812 0.443 8.7e-12
ZFIN|ZDB-GENE-040930-4112 polr1d "polymerase (RNA) I pol 0.126 0.723 0.345 3e-11
UNIPROTKB|E1C277119 E1C277 "Uncharacterized protei 0.120 0.647 0.337 4.9e-11
FB|FBgn0086447 l(2)37Cg "lethal (2) 37Cg" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 204 (76.9 bits), Expect = 1.9e-15, P = 1.9e-15
 Identities = 38/79 (48%), Positives = 52/79 (65%)

Query:   107 RTFVFEKEGHTFGSVITHILQSYPEVDFAGYSVPHPADFQIFIRIQVKDGYDSIDILKKG 166
             RTFVF  EGHT G+ +  I+  YPEVDF GY++PHP + ++  RIQ +    +IDILK+G
Sbjct:    18 RTFVFTNEGHTLGNALKTIIARYPEVDFCGYTIPHPTEQKLHFRIQSRRDR-AIDILKRG 76

Query:   167 IKELESACDRITETFNDAM 185
             +++LE  CD    TF   M
Sbjct:    77 LEDLEGLCDHTIVTFEKEM 95
GO:0003899 "DNA-directed RNA polymerase activity" evidence=ISS
GO:0005736 "DNA-directed RNA polymerase I complex" evidence=IC
GO:0006360 "transcription from RNA polymerase I promoter" evidence=ISS
GO:0003677 "DNA binding" evidence=IEA
GO:0046983 "protein dimerization activity" evidence=IEA
GO:0005875 "microtubule associated complex" evidence=IDA
FB|FBgn0033402 Myd88 "Myd88" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0291362 rpc19 "putative RNA polymerase III subunit" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
POMBASE|SPAC1687.01 rpc19 "DNA-directed RNA polymerase I and III subunit Rpc19" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
ASPGD|ASPL0000003267 AN6558 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
WB|WBGene00010230 rpac-19 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PF14_0150 PF14_0150 "RNA polymerase small subunit, putative" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8ILU4 PF14_0150 "RNA polymerase small subunit, putative" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040930-4 polr1d "polymerase (RNA) I polypeptide D" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1C277 E1C277 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.70.691
4th Layer2.7.7.60.737

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query639
cd0702985 cd07029, RNAP_I_III_AC19, AC19 subunit of Eukaryot 6e-27
pfam1365677 pfam13656, RNA_pol_L_2, RNA polymerase Rpb3/Rpb11 5e-25
COG176199 COG1761, RPB11, DNA-directed RNA polymerase, subun 1e-16
cd0692693 cd06926, RNAP_II_RPB11, RPB11 subunit of Eukaryoti 2e-16
cd0702783 cd07027, RNAP_RPB11_like, RPB11 subunit of RNA pol 3e-15
cd0692783 cd06927, RNAP_L, L subunit of Archaeal RNA polymer 1e-12
PRK0114685 PRK01146, PRK01146, DNA-directed RNA polymerase su 9e-12
pfam0119388 pfam01193, RNA_pol_L, RNA polymerase Rpb3/Rpb11 di 2e-11
cd0046086 cd00460, RNAP_RPB11_RPB3, RPB11 and RPB3 subunits 1e-10
pfam13676102 pfam13676, TIR_2, TIR domain 4e-04
>gnl|CDD|132907 cd07029, RNAP_I_III_AC19, AC19 subunit of Eukaryotic RNA polymerase (RNAP) I and RNAP III Back     alignment and domain information 
 Score =  104 bits (261), Expect = 6e-27
 Identities = 37/79 (46%), Positives = 55/79 (69%)

Query: 103 KPNCRTFVFEKEGHTFGSVITHILQSYPEVDFAGYSVPHPADFQIFIRIQVKDGYDSIDI 162
             +C TFVF  E HT G+ + +++   PEV+F GYS+PHP++ +I +RIQ K G  ++D+
Sbjct: 7   DESCATFVFYGEDHTLGNSLRYVIMKNPEVEFCGYSIPHPSENKINLRIQTKGGEPAVDV 66

Query: 163 LKKGIKELESACDRITETF 181
           LKKG+++LE  CD I  TF
Sbjct: 67  LKKGLEDLEQICDHILSTF 85

The eukaryotic AC19 subunit of RNA polymerase (RNAP) I and RNAP III is involved in the assembly of RNAP subunits. RNAP is a large multi-subunit complex responsible for the synthesis of RNA. It is the principal enzyme of the transcription process, and is a final target in many regulatory pathways that control gene expression in all living cells. At least three distinct RNAP complexes are found in eukaryotic nuclei: RNAP I, RNAP II, and RNAP III. RNAP I is responsible for the synthesis of ribosomal RNA precursor, while RNAP III functions in the synthesis of 5S and tRNA. The AC19 subunit is the equivalent of the RPB11 subunit of RNAP II. The RPB11 subunit heterodimerizes with the RPB3 subunit, and together with RPB10 and RPB12, anchors the two largest subunits, RPB1 and RPB2, and stabilizes their association. The homology of AC19 to RPB11 suggests a similar function. The AC19 subunit is likely to associate with the RPB3 counterpart, AC40, to form a heterodimer, which stabilizes the association of the two largest subunits of RNAP I and RNAP III. Length = 85
>gnl|CDD|222292 pfam13656, RNA_pol_L_2, RNA polymerase Rpb3/Rpb11 dimerisation domain Back     alignment and domain information
>gnl|CDD|224675 COG1761, RPB11, DNA-directed RNA polymerase, subunit L [Transcription] Back     alignment and domain information
>gnl|CDD|132902 cd06926, RNAP_II_RPB11, RPB11 subunit of Eukaryotic RNA polymerase II Back     alignment and domain information
>gnl|CDD|132905 cd07027, RNAP_RPB11_like, RPB11 subunit of RNA polymerase Back     alignment and domain information
>gnl|CDD|132903 cd06927, RNAP_L, L subunit of Archaeal RNA polymerase Back     alignment and domain information
>gnl|CDD|234909 PRK01146, PRK01146, DNA-directed RNA polymerase subunit L; Provisional Back     alignment and domain information
>gnl|CDD|216354 pfam01193, RNA_pol_L, RNA polymerase Rpb3/Rpb11 dimerisation domain Back     alignment and domain information
>gnl|CDD|132901 cd00460, RNAP_RPB11_RPB3, RPB11 and RPB3 subunits of RNA polymerase Back     alignment and domain information
>gnl|CDD|222311 pfam13676, TIR_2, TIR domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 639
KOG4392|consensus117 99.96
cd0692693 RNAP_II_RPB11 RPB11 subunit of Eukaryotic RNA poly 99.95
PF1365677 RNA_pol_L_2: RNA polymerase Rpb3/Rpb11 dimerisatio 99.94
cd0702985 RNAP_I_III_AC19 AC19 subunit of Eukaryotic RNA pol 99.94
cd0692783 RNAP_L L subunit of Archaeal RNA polymerase. The a 99.94
PRK0114685 DNA-directed RNA polymerase subunit L; Provisional 99.94
cd0702783 RNAP_RPB11_like RPB11 subunit of RNA polymerase. T 99.94
KOG3438|consensus105 99.92
COG176199 RPB11 DNA-directed RNA polymerase, subunit L [Tran 99.92
PF01582141 TIR: TIR domain; InterPro: IPR000157 In Drosophila 99.89
smart00255140 TIR Toll - interleukin 1 - resistance. 99.85
cd0046086 RNAP_RPB11_RPB3 RPB11 and RPB3 subunits of RNA pol 99.81
cd0831279 Death_MyD88 Death domain of Myeloid Differentation 99.74
cd0880284 Death_UNC5B Death domain found in Uncoordinated-5B 99.61
PF13676102 TIR_2: TIR domain; PDB: 3H16_B 3UB4_A 2Y92_A 3UB3_ 99.57
cd0879984 Death_UNC5C Death domain found in Uncoordinated-5C 99.52
cd0878282 Death_DAPK1 Death domain found in death-associated 99.51
cd0878183 Death_UNC5-like Death domain found in Uncoordinate 99.44
cd0831072 Death_NFkB-like Death domain of Nuclear Factor-Kap 99.37
PF0119366 RNA_pol_L: RNA polymerase Rpb3/Rpb11 dimerisation 99.37
PLN03194187 putative disease resistance protein; Provisional 99.35
cd08793100 Death_IRAK4 Death domain of Interleukin-1 Receptor 99.14
cd0831177 Death_p75NR Death domain of p75 Neurotophin Recept 99.14
cd0880084 Death_UNC5A Death domain found in Uncoordinated-5A 99.07
cd0830995 Death_IRAK Death domain of Interleukin-1 Receptor- 98.97
cd0880198 Death_UNC5D Death domain found in Uncoordinated-5D 98.71
cd0880384 Death_ank3 Death domain of Ankyrin-3. Death Domain 98.63
PF0053183 Death: Death domain; InterPro: IPR000488 The death 98.46
cd0879776 Death_NFkB1_p105 Death domain of the Nuclear Facto 98.37
cd0877786 Death_RIP1 Death Domain of Receptor-Interacting Pr 98.35
smart0000588 DEATH DEATH domain, found in proteins involved in 98.32
cd0880484 Death_ank2 Death domain of Ankyrin-2. Death Domain 98.26
cd0879876 Death_NFkB2_p100 Death domain of the Nuclear Facto 98.22
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.03
cd0167079 Death Death Domain: a protein-protein interaction 97.89
cd0831886 Death_NMPP84 Death domain of Nuclear Matrix Protei 97.89
cd0831784 Death_ank Death domain associated with Ankyrins. D 97.85
cd0830797 Death_Pelle Death domain of the protein kinase Pel 97.8
KOG3678|consensus832 97.71
KOG1480|consensus909 97.39
cd0878397 Death_MALT1 Death domain similar to that found in 97.39
PF08937130 DUF1863: MTH538 TIR-like domain (DUF1863); InterPr 97.27
cd0877986 Death_PIDD Death Domain of p53-induced protein wit 97.04
cd0880584 Death_ank1 Death domain of Ankyrin-1. Death Domain 96.96
cd0879689 Death_IRAK-M Death domain of Interleukin 1 Recepto 96.88
cd0830686 Death_FADD Fas-associated Death Domain protein-pro 96.72
cd08308125 Death_Tube Death domain of Tube. Death domains (DD 96.68
PF08357150 SEFIR: SEFIR domain; InterPro: IPR013568 This doma 96.14
cd0878479 Death_DRs Death Domain of Death Receptors. Death d 95.9
cd0831596 Death_TRAILR_DR4_DR5 Death domain of Tumor necrosi 95.74
cd0879588 Death_IRAK2 Death domain of Interleukin 1 Receptor 95.11
cd0831697 Death_FAS_TNFRSF6 Death domain of FAS or TNF recep 94.77
cd0831983 Death_RAIDD Death domain of RIP-associated ICH-1 h 94.66
cd0879484 Death_IRAK1 Death domain of Interleukin 1 Receptor 94.66
cd0831380 Death_TNFR1 Death domain of Tumor Necrosis Factor 94.18
PF10137125 TIR-like: Predicted nucleotide-binding protein con 93.73
cd0878090 Death_TRADD Death Domain of Tumor Necrosis Factor 91.77
cd06928215 RNAP_alpha_NTD N-terminal domain of the Alpha subu 86.27
PRK14979195 DNA-directed RNA polymerase subunit D; Provisional 86.23
cd07028212 RNAP_RPB3_like RPB3 subunit of RNA polymerase. The 85.68
smart00662224 RPOLD RNA polymerases D. DNA-directed RNA polymera 84.2
TIGR02027297 rpoA DNA-directed RNA polymerase, alpha subunit, b 83.2
>KOG4392|consensus Back     alignment and domain information 
Probab=99.96  E-value=1.8e-29  Score=226.95  Aligned_cols=110  Identities=30%  Similarity=0.449  Sum_probs=106.7

Q ss_pred             cccccchhccccCCC-CceeEeecCCccCCCCeEEEEEccCCcchHHHHHHHHhcCCCeeEEeecCCCCCCCceEEEEEe
Q psy12711         75 SLCINYMESKQLENS-SPVWELRDNTLNVKPNCRTFVFEKEGHTFGSVITHILQSYPEVDFAGYSVPHPADFQIFIRIQV  153 (639)
Q Consensus        75 ~~~~~~~e~~~l~~~-~Kv~~~~dt~~~~~~N~~tf~i~gEDHTLGNlLR~~Llkdp~V~FAGY~IPHPLe~~i~LrIQT  153 (639)
                      ||.+.+||+|.|.+| +||++..||+   .+|++.|+|++|||||||+|+.+|++||+|.||||++|||++.++.|||||
T Consensus         1 MNaP~~fE~fll~eg~kKvtin~DtK---vpNA~~fTiekEDHTLGNii~~qLl~D~~vLFagYkvpHPl~~~~~LRiqt   77 (117)
T KOG4392|consen    1 MNAPPAFESFLLFEGEKKITINKDTK---VPNAALFTIEKEDHTLGNIIKSQLLKDPRVLFAGYKVPHPLEHKIILRVQT   77 (117)
T ss_pred             CCCchhhhhheeccCCceeEEecCCC---CCceEEEEEecccchHHHHHHHHHccCccceEeeecCCCcccccEEEEEec
Confidence            799999999999777 6699999999   499999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhh
Q psy12711        154 KDGYDSIDILKKGIKELESACDRITETFNDAMQC  187 (639)
Q Consensus       154 ~~~~~P~eaLk~Al~~L~~~~~~L~~~F~~ai~~  187 (639)
                      +.+++|.++|.+|+.+++..++.+...|+.+++.
T Consensus        78 t~d~~p~~al~~a~~~l~~el~~l~~~f~~~~~~  111 (117)
T KOG4392|consen   78 TEDCSPADALTNAITDLIEELSLLENRFKAEAAL  111 (117)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            9999999999999999999999999999999987

>cd06926 RNAP_II_RPB11 RPB11 subunit of Eukaryotic RNA polymerase II Back     alignment and domain information
>PF13656 RNA_pol_L_2: RNA polymerase Rpb3/Rpb11 dimerisation domain; PDB: 2Y0S_L 1I3Q_K 4A3D_K 2JA8_K 3GTP_K 1R9T_K 3PO2_K 4A3J_K 3HOX_K 2JA7_K Back     alignment and domain information
>cd07029 RNAP_I_III_AC19 AC19 subunit of Eukaryotic RNA polymerase (RNAP) I and RNAP III Back     alignment and domain information
>cd06927 RNAP_L L subunit of Archaeal RNA polymerase Back     alignment and domain information
>PRK01146 DNA-directed RNA polymerase subunit L; Provisional Back     alignment and domain information
>cd07027 RNAP_RPB11_like RPB11 subunit of RNA polymerase Back     alignment and domain information
>KOG3438|consensus Back     alignment and domain information
>COG1761 RPB11 DNA-directed RNA polymerase, subunit L [Transcription] Back     alignment and domain information
>PF01582 TIR: TIR domain; InterPro: IPR000157 In Drosophila melanogaster the Toll protein is involved in establishment of dorso-ventral polarity in the embryo Back     alignment and domain information
>smart00255 TIR Toll - interleukin 1 - resistance Back     alignment and domain information
>cd00460 RNAP_RPB11_RPB3 RPB11 and RPB3 subunits of RNA polymerase Back     alignment and domain information
>cd08312 Death_MyD88 Death domain of Myeloid Differentation primary response protein MyD88 Back     alignment and domain information
>cd08802 Death_UNC5B Death domain found in Uncoordinated-5B Back     alignment and domain information
>PF13676 TIR_2: TIR domain; PDB: 3H16_B 3UB4_A 2Y92_A 3UB3_A 3UB2_A Back     alignment and domain information
>cd08799 Death_UNC5C Death domain found in Uncoordinated-5C Back     alignment and domain information
>cd08782 Death_DAPK1 Death domain found in death-associated protein kinase 1 Back     alignment and domain information
>cd08781 Death_UNC5-like Death domain found in Uncoordinated-5 homolog family Back     alignment and domain information
>cd08310 Death_NFkB-like Death domain of Nuclear Factor-KappaB precursor proteins Back     alignment and domain information
>PF01193 RNA_pol_L: RNA polymerase Rpb3/Rpb11 dimerisation domain; InterPro: IPR011261 DNA-directed RNA polymerases 2 Back     alignment and domain information
>PLN03194 putative disease resistance protein; Provisional Back     alignment and domain information
>cd08793 Death_IRAK4 Death domain of Interleukin-1 Receptor-Associated Kinase 4 Back     alignment and domain information
>cd08311 Death_p75NR Death domain of p75 Neurotophin Receptor Back     alignment and domain information
>cd08800 Death_UNC5A Death domain found in Uncoordinated-5A Back     alignment and domain information
>cd08309 Death_IRAK Death domain of Interleukin-1 Receptor-Associated Kinases Back     alignment and domain information
>cd08801 Death_UNC5D Death domain found in Uncoordinated-5D Back     alignment and domain information
>cd08803 Death_ank3 Death domain of Ankyrin-3 Back     alignment and domain information
>PF00531 Death: Death domain; InterPro: IPR000488 The death domain (DD) is a homotypic protein interaction module composed of a bundle of six alpha-helices Back     alignment and domain information
>cd08797 Death_NFkB1_p105 Death domain of the Nuclear Factor-KappaB1 precursor protein p105 Back     alignment and domain information
>cd08777 Death_RIP1 Death Domain of Receptor-Interacting Protein 1 Back     alignment and domain information
>smart00005 DEATH DEATH domain, found in proteins involved in cell death (apoptosis) Back     alignment and domain information
>cd08804 Death_ank2 Death domain of Ankyrin-2 Back     alignment and domain information
>cd08798 Death_NFkB2_p100 Death domain of the Nuclear Factor-KappaB2 precursor protein p100 Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd01670 Death Death Domain: a protein-protein interaction domain Back     alignment and domain information
>cd08318 Death_NMPP84 Death domain of Nuclear Matrix Protein P84 Back     alignment and domain information
>cd08317 Death_ank Death domain associated with Ankyrins Back     alignment and domain information
>cd08307 Death_Pelle Death domain of the protein kinase Pelle Back     alignment and domain information
>KOG3678|consensus Back     alignment and domain information
>KOG1480|consensus Back     alignment and domain information
>cd08783 Death_MALT1 Death domain similar to that found in Mucosa-associated lymphoid tissue-lymphoma-translocation gene 1 Back     alignment and domain information
>PF08937 DUF1863: MTH538 TIR-like domain (DUF1863); InterPro: IPR015032 This protein adopts the flavodoxin fold, that is, five parallel beta-strands and four helical segments Back     alignment and domain information
>cd08779 Death_PIDD Death Domain of p53-induced protein with a death domain Back     alignment and domain information
>cd08805 Death_ank1 Death domain of Ankyrin-1 Back     alignment and domain information
>cd08796 Death_IRAK-M Death domain of Interleukin 1 Receptor Associated Kinase-M Back     alignment and domain information
>cd08306 Death_FADD Fas-associated Death Domain protein-protein interaction domain Back     alignment and domain information
>cd08308 Death_Tube Death domain of Tube Back     alignment and domain information
>PF08357 SEFIR: SEFIR domain; InterPro: IPR013568 This domain is found in IL17 receptors (IL17Rs, e Back     alignment and domain information
>cd08784 Death_DRs Death Domain of Death Receptors Back     alignment and domain information
>cd08315 Death_TRAILR_DR4_DR5 Death domain of Tumor necrosis factor-Related Apoptosis-Inducing Ligand Receptors Back     alignment and domain information
>cd08795 Death_IRAK2 Death domain of Interleukin 1 Receptor Associated Kinase-2 Back     alignment and domain information
>cd08316 Death_FAS_TNFRSF6 Death domain of FAS or TNF receptor superfamily member 6 Back     alignment and domain information
>cd08319 Death_RAIDD Death domain of RIP-associated ICH-1 homologous protein with a death domain Back     alignment and domain information
>cd08794 Death_IRAK1 Death domain of Interleukin 1 Receptor Associated Kinase-1 Back     alignment and domain information
>cd08313 Death_TNFR1 Death domain of Tumor Necrosis Factor Receptor 1 Back     alignment and domain information
>PF10137 TIR-like: Predicted nucleotide-binding protein containing TIR-like domain; InterPro: IPR019302 This entry represents a TIR-like domain found in a family of prokaryotic predicted nucleotide-binding proteins Back     alignment and domain information
>cd08780 Death_TRADD Death Domain of Tumor Necrosis Factor Receptor 1-Associated Death Domain protein Back     alignment and domain information
>cd06928 RNAP_alpha_NTD N-terminal domain of the Alpha subunit of Bacterial RNA polymerase Back     alignment and domain information
>PRK14979 DNA-directed RNA polymerase subunit D; Provisional Back     alignment and domain information
>cd07028 RNAP_RPB3_like RPB3 subunit of RNA polymerase Back     alignment and domain information
>smart00662 RPOLD RNA polymerases D Back     alignment and domain information
>TIGR02027 rpoA DNA-directed RNA polymerase, alpha subunit, bacterial and chloroplast-type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query639
1i3q_K120 Rna Polymerase Ii Crystal Form I At 3.1 A Resolutio 2e-06
3h0g_K123 Rna Polymerase Ii From Schizosaccharomyces Pombe Le 2e-05
>pdb|1I3Q|K Chain K, Rna Polymerase Ii Crystal Form I At 3.1 A Resolution Length = 120 Back     alignment and structure 
Iteration: 1

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 30/74 (40%), Positives = 39/74 (52%), Gaps = 7/74 (9%)
Query: 104 PNCRTFVFEKEGHTFGSVITHILQSYPEVDFAGYSVPHPADFQIFIRIQVKDGYDSIDIL 163
           PN     FEKE HT G++I   L +  +V FA Y V HP   +  +RIQ  +GYD  D L
Sbjct: 28  PNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDAL 87
Query: 164 KKGIKELESACDRI 177
           K       +AC+ I
Sbjct: 88  K-------NACNSI 94
>pdb|3H0G|K Chain K, Rna Polymerase Ii From Schizosaccharomyces Pombe Length = 123 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query639
3h0g_K123 DNA-directed RNA polymerase II subunit RPB11; tran 2e-23
1twf_K120 B13.6, DNA-directed RNA polymerase II 13.6 kDa pol 1e-22
2pa8_L92 DNA-directed RNA polymerase subunit L; ferredoxin- 1e-22
1xpp_A115 TA1416, DNA-directed RNA polymerase subunit L; str 8e-21
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
3ub2_A146 TOLL/interleukin-1 receptor domain-containing ADA 4e-11
3mop_A110 Myeloid differentiation primary response protein; 7e-11
2js7_A160 Myeloid differentiation primary response protein M 3e-10
2j67_A178 TOLL like receptor 10; TIR, IL-1, TLR10, membrane, 6e-08
1t3g_A159 X-linked interleukin-1 receptor accessory protein- 6e-08
1fyx_A149 TOLL-like receptor 2; beta-alpha-beta fold, signal 1e-07
>3h0g_K DNA-directed RNA polymerase II subunit RPB11; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 123 Back     alignment and structure
 Score = 94.7 bits (235), Expect = 2e-23
 Identities = 26/89 (29%), Positives = 40/89 (44%)

Query: 104 PNCRTFVFEKEGHTFGSVITHILQSYPEVDFAGYSVPHPADFQIFIRIQVKDGYDSIDIL 163
           PN      EKE HT  +++ + L S   V FAGY VPHP +    +R+Q  +      ++
Sbjct: 27  PNAAVVTLEKEDHTLANMLANQLLSDERVLFAGYKVPHPLNHNFILRVQTVEDCSPKQVI 86

Query: 164 KKGIKELESACDRITETFNDAMQCKVILK 192
               K L +  + I   F    + K+I  
Sbjct: 87  VDAAKSLITHLEEIKVNFMREWELKMISV 115
>1twf_K B13.6, DNA-directed RNA polymerase II 13.6 kDa polypepti; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: d.74.3.2 PDB: 1i3q_K 1i6h_K 1k83_K* 1nik_K 1nt9_K 1pqv_K 1r5u_K 1r9s_K* 1r9t_K* 1sfo_K* 1twa_K* 1twc_K* 1i50_K* 1twg_K* 1twh_K* 1wcm_K 1y1v_K 1y1w_K 1y1y_K 1y77_K* ... Length = 120 Back     alignment and structure
>2pa8_L DNA-directed RNA polymerase subunit L; ferredoxin-like Fe-S binding motif, platform for RNA polymer assembly, transferase; 1.76A {Sulfolobus solfataricus} PDB: 2pmz_L 3hkz_L 2waq_L 2wb1_L 2y0s_L Length = 92 Back     alignment and structure
>1xpp_A TA1416, DNA-directed RNA polymerase subunit L; structural genomics, protein structure initiative, MCSG; 1.60A {Thermoplasma acidophilum} SCOP: d.74.3.2 Length = 115 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ub2_A TOLL/interleukin-1 receptor domain-containing ADA protein; TIR domain, TLRS adaptor, immune system; 2.40A {Homo sapiens} PDB: 3ub3_A 3ub4_A 2y92_A Length = 146 Back     alignment and structure
>3mop_A Myeloid differentiation primary response protein; death domain complex, helical symmetry, single-stranded HELI assembly; 3.40A {Homo sapiens} Length = 110 Back     alignment and structure
>2js7_A Myeloid differentiation primary response protein MYD88; MYD88_human, TIR domain, TOLL like receptor adaptor domain, innate immune signaling; NMR {Homo sapiens} PDB: 2z5v_A Length = 160 Back     alignment and structure
>2j67_A TOLL like receptor 10; TIR, IL-1, TLR10, membrane, innate immunity, immune response, leucine-rich repeat, glycoprotein, transmembrane; 2.20A {Homo sapiens} PDB: 1fyv_A Length = 178 Back     alignment and structure
>1t3g_A X-linked interleukin-1 receptor accessory protein-like 1; TIR, IL-1RAPL, IL-1R, TLR, membrane protein; 2.30A {Homo sapiens} Length = 159 Back     alignment and structure
>1fyx_A TOLL-like receptor 2; beta-alpha-beta fold, signaling protein; 2.80A {Homo sapiens} SCOP: c.23.2.1 PDB: 1fyw_A 1o77_A Length = 149 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query639
3h0g_K123 DNA-directed RNA polymerase II subunit RPB11; tran 100.0
1twf_K120 B13.6, DNA-directed RNA polymerase II 13.6 kDa pol 100.0
2js7_A160 Myeloid differentiation primary response protein M 99.97
1t3g_A159 X-linked interleukin-1 receptor accessory protein- 99.96
2pa8_L92 DNA-directed RNA polymerase subunit L; ferredoxin- 99.96
1xpp_A115 TA1416, DNA-directed RNA polymerase subunit L; str 99.96
2j67_A178 TOLL like receptor 10; TIR, IL-1, TLR10, membrane, 99.96
1fyx_A149 TOLL-like receptor 2; beta-alpha-beta fold, signal 99.95
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 99.95
3ub2_A146 TOLL/interleukin-1 receptor domain-containing ADA 99.93
3mop_A110 Myeloid differentiation primary response protein; 99.91
3h16_A154 TIR protein; bacteria TIR domain, signaling protei 99.7
3ozi_A204 L6TR; plant TIR domain, plant protein; 2.30A {Linu 99.66
3jrn_A176 AT1G72930 protein; TIR domain arabidopsis thaliana 99.61
1d2z_A108 Death domain of pelle; six-helix bundle, linear ar 99.55
2dbf_A100 Nuclear factor NF-kappa-B P105 subunit; apoptosis, 99.5
1wmg_A103 Netrin receptor UNC5H2; six helix bundle, death do 99.47
1ngr_A85 P75 low affinity neurotrophin receptor; intracellu 99.35
3g5b_A405 Netrin receptor UNC5B; ZU5, death domain, UPA, apo 99.18
2ib1_A91 Death domain containing membrane protein nradd; ap 99.14
2a9i_A113 IRAK-4, interleukin-1 receptor-associated kinase-4 98.97
1wh4_A127 IRAK4, interleukin-1 receptor-associated kinase 4; 98.95
2d96_A109 Nuclear factor NF-kappa-B P100 subunit; six helix 98.62
2of5_H118 Leucine-rich repeat and death domain-containing pr 98.54
1wxp_A110 THO complex subunit 1; death domain, structural ge 97.89
2g7r_A117 Mucosa-associated lymphoid tissue lymphoma transl 97.82
2yqf_A111 Ankyrin-1; death domain, structural genomics, NPPS 97.78
3ezq_B122 Protein FADD; apoptosis, DISC, FAS, membrane,recep 97.52
4d8o_A581 Ankyrin-2; ZU5, UPA, death domain, supramodule, pr 97.43
2gf5_A191 FADD protein; death domain, death effector domain, 97.2
1fad_A99 Protein (FADD protein); apoptosis, death domain; N 97.18
3mop_K111 IRAK-2, interleukin-1 receptor-associated kinase-l 97.05
2o71_A115 Death domain-containing protein cradd; raidd, apop 96.39
1eiw_A111 Hypothetical protein MTH538; CHEY-like fold, flavo 96.22
1d2z_B153 Death domain of tube; six-helix bundle, linear arr 96.2
2of5_A114 Death domain-containing protein cradd; death domai 95.81
1ich_A112 TNF-1, tumor necrosis factor receptor-1; death dom 94.99
3oq9_A86 Tumor necrosis factor receptor superfamily member; 92.29
3ezq_A115 Tumor necrosis factor receptor superfamily member; 91.1
3hyn_A189 Putative signal transduction protein; DUF1863 fami 85.3
>3h0g_K DNA-directed RNA polymerase II subunit RPB11; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=8.2e-36  Score=272.97  Aligned_cols=117  Identities=26%  Similarity=0.321  Sum_probs=112.4

Q ss_pred             cccccchhccccCCCCceeEeecCCccCCCCeEEEEEccCCcchHHHHHHHHhcCCCeeEEeecCCCCCCCceEEEEEeC
Q psy12711         75 SLCINYMESKQLENSSPVWELRDNTLNVKPNCRTFVFEKEGHTFGSVITHILQSYPEVDFAGYSVPHPADFQIFIRIQVK  154 (639)
Q Consensus        75 ~~~~~~~e~~~l~~~~Kv~~~~dt~~~~~~N~~tf~i~gEDHTLGNlLR~~Llkdp~V~FAGY~IPHPLe~~i~LrIQT~  154 (639)
                      ||.|+|||+|+|++++||++..|++.   +|+++|+|.||||||||+||++|+++|+|+||||+||||++++++|||||+
T Consensus         1 mnap~~~e~f~l~ge~Kv~~~~dtk~---~n~~~f~i~~EDHTLgNlLr~~Llk~p~V~fAgY~vpHPle~~~~lrIqT~   77 (123)
T 3h0g_K            1 MNQPERYELIELMGLPKVTYELDSKS---PNAAVVTLEKEDHTLANMLANQLLSDERVLFAGYKVPHPLNHNFILRVQTV   77 (123)
T ss_dssp             CCCCCGGGTSSCSSCCSCCEEECSSS---TTEEEEEEESCCSSHHHHHHHTGGGSTTCSCBCCBCSCTTSCEEEEEEECC
T ss_pred             CCCCCccceeEeCCCcceEEecCCCC---CceEEEEEeCCCcchHHHHHHHHhcCCCeeEeeecCCCCCCCceEEEEEEC
Confidence            79999999999955589999999994   999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcchhhhh
Q psy12711        155 DGYDSIDILKKGIKELESACDRITETFNDAMQCKVILKLT  194 (639)
Q Consensus       155 ~~~~P~eaLk~Al~~L~~~~~~L~~~F~~ai~~k~~~~~~  194 (639)
                      ++++|++||++||++|++.|++|+++|.++++.++++..+
T Consensus        78 ~~~~p~eaL~~al~~L~~~~~~l~~~F~~~~~~~~~~~~~  117 (123)
T 3h0g_K           78 EDCSPKQVIVDAAKSLITHLEEIKVNFMREWELKMISVEG  117 (123)
T ss_dssp             SSSCSHHHHHHHHHHHHHHHHHHHHHHHHHTTTTTSSSCC
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccccccc
Confidence            9999999999999999999999999999999999988654
>1twf_K B13.6, DNA-directed RNA polymerase II 13.6 kDa polypepti; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: d.74.3.2 PDB: 1i3q_K 1i6h_K 1k83_K* 1nik_K 1nt9_K 1pqv_K 1r5u_K 1r9s_K* 1r9t_K* 1sfo_K* 1twa_K* 1twc_K* 1i50_K* 1twg_K* 1twh_K* 1wcm_K 1y1v_K 1y1w_K 1y1y_K 1y77_K* ... Back     alignment and structure
>2js7_A Myeloid differentiation primary response protein MYD88; MYD88_human, TIR domain, TOLL like receptor adaptor domain, innate immune signaling; NMR {Homo sapiens} PDB: 2z5v_A Back     alignment and structure
>1t3g_A X-linked interleukin-1 receptor accessory protein-like 1; TIR, IL-1RAPL, IL-1R, TLR, membrane protein; 2.30A {Homo sapiens} Back     alignment and structure
>2pa8_L DNA-directed RNA polymerase subunit L; ferredoxin-like Fe-S binding motif, platform for RNA polymer assembly, transferase; 1.76A {Sulfolobus solfataricus} PDB: 2pmz_L 3hkz_L 2waq_L 2wb1_L 2y0s_L Back     alignment and structure
>1xpp_A TA1416, DNA-directed RNA polymerase subunit L; structural genomics, protein structure initiative, MCSG; 1.60A {Thermoplasma acidophilum} SCOP: d.74.3.2 Back     alignment and structure
>2j67_A TOLL like receptor 10; TIR, IL-1, TLR10, membrane, innate immunity, immune response, leucine-rich repeat, glycoprotein, transmembrane; 2.20A {Homo sapiens} PDB: 1fyv_A Back     alignment and structure
>1fyx_A TOLL-like receptor 2; beta-alpha-beta fold, signaling protein; 2.80A {Homo sapiens} SCOP: c.23.2.1 PDB: 1fyw_A 1o77_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3ub2_A TOLL/interleukin-1 receptor domain-containing ADA protein; TIR domain, TLRS adaptor, immune system; 2.40A {Homo sapiens} PDB: 3ub3_A 3ub4_A 2y92_A Back     alignment and structure
>3mop_A Myeloid differentiation primary response protein; death domain complex, helical symmetry, single-stranded HELI assembly; 3.40A {Homo sapiens} Back     alignment and structure
>3h16_A TIR protein; bacteria TIR domain, signaling protein; 2.50A {Paracoccus denitrificans PD1222} Back     alignment and structure
>3ozi_A L6TR; plant TIR domain, plant protein; 2.30A {Linum usitatissimum} Back     alignment and structure
>3jrn_A AT1G72930 protein; TIR domain arabidopsis thaliana, plant protein; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1d2z_A Death domain of pelle; six-helix bundle, linear array of death domains, plastic interfaces, apoptosis; HET: EPE; 2.00A {Drosophila melanogaster} SCOP: a.77.1.2 PDB: 1ik7_A 1ygo_A Back     alignment and structure
>2dbf_A Nuclear factor NF-kappa-B P105 subunit; apoptosis, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wmg_A Netrin receptor UNC5H2; six helix bundle, death domain, apoptosis, structural genomi NPPSFA; 2.10A {Mus musculus} SCOP: a.77.1.2 Back     alignment and structure
>1ngr_A P75 low affinity neurotrophin receptor; intracellular domain, death domain; NMR {Rattus norvegicus} SCOP: a.77.1.2 Back     alignment and structure
>3g5b_A Netrin receptor UNC5B; ZU5, death domain, UPA, apoptosis, developmental protein, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; 2.00A {Rattus norvegicus} Back     alignment and structure
>2ib1_A Death domain containing membrane protein nradd; apoptosis, NOGO, FADD; NMR {Mus musculus} Back     alignment and structure
>2a9i_A IRAK-4, interleukin-1 receptor-associated kinase-4; hexahelical bundle, transferase; 1.70A {Mus musculus} PDB: 3mop_G Back     alignment and structure
>1wh4_A IRAK4, interleukin-1 receptor-associated kinase 4; death domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.77.1.2 Back     alignment and structure
>2d96_A Nuclear factor NF-kappa-B P100 subunit; six helix bundle, processing, proteasome, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2of5_H Leucine-rich repeat and death domain-containing protein; death domain complex, apoptosis; 3.20A {Homo sapiens} Back     alignment and structure
>1wxp_A THO complex subunit 1; death domain, structural genomics, nuclear matrix, riken structural genomics/proteomics initiative, RSGI, transport protein; NMR {Homo sapiens} Back     alignment and structure
>2g7r_A Mucosa-associated lymphoid tissue lymphoma transl protein 1; death domain, chromosomal translocation, hydrolase; 2.70A {Homo sapiens} Back     alignment and structure
>2yqf_A Ankyrin-1; death domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yvi_A Back     alignment and structure
>3ezq_B Protein FADD; apoptosis, DISC, FAS, membrane,receptor, transmembrane; 2.73A {Homo sapiens} PDB: 1e3y_A 1e41_A 3oq9_H Back     alignment and structure
>4d8o_A Ankyrin-2; ZU5, UPA, death domain, supramodule, protein binding; 2.20A {Homo sapiens} Back     alignment and structure
>2gf5_A FADD protein; death domain, death effector domain, apoptosis, death- inducing signaling complex; NMR {Homo sapiens} SCOP: a.77.1.2 a.77.1.4 Back     alignment and structure
>1fad_A Protein (FADD protein); apoptosis, death domain; NMR {Mus musculus} SCOP: a.77.1.2 Back     alignment and structure
>3mop_K IRAK-2, interleukin-1 receptor-associated kinase-like 2; death domain complex, helical symmetry, single-stranded HELI assembly; 3.40A {Homo sapiens} Back     alignment and structure
>2o71_A Death domain-containing protein cradd; raidd, apoptosis; 2.00A {Homo sapiens} Back     alignment and structure
>1eiw_A Hypothetical protein MTH538; CHEY-like fold, flavodoxin-like fold, (A/B)5 doubly wound fold, parallel beta sheet; NMR {Methanothermobacterthermautotrophicus} SCOP: c.23.3.1 Back     alignment and structure
>1d2z_B Death domain of tube; six-helix bundle, linear array of death domains, plastic interfaces, apoptosis; HET: EPE; 2.00A {Drosophila melanogaster} SCOP: a.77.1.2 Back     alignment and structure
>2of5_A Death domain-containing protein cradd; death domain complex, apoptosis; 3.20A {Homo sapiens} Back     alignment and structure
>1ich_A TNF-1, tumor necrosis factor receptor-1; death domain, apoptosis; NMR {Homo sapiens} SCOP: a.77.1.2 Back     alignment and structure
>3oq9_A Tumor necrosis factor receptor superfamily member; apoptosis, DISC, FAS; 6.80A {Mus musculus} Back     alignment and structure
>3ezq_A Tumor necrosis factor receptor superfamily member; apoptosis, DISC, FAS, membrane,receptor, transmembrane; 2.73A {Homo sapiens} SCOP: a.77.1.2 PDB: 1ddf_A Back     alignment and structure
>3hyn_A Putative signal transduction protein; DUF1863 family protein, nucleotide-binding protein, structur genomics; HET: MSE; 1.20A {Eubacterium rectale atcc 33656} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 639
d1twfk_114 d.74.3.2 (K:) RPB11 {Baker's yeast (Saccharomyces 3e-22
d1xppa_99 d.74.3.2 (A:) DNA-directed RNA polymerase subunit 6e-17
d1fyva_161 c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (H 1e-09
d1fyxa_149 c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (H 2e-07
>d1twfk_ d.74.3.2 (K:) RPB11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 114 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: DCoH-like
superfamily: RBP11-like subunits of RNA polymerase
family: RBP11/RpoL
domain: RPB11
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 89.8 bits (223), Expect = 3e-22
 Identities = 28/87 (32%), Positives = 40/87 (45%)

Query: 104 PNCRTFVFEKEGHTFGSVITHILQSYPEVDFAGYSVPHPADFQIFIRIQVKDGYDSIDIL 163
           PN     FEKE HT G++I   L +  +V FA Y V HP   +  +RIQ  +GYD  D L
Sbjct: 28  PNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDAL 87

Query: 164 KKGIKELESACDRITETFNDAMQCKVI 190
           K     + +    +   F      + +
Sbjct: 88  KNACNSIINKLGALKTNFETEWNLQTL 114
>d1xppa_ d.74.3.2 (A:) DNA-directed RNA polymerase subunit L, RpoL {Thermoplasma acidophilum [TaxId: 2303]} Length = 99 Back     information, alignment and structure
>d1fyva_ c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure
>d1fyxa_ c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (Homo sapiens) [TaxId: 9606]} Length = 149 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query639
d1twfk_114 RPB11 {Baker's yeast (Saccharomyces cerevisiae) [T 99.96
d1fyva_161 Toll-like receptor 1, TLR1 {Human (Homo sapiens) [ 99.95
d1fyxa_149 Toll-like receptor 2, TLR2 {Human (Homo sapiens) [ 99.94
d1xppa_99 DNA-directed RNA polymerase subunit L, RpoL {Therm 99.93
d1wmga_90 Netrin receptor UNC5B {Mouse (Mus musculus) [TaxId 99.53
d1d2za_102 Pelle death domain {Drosophila melanogaster [TaxId 99.39
d1ngra_85 p75 low affinity neurotrophin receptor {Rat (Rattu 99.22
d1wh4a_127 Interleukin-1 receptor-associated kinase 4, IRAK4 98.76
d2gf5a1103 FADD (Mort1) {Human (Homo sapiens) [TaxId: 9606]} 97.66
d1icha_87 Tumor necrosis factor receptor-1 death domain {Hum 97.63
d1fada_95 FADD (Mort1) {Mouse (Mus musculus) [TaxId: 10090]} 97.51
d1ddfa_127 Fas {Human (Homo sapiens) [TaxId: 9606]} 97.38
d1bdfa1105 RNA polymerase alpha {Escherichia coli [TaxId: 562 97.06
d1smya1106 RNA polymerase alpha {Thermus thermophilus [TaxId: 97.0
d1d2zb_150 Tube death domain {Drosophila melanogaster [TaxId: 94.33
d1twfc1135 RPB3 {Baker's yeast (Saccharomyces cerevisiae) [Ta 93.57
d1fyxa_149 Toll-like receptor 2, TLR2 {Human (Homo sapiens) [ 86.17
>d1twfk_ d.74.3.2 (K:) RPB11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: DCoH-like
superfamily: RBP11-like subunits of RNA polymerase
family: RBP11/RpoL
domain: RPB11
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.96  E-value=4.7e-30  Score=229.56  Aligned_cols=112  Identities=29%  Similarity=0.368  Sum_probs=108.2

Q ss_pred             cccccchhccccCCC-CceeEeecCCccCCCCeEEEEEccCCcchHHHHHHHHhcCCCeeEEeecCCCCCCCceEEEEEe
Q psy12711         75 SLCINYMESKQLENS-SPVWELRDNTLNVKPNCRTFVFEKEGHTFGSVITHILQSYPEVDFAGYSVPHPADFQIFIRIQV  153 (639)
Q Consensus        75 ~~~~~~~e~~~l~~~-~Kv~~~~dt~~~~~~N~~tf~i~gEDHTLGNlLR~~Llkdp~V~FAGY~IPHPLe~~i~LrIQT  153 (639)
                      ||.+|++|+|+|++| .|+++..+++   .+|+++|+|.||||||||+|++.|+++|+|.||||++|||+++++.|||||
T Consensus         1 mn~p~~~~~~~l~~~e~ki~i~~~~~---~~n~~~~~i~~EdhTlGnlL~~~L~~~~~V~fagY~~pHPl~~~i~irI~t   77 (114)
T d1twfk_           1 MNAPDRFELFLLGEGESKLKIDPDTK---APNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQT   77 (114)
T ss_dssp             CCSCCSGGGTSCCTTCCSCCEEECSS---STTEEEEEEESCCHHHHHHHHHHHTTCTTEEEEEEECSCTTSCEEEEEEEE
T ss_pred             CCCcchhhhcccCCCCceEEEEecCC---CCceEEEEEeCCCchHHHHHHHHHhcCCCceEEEeecCCCCCCeeEEEEEe
Confidence            799999999999999 7899999988   489999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcc
Q psy12711        154 KDGYDSIDILKKGIKELESACDRITETFNDAMQCKV  189 (639)
Q Consensus       154 ~~~~~P~eaLk~Al~~L~~~~~~L~~~F~~ai~~k~  189 (639)
                      +++.+|.++|++|+++|++.|+.+.+.|+++++.+.
T Consensus        78 ~~~~~p~~~l~~a~~~l~~~~~~l~~~f~~e~~~~~  113 (114)
T d1twfk_          78 TEGYDPKDALKNACNSIINKLGALKTNFETEWNLQT  113 (114)
T ss_dssp             CTTCCHHHHHHHHHHHHHHHHHHHHHHHHHHTTTCC
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcc
Confidence            999999999999999999999999999999998775
>d1fyva_ c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fyxa_ c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xppa_ d.74.3.2 (A:) DNA-directed RNA polymerase subunit L, RpoL {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1wmga_ a.77.1.2 (A:) Netrin receptor UNC5B {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d2za_ a.77.1.2 (A:) Pelle death domain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1ngra_ a.77.1.2 (A:) p75 low affinity neurotrophin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wh4a_ a.77.1.2 (A:) Interleukin-1 receptor-associated kinase 4, IRAK4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gf5a1 a.77.1.2 (A:89-191) FADD (Mort1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1icha_ a.77.1.2 (A:) Tumor necrosis factor receptor-1 death domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fada_ a.77.1.2 (A:) FADD (Mort1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ddfa_ a.77.1.2 (A:) Fas {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bdfa1 d.74.3.1 (A:2-52,A:179-232) RNA polymerase alpha {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1smya1 d.74.3.1 (A:1-49,A:173-229) RNA polymerase alpha {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1d2zb_ a.77.1.2 (B:) Tube death domain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1twfc1 d.74.3.1 (C:3-41,C:173-268) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fyxa_ c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure