Psyllid ID: psy1306

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MARDLELKQNFKLASVISFLPKAPMPWALPIIGHLHLLGQYEVPYQAFKVISKTHGSIFRLKLGVVPAIVVNGLENIKEVLFVKATDFDGRPNISRYNDLFSGNRENCK
cccHHHHHHHHHHHHcccccccccccccccHHcHHHHHccccccHHHHHHHHHHcccEEEEEEccccEEEEEcHHHHHHHHHHcccccccccccccccHHccccccccc
cccHHHHHHHccccccccccccccccccccEEHHHHEcccccccHHHHHHHHHHcccEEEEEEccccEEEEccHHHHHHHHHHcHHHHccccccccEEEEccccccccc
MARDLELKQNFKLASvisflpkapmpwalpiighlhllgqyevpYQAFKVISKTHGSIFRLKLGVVPAIVVNGLENIKEVLFVkatdfdgrpnisryndlfsgnrenck
MARDLELKQNFKLASVISFLPKAPMPWALPIIGHLHLLGQYEVPYQAFKVISKTHGSIFRLKLGVVPAIVVNGLENIKEVLfvkatdfdgrpnisryndlfsgnrenck
MARDLELKQNFKLASVISFLPKAPMPWALPIIGHLHLLGQYEVPYQAFKVISKTHGSIFRLKLGVVPAIVVNGLENIKEVLFVKATDFDGRPNISRYNDLFSGNRENCK
*********NFKLASVISFLPKAPMPWALPIIGHLHLLGQYEVPYQAFKVISKTHGSIFRLKLGVVPAIVVNGLENIKEVLFVKATDFDGRPNISRYN***********
MARDLELKQNF***************WALPIIGHLHLLGQYEVPYQAFKVISKTHGSIFRLKLGVVPAIVVNGLENIKEVLFVKATDFDGRPNISRYNDLFSGNRENC*
MARDLELKQNFKLASVISFLPKAPMPWALPIIGHLHLLGQYEVPYQAFKVISKTHGSIFRLKLGVVPAIVVNGLENIKEVLFVKATDFDGRPNISRYNDLFSGNRENCK
**RDLELKQNFKLASVISFLPKAPMPWALPIIGHLHLLGQYEVPYQAFKVISKTHGSIFRLKLGVVPAIVVNGLENIKEVLFVKATDFDGRPNISRYNDLFSG******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARDLELKQNFKLASVISFLPKAPMPWALPIIGHLHLLGQYEVPYQAFKVISKTHGSIFRLKLGVVPAIVVNGLENIKEVLFVKATDFDGRPNISRYNDLFSGNRENCK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query109 2.2.26 [Sep-21-2011]
Q9VRM7 543 Cytochrome P450 307a1 OS= yes N/A 0.788 0.158 0.425 7e-13
P00187 516 Cytochrome P450 1A2 OS=Or yes N/A 0.669 0.141 0.386 1e-11
P05176 518 Cytochrome P450 1A1 OS=Or yes N/A 0.761 0.160 0.341 1e-11
P24453 513 Cytochrome P450 1A2 OS=Me N/A N/A 0.752 0.159 0.333 6e-11
Q00557 524 Cytochrome P450 1A1 OS=Me N/A N/A 0.752 0.156 0.333 8e-11
Q6GUR1 512 Cytochrome P450 1A1 OS=Ma no N/A 0.761 0.162 0.329 9e-11
P33616 512 Cytochrome P450 1A1 OS=Ma N/A N/A 0.761 0.162 0.329 9e-11
Q3LFU0 516 Cytochrome P450 1A1 OS=Ba N/A N/A 0.761 0.160 0.317 1e-10
P04799 513 Cytochrome P450 1A2 OS=Ra yes N/A 0.752 0.159 0.333 2e-10
Q3LFT9 516 Cytochrome P450 1A2 OS=Ba N/A N/A 0.761 0.160 0.317 2e-10
>sp|Q9VRM7|CP307_DROME Cytochrome P450 307a1 OS=Drosophila melanogaster GN=spo PE=1 SV=3 Back     alignment and function desciption
 Score = 72.4 bits (176), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 37/87 (42%), Positives = 51/87 (58%), Gaps = 1/87 (1%)

Query: 22  KAPMPWALPIIGHLHLLGQY-EVPYQAFKVISKTHGSIFRLKLGVVPAIVVNGLENIKEV 80
           +AP P   PIIG+LHLL +Y + P+  F  +++ +G I+ L  G    +VVN LE I+EV
Sbjct: 54  QAPGPRPWPIIGNLHLLDRYRDSPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREV 113

Query: 81  LFVKATDFDGRPNISRYNDLFSGNREN 107
           L        GRP+  RY+ LF G R N
Sbjct: 114 LNQNGKVMSGRPDFIRYHKLFGGERSN 140
Required for correct development of the embryonic midline glial cells which are necessary for the formation of distinct segmental commissures.
Drosophila melanogaster (taxid: 7227)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|P00187|CP1A2_RABIT Cytochrome P450 1A2 OS=Oryctolagus cuniculus GN=CYP1A2 PE=1 SV=3 Back     alignment and function description
>sp|P05176|CP1A1_RABIT Cytochrome P450 1A1 OS=Oryctolagus cuniculus GN=CYP1A1 PE=2 SV=1 Back     alignment and function description
>sp|P24453|CP1A2_MESAU Cytochrome P450 1A2 OS=Mesocricetus auratus GN=CYP1A2 PE=1 SV=4 Back     alignment and function description
>sp|Q00557|CP1A1_MESAU Cytochrome P450 1A1 OS=Mesocricetus auratus GN=CYP1A1 PE=2 SV=2 Back     alignment and function description
>sp|Q6GUR1|CP1A1_MACMU Cytochrome P450 1A1 OS=Macaca mulatta GN=CYP1A1 PE=2 SV=1 Back     alignment and function description
>sp|P33616|CP1A1_MACFA Cytochrome P450 1A1 OS=Macaca fascicularis GN=CYP1A1 PE=2 SV=1 Back     alignment and function description
>sp|Q3LFU0|CP1A1_BALAC Cytochrome P450 1A1 OS=Balaenoptera acutorostrata GN=CYP1A1 PE=2 SV=1 Back     alignment and function description
>sp|P04799|CP1A2_RAT Cytochrome P450 1A2 OS=Rattus norvegicus GN=Cyp1a2 PE=1 SV=2 Back     alignment and function description
>sp|Q3LFT9|CP1A2_BALAC Cytochrome P450 1A2 OS=Balaenoptera acutorostrata GN=CYP1A2 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query109
91085043 487 PREDICTED: similar to cytochrome P450 [T 0.798 0.178 0.563 3e-22
170029558 515 cytochrome P450 307a1 [Culex quinquefasc 0.926 0.196 0.568 1e-21
157103962 536 cytochrome P450 [Aedes aegypti] gi|15711 0.844 0.171 0.576 1e-21
307197088 506 Cytochrome P450 307a1 [Harpegnathos salt 0.779 0.167 0.579 2e-21
193676474 507 PREDICTED: cytochrome P450 307a1-like [A 0.917 0.197 0.490 2e-20
322794093 506 hypothetical protein SINV_01048 [Solenop 0.779 0.167 0.534 9e-20
312378767 544 hypothetical protein AND_09593 [Anophele 0.825 0.165 0.555 5e-19
307180605 505 Cytochrome P450 307a1 [Camponotus florid 0.770 0.166 0.545 1e-18
332019294 505 Cytochrome P450 307a1 [Acromyrmex echina 0.706 0.152 0.589 3e-18
158293444 507 AGAP008682-PA [Anopheles gambiae str. PE 0.779 0.167 0.564 7e-18
>gi|91085043|ref|XP_974280.1| PREDICTED: similar to cytochrome P450 [Tribolium castaneum] gi|270009225|gb|EFA05673.1| cytochrome P450 307B1 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 60/87 (68%)

Query: 22  KAPMPWALPIIGHLHLLGQYEVPYQAFKVISKTHGSIFRLKLGVVPAIVVNGLENIKEVL 81
           + P P  LPIIGHLHL+  Y+VPYQAF  +SK  GS+F L+LG V  +V+NG +NI+E L
Sbjct: 34  RPPSPLKLPIIGHLHLMSGYQVPYQAFTSLSKKFGSVFGLQLGYVKCVVINGQKNIREAL 93

Query: 82  FVKATDFDGRPNISRYNDLFSGNRENC 108
             K   FD RPN  RY  LFSGN+EN 
Sbjct: 94  VTKGHHFDSRPNFERYQQLFSGNKENS 120

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|170029558|ref|XP_001842659.1| cytochrome P450 307a1 [Culex quinquefasciatus] gi|167863243|gb|EDS26626.1| cytochrome P450 307a1 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|157103962|ref|XP_001648198.1| cytochrome P450 [Aedes aegypti] gi|157114441|ref|XP_001652272.1| cytochrome P450 [Aedes aegypti] gi|108869293|gb|EAT33518.1| AAEL014208-PA [Aedes aegypti] gi|108877262|gb|EAT41487.1| AAEL006875-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|307197088|gb|EFN78456.1| Cytochrome P450 307a1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|193676474|ref|XP_001948715.1| PREDICTED: cytochrome P450 307a1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|322794093|gb|EFZ17302.1| hypothetical protein SINV_01048 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|312378767|gb|EFR25248.1| hypothetical protein AND_09593 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|307180605|gb|EFN68560.1| Cytochrome P450 307a1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332019294|gb|EGI59802.1| Cytochrome P450 307a1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|158293444|ref|XP_314781.4| AGAP008682-PA [Anopheles gambiae str. PEST] gi|157016709|gb|EAA10112.4| AGAP008682-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query109
FB|FBgn0086917 553 spok "spookier" [Drosophila me 0.752 0.148 0.447 2.7e-13
FB|FBgn0003486 543 spo "spook" [Drosophila melano 0.752 0.151 0.435 1.5e-12
UNIPROTKB|P00187 516 CYP1A2 "Cytochrome P450 1A2" [ 0.715 0.151 0.378 3.5e-11
UNIPROTKB|A4F3W0189 CYP1A1 "Cytochrome P450 1A1" [ 0.752 0.433 0.321 7.4e-11
UNIPROTKB|E1BY32 495 CYP2B7P1 "Uncharacterized prot 0.733 0.161 0.407 1.4e-10
UNIPROTKB|P24453 513 CYP1A2 "Cytochrome P450 1A2" [ 0.752 0.159 0.333 1.5e-10
RGD|2459 513 Cyp1a2 "cytochrome P450, famil 0.752 0.159 0.333 2.5e-10
UNIPROTKB|P04799 513 Cyp1a2 "Cytochrome P450 1A2" [ 0.752 0.159 0.333 2.5e-10
RGD|2458 524 Cyp1a1 "cytochrome P450, famil 0.752 0.156 0.333 3.3e-10
UNIPROTKB|E7EMT5 483 CYP1A1 "Cytochrome P450 1A1" [ 0.752 0.169 0.321 6.1e-10
FB|FBgn0086917 spok "spookier" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 183 (69.5 bits), Expect = 2.7e-13, P = 2.7e-13
 Identities = 38/85 (44%), Positives = 54/85 (63%)

Query:    24 PMPWALPIIGHLHLLGQYEV-PYQAFKVISKTHGSIFRLKLGVVPAIVVNGLENIKEVLF 82
             P PW  PIIG+++LLG+++  P+  F  ++K +G I+ L LG    IVVN ++ IKEVL 
Sbjct:    54 PHPW--PIIGNINLLGRFQYNPFYGFGTLTKKYGDIYSLSLGHTRCIVVNNVDLIKEVLN 111

Query:    83 VKATDFDGRPNISRYNDLFSGNREN 107
                  F GRP+  RY+ LF G+R N
Sbjct:   112 KNGKYFGGRPDFFRYHKLFGGDRNN 136
GO:0020037 "heme binding" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005506 "iron ion binding" evidence=IEA
GO:0007591 "molting cycle, chitin-based cuticle" evidence=IMP
GO:0006697 "ecdysone biosynthetic process" evidence=IMP
FB|FBgn0003486 spo "spook" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|P00187 CYP1A2 "Cytochrome P450 1A2" [Oryctolagus cuniculus (taxid:9986)] Back     alignment and assigned GO terms
UNIPROTKB|A4F3W0 CYP1A1 "Cytochrome P450 1A1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BY32 CYP2B7P1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P24453 CYP1A2 "Cytochrome P450 1A2" [Mesocricetus auratus (taxid:10036)] Back     alignment and assigned GO terms
RGD|2459 Cyp1a2 "cytochrome P450, family 1, subfamily a, polypeptide 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P04799 Cyp1a2 "Cytochrome P450 1A2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|2458 Cyp1a1 "cytochrome P450, family 1, subfamily a, polypeptide 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E7EMT5 CYP1A1 "Cytochrome P450 1A1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
pfam00067 461 pfam00067, p450, Cytochrome P450 2e-11
PLN02655 466 PLN02655, PLN02655, ent-kaurene oxidase 7e-08
PLN02183 516 PLN02183, PLN02183, ferulate 5-hydroxylase 9e-08
PLN03112 514 PLN03112, PLN03112, cytochrome P450 family protein 2e-07
PLN03234 499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 2e-06
PTZ00404 482 PTZ00404, PTZ00404, cytochrome P450; Provisional 4e-06
PLN02687 517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 5e-06
PLN02394 503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 2e-05
PLN00110 504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 3e-04
PLN02966 502 PLN02966, PLN02966, cytochrome P450 83A1 7e-04
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information 
 Score = 58.8 bits (143), Expect = 2e-11
 Identities = 30/82 (36%), Positives = 43/82 (52%)

Query: 24  PMPWALPIIGHLHLLGQYEVPYQAFKVISKTHGSIFRLKLGVVPAIVVNGLENIKEVLFV 83
           P P  LP+ G+L  LG+    +  F  + K +G IFRL LG  P +V++G E +KEVL  
Sbjct: 2   PGPPPLPLFGNLLQLGRKGNLHSVFTKLQKKYGPIFRLYLGPKPVVVLSGPEAVKEVLIK 61

Query: 84  KATDFDGRPNISRYNDLFSGNR 105
           K  +F GRP+   +        
Sbjct: 62  KGEEFSGRPDEPWFATSRGPFL 83

Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures. Length = 461
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 109
KOG0156|consensus 489 99.72
PLN02655 466 ent-kaurene oxidase 99.51
PLN00110 504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.47
PLN03112 514 cytochrome P450 family protein; Provisional 99.46
PLN02183 516 ferulate 5-hydroxylase 99.41
PLN02687 517 flavonoid 3'-monooxygenase 99.41
PLN02971 543 tryptophan N-hydroxylase 99.4
PLN03234 499 cytochrome P450 83B1; Provisional 99.37
PLN00168 519 Cytochrome P450; Provisional 99.37
PLN03141 452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 99.36
PTZ00404 482 cytochrome P450; Provisional 99.36
PLN02394 503 trans-cinnamate 4-monooxygenase 99.31
PLN02966 502 cytochrome P450 83A1 99.3
PF00067 463 p450: Cytochrome P450 p450 superfamily signature b 99.3
PLN02774 463 brassinosteroid-6-oxidase 99.27
PLN02290 516 cytokinin trans-hydroxylase 99.26
PLN02196 463 abscisic acid 8'-hydroxylase 99.26
PLN02987 472 Cytochrome P450, family 90, subfamily A 99.24
PLN02500 490 cytochrome P450 90B1 99.21
PLN03018 534 homomethionine N-hydroxylase 99.17
KOG0157|consensus 497 99.17
PLN02302 490 ent-kaurenoic acid oxidase 99.05
PLN02169 500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.05
PLN03195 516 fatty acid omega-hydroxylase; Provisional 98.92
KOG0158|consensus 499 98.91
PLN02936 489 epsilon-ring hydroxylase 98.86
PLN02648 480 allene oxide synthase 98.75
PLN02738 633 carotene beta-ring hydroxylase 98.57
KOG0684|consensus 486 98.46
KOG0159|consensus 519 98.32
PLN02426 502 cytochrome P450, family 94, subfamily C protein 97.01
>KOG0156|consensus Back     alignment and domain information 
Probab=99.72  E-value=3.5e-17  Score=115.97  Aligned_cols=81  Identities=40%  Similarity=0.670  Sum_probs=73.1

Q ss_pred             CCCCCCCCCCceeecccccCCCCcHHHHHHHHHHHcCCeeEEecCCccEEEEeCHHHHHHHHhhCCCCCCCCCC-hhhhh
Q psy1306          20 LPKAPMPWALPIIGHLHLLGQYEVPYQAFKVISKTHGSIFRLKLGVVPAIVVNGLENIKEVLFVKATDFDGRPN-ISRYN   98 (109)
Q Consensus        20 ~~~~pgp~~~~~~G~~~~~~~~~~~~~~~~~~~~~~g~i~~~~~~~~~~v~i~~p~~~~~il~~~~~~~~~r~~-~~~~~   98 (109)
                      .+.||||+++|++||++++... .++..+.++.++||+++.+|+|..|+|+++|+++++|+|.+++..|++||. .....
T Consensus        25 ~~lPPGP~~lPiIGnl~~l~~~-~~h~~~~~ls~~yGpi~tl~lG~~~~Vviss~~~akE~l~~~d~~fa~Rp~~~~~~~  103 (489)
T KOG0156|consen   25 RNLPPGPPPLPIIGNLHQLGSL-PPHRSFRKLSKKYGPVFTLRLGSVPVVVISSYEAAKEVLVKQDLEFADRPDPTATLK  103 (489)
T ss_pred             CCCCcCCCCCCccccHHHcCCC-chhHHHHHHHHHhCCeEEEEecCceEEEECCHHHHHHHHHhCCccccCCCCchhhHH
Confidence            6789999999999999999884 599999999999999999999999999999999999999999999999997 23444


Q ss_pred             hhh
Q psy1306          99 DLF  101 (109)
Q Consensus        99 ~~~  101 (109)
                      .+.
T Consensus       104 ~~~  106 (489)
T KOG0156|consen  104 YLS  106 (489)
T ss_pred             Hhc
Confidence            444

>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>KOG0157|consensus Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>KOG0158|consensus Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>KOG0684|consensus Back     alignment and domain information
>KOG0159|consensus Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
4i8v_A 491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 1e-11
2hi4_A 495 Crystal Structure Of Human Microsomal P450 1a2 In C 9e-10
3pm0_A 507 Structural Characterization Of The Complex Between 5e-08
3ruk_A 494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 3e-06
1pq2_A 476 Crystal Structure Of Human Drug Metabolizing Cytoch 3e-06
1og2_A 475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 3e-06
1r9o_A 477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 4e-06
3qz1_A 496 Crystal Structure Of Bovine Steroid Of 21-Hydroxyla 8e-06
2p85_A 476 Structure Of Human Lung Cytochrome P450 2a13 With I 8e-06
4h1n_A 479 Crystal Structure Of P450 2b4 F297a Mutant In Compl 1e-05
2q6n_A 478 Structure Of Cytochrome P450 2b4 With Bound 1-(4- C 1e-05
3tk3_A 476 Cytochrome P450 2b4 Mutant L437a In Complex With 4- 2e-05
1po5_A 476 Structure Of Mammalian Cytochrome P450 2b4 Length = 2e-05
1suo_A 476 Structure Of Mammalian Cytochrome P450 2b4 With Bou 2e-05
2pg6_A 476 Crystal Structure Of Human Microsomal P450 2a6 L240 3e-05
1z10_A 476 Crystal Structure Of Human Microsomal P450 2a6 With 3e-05
3ebs_A 476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 3e-05
2pg7_A 476 Crystal Structure Of Human Microsomal P450 2a6 N297 3e-05
2pg5_A 476 Crystal Structure Of Human Microsomal P450 2a6 N297 3e-05
1dt6_A 473 Structure Of Mammalian Cytochrome P450 2c5 Length = 4e-05
3e4e_A 476 Human Cytochrome P450 2e1 In Complex With The Inhib 4e-05
4gqs_A 477 Structure Of Human Microsomal Cytochrome P450 (cyp) 3e-04
3ibd_A 476 Crystal Structure Of A Cytochrome P450 2b6 Genetic 4e-04
3c6g_A 479 Crystal Structure Of Cyp2r1 In Complex With Vitamin 6e-04
3czh_A 481 Crystal Structure Of Cyp2r1 In Complex With Vitamin 6e-04
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure 
Iteration: 1

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 51/85 (60%), Gaps = 2/85 (2%)
Query: 20  LPKAPMPWALPIIGHLHLLGQYEVPYQAFKVISKTHGSIFRLKLGVVPAIVVNGLENIKE 79
           L   P PW  P+IGH+  LG+   P+ A   +S+ +G + ++++G  P +V++GL+ I++
Sbjct: 10  LKNPPGPWGWPLIGHMLTLGKN--PHLALSRMSQQYGDVLQIRIGSTPVVVLSGLDTIRQ 67
Query: 80  VLFVKATDFDGRPNISRYNDLFSGN 104
            L  +  DF GRP++  +  + +G 
Sbjct: 68  ALVRQGDDFKGRPDLYTFTLISNGQ 92
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure
>pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 Back     alignment and structure
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure
>pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 Back     alignment and structure
>pdb|2Q6N|A Chain A, Structure Of Cytochrome P450 2b4 With Bound 1-(4- Cholorophenyl)imidazole Length = 478 Back     alignment and structure
>pdb|3TK3|A Chain A, Cytochrome P450 2b4 Mutant L437a In Complex With 4-(4-Chlorophenyl) Imidazole Length = 476 Back     alignment and structure
>pdb|1PO5|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 Length = 476 Back     alignment and structure
>pdb|1SUO|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 With Bound 4-(4- Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure
>pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|3IBD|A Chain A, Crystal Structure Of A Cytochrome P450 2b6 Genetic Variant In Complex With The Inhibitor 4-(4-Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|3C6G|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D3 Length = 479 Back     alignment and structure
>pdb|3CZH|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D2 Length = 481 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 2e-21
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 3e-20
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 4e-20
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 9e-19
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 2e-18
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 5e-18
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 5e-18
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 6e-18
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 5e-17
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 5e-17
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 1e-14
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 5e-13
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 5e-13
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 6e-13
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 7e-13
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 2e-10
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 2e-10
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 5e-09
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 7e-08
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 8e-08
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 2e-07
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 5e-07
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 3e-06
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 5e-06
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
 Score = 86.4 bits (215), Expect = 2e-21
 Identities = 21/82 (25%), Positives = 41/82 (50%)

Query: 24  PMPWALPIIGHLHLLGQYEVPYQAFKVISKTHGSIFRLKLGVVPAIVVNGLENIKEVLFV 83
               +LP++G L  L ++   +  F  + K +G I+ +++G    ++V   +  KEVL  
Sbjct: 11  KSLLSLPLVGSLPFLPRHGHMHNNFFKLQKKYGPIYSVRMGTKTTVIVGHHQLAKEVLIK 70

Query: 84  KATDFDGRPNISRYNDLFSGNR 105
           K  DF GRP ++  +   +  +
Sbjct: 71  KGKDFSGRPQMATLDIASNNRK 92
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query109
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 99.7
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.59
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 99.57
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.56
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.49
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.44
3ld6_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.43
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.41
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.41
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.41
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.36
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.36
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.36
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 99.33
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.33
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.29
3v8d_A 491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.24
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 99.21
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 99.2
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 99.12
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 99.11
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.1
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 99.09
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 99.07
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 98.97
2cd8_A 436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 98.93
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 98.73
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 98.55
1ued_A 406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 98.42
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 98.41
1jfb_A 404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 98.37
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 98.36
2zbx_A 412 Cytochrome P450-SU1; beta prism, heme, iron, metal 98.25
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 98.13
1cpt_A 428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 97.95
1z8o_A 404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 97.92
1s1f_A 406 Putative cytochrome P450; cytochrome P450 oxidored 97.91
3dan_A 473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 97.86
3ivy_A 433 Cytochrome P450 CYP125; cholesterol, monooxygenase 97.83
2zwu_A 415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 97.8
3abb_A 408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 97.8
3a4g_A 411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 97.79
3oo3_A 384 OXY protein; cytochrome P450, monooxygenase, PCD-t 97.79
3ejb_B 404 Biotin biosynthesis cytochrome P450-like enzyme; p 97.78
4fb2_A 398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 97.72
1odo_A 408 Putative cytochrome P450 154A1; P450 monooxygenase 97.7
2z36_A 413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 97.66
3aba_A 403 Cytochrome P450; oxidoreductase, heme, monooxygena 97.58
1gwi_A 411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 97.55
2y5n_A 417 MYCG, P-450-like protein; oxidoreductase, mycinami 97.55
2xbk_A 404 PIMD protein; epoxidation, oxidoreductase; HET: HE 97.53
2jjn_A 411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 97.51
1n40_A 396 P450 MT2, cytochrome P450 121; heme binding, oxyge 97.51
2z3t_A 425 Cytochrome P450; monoxygenase, oxydoreductase, hem 97.45
2wm5_A 435 CYP124, putative cytochrome P450 124; metal-bindin 97.38
1q5d_A 419 P450 epoxidase; cytochrome P450, epothilone, oxydo 97.35
3tyw_A 417 Putative cytochrome P450; P450 monooxygenase, oxid 97.26
3lxh_A 421 Cytochrome P450; heme, iron, metal-binding, monoox 97.26
2uuq_A 414 CYP130, cytochrome P450 130; iron, heme, monooxyge 97.25
3nc3_A 441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 97.13
3tkt_A 450 Cytochrome P450; aromatic hydrocarbon binding of P 97.07
3oft_A 396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 97.05
2dkk_A 411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 96.97
3mgx_A 415 Putative P450 monooxygenase; cytochrome P450 oxida 96.84
2xkr_A 398 CYP142, putative cytochrome P450 142; oxidoreducta 96.68
3r9b_A 418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 96.47
3buj_A 397 CALO2; heme, iron, metal-binding, monooxygenase, o 96.24
1io7_A 368 Cytochrome P450 CYP119; thermophilic, cytochromo P 96.21
1lfk_A 398 OXYB, P450 monooxygenase; oxidative phenol couplin 96.08
3rwl_A 426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 96.03
3b4x_A 367 367AA long hypothetical cytochrome P450; HEM prote 95.97
2rfb_A 343 Cytochrome P450; heme, iron, metal-binding, monoox 95.03
2yjn_B 381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 94.4
3p3o_A 416 Cytochrome P450; monooxygenase, oxidoreductase; HE 90.61
4dnj_A 412 Putative cytochrome P450; oxidoreductase; HET: HEM 90.49
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
Probab=99.70  E-value=5.1e-17  Score=112.51  Aligned_cols=83  Identities=28%  Similarity=0.421  Sum_probs=71.1

Q ss_pred             hhcCCCCCCCCCCceeecccccCCCCcHHHHHHHHHHHcCCeeEEecCCccEEEEeCHHHHHHHHhhCCCCCCCCCChhh
Q psy1306          17 ISFLPKAPMPWALPIIGHLHLLGQYEVPYQAFKVISKTHGSIFRLKLGVVPAIVVNGLENIKEVLFVKATDFDGRPNISR   96 (109)
Q Consensus        17 ~~~~~~~pgp~~~~~~G~~~~~~~~~~~~~~~~~~~~~~g~i~~~~~~~~~~v~i~~p~~~~~il~~~~~~~~~r~~~~~   96 (109)
                      .++.+.||||+++|++||+.++... +....+.+|.++||+||++++|+.++|+++||+++++||.+++..|++|+....
T Consensus         6 ss~~kLPPGP~~lP~iGn~~~~~~~-~~~~~~~~~~~kYG~i~~~~~g~~~~vvv~~p~~i~~vl~~~~~~f~~r~~~~~   84 (479)
T 3tbg_A            6 SSKGKLPPGPLPLPGLGNLLHVDFQ-NTPYCFDQLRRRFGDVFSLQLAWTPVVVLNGLAAVREALVTHGEDTADRPPVPI   84 (479)
T ss_dssp             ---CCCCCCSCCBTTTBTGGGCCTT-SHHHHHHHHHHHHCSEEEEEETTEEEEEEEHHHHHHHHHTTTGGGSCBCCCCGG
T ss_pred             CCCCCCCCCCCCcCcccchHhhcCC-CHHHHHHHHHHHhCCEEEEEECCeeEEEECCHHHHHHHHHhCChhhcCCCchHH
Confidence            3445789999999999999988654 788899999999999999999999999999999999999988888998887665


Q ss_pred             hhhh
Q psy1306          97 YNDL  100 (109)
Q Consensus        97 ~~~~  100 (109)
                      ...+
T Consensus        85 ~~~~   88 (479)
T 3tbg_A           85 TQIL   88 (479)
T ss_dssp             GGGG
T ss_pred             HHHh
Confidence            5544
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 109
d3czha1 463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 5e-18
d1r9oa_ 467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 5e-18
d1po5a_ 465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 9e-18
d2ij2a1 453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 1e-17
d2ciba1 445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 3e-17
d1tqna_ 472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 2e-13
d1n97a_ 385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 5e-09
d1izoa_ 411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 1e-08
d1odoa_ 401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 4e-07
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Vitamin D 25-hydroxylase Cyp2R1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 75.5 bits (184), Expect = 5e-18
 Identities = 25/82 (30%), Positives = 43/82 (52%), Gaps = 1/82 (1%)

Query: 24  PMPWALPIIGHLHLLGQY-EVPYQAFKVISKTHGSIFRLKLGVVPAIVVNGLENIKEVLF 82
           P P  LP IG+++ L    E+P+   +  S+ +G IF L LG +  +V+NG + +KE L 
Sbjct: 2   PGPPGLPFIGNIYSLAASSELPHVYMRKQSQVYGEIFSLDLGGISTVVLNGYDVVKECLV 61

Query: 83  VKATDFDGRPNISRYNDLFSGN 104
            ++  F  RP +  +  +    
Sbjct: 62  HQSEIFADRPCLPLFMKMTKMG 83
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query109
d1r9oa_ 467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 99.67
d1po5a_ 465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 99.64
d3czha1 463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 99.61
d1tqna_ 472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 99.52
d2ij2a1 453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.51
d2ciba1 445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 99.45
d1izoa_ 411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 98.74
d1n97a_ 385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 98.23
d1odoa_ 401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 97.94
d1z8oa1 402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 97.08
d1gwia_ 403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 96.7
d1ueda_ 403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 96.46
d1s1fa_ 399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 94.23
d1q5da_ 401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 93.98
d1jfba_ 399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 93.73
d1cpta_ 428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 92.44
d1re9a_ 404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 91.78
d1lfka_ 394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 80.48
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome p450 2c9
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.67  E-value=4e-17  Score=110.44  Aligned_cols=86  Identities=28%  Similarity=0.420  Sum_probs=68.9

Q ss_pred             CCCCCCCCCCceeecccccCCCCcHHHHHHHHHHHcCCeeEEecCCccEEEEeCHHHHHHHHhhCCCCCCCCCChhhhhh
Q psy1306          20 LPKAPMPWALPIIGHLHLLGQYEVPYQAFKVISKTHGSIFRLKLGVVPAIVVNGLENIKEVLFVKATDFDGRPNISRYND   99 (109)
Q Consensus        20 ~~~~pgp~~~~~~G~~~~~~~~~~~~~~~~~~~~~~g~i~~~~~~~~~~v~i~~p~~~~~il~~~~~~~~~r~~~~~~~~   99 (109)
                      .+.||||+++|++||+..+... ++..++.++.++||++|++++++.++|+++||+++++||.+++..|++++.......
T Consensus         2 ~~lPPGP~~~P~lG~~~~l~~~-~~~~~~~~~~~kyG~i~~~~~g~~~~vvv~dpe~i~~il~~~~~~f~~r~~~~~~~~   80 (467)
T d1r9oa_           2 GKLPPGPTPLPVIGNILQIGIK-DISKSLTNLSKVYGPVFTLYFGLKPIVVLHGYEAVKEALIDLGEEFSGRGIFPLAER   80 (467)
T ss_dssp             CBCCCCSSSCC-----CCBCHH-HHHHHHHHHHHHHCSEEEEESSSCEEEEECSHHHHHHHHTTTTTTTCEECCCSCCCT
T ss_pred             CCCCcCCCCCCccccHHHhCCc-CHHHHHHHHHHHhCCEEEEEECCeeEEEECCHHHHHHHHHhCCcccCCCCcchhhhh
Confidence            4678999999999999988654 788899999999999999999999999999999999999988888988776665555


Q ss_pred             hhCCCCc
Q psy1306         100 LFSGNRE  106 (109)
Q Consensus       100 ~~~g~~~  106 (109)
                      ...|.+.
T Consensus        81 ~~~g~~l   87 (467)
T d1r9oa_          81 ANRGFGI   87 (467)
T ss_dssp             TTCTTSS
T ss_pred             cCCCCce
Confidence            5555544
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure