Psyllid ID: psy13284

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230
MLDYYKVLGVDKQSSTGDIKKASHSSMLDYYKVLGVDKQSSTGDIKKAYRKLALKWHPDKNPDNQSEANKKFKEISEAYEVLSDEKKRRIYDDRGKGGYEDSRQRGRYRSQAKYDDDHDDDFGGFHRGFRFRDPEDVFREFFGSASPFNDIFGIRPRNNRGDETQLFHTGPLGFHNLGDIFSHSDAFSSFGGFDFNSSGRGGAAVKTTSTSTRFIDGKKVTTKKMAFMNS
cccccEEccccccccccccccccccccccHHHHccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccEEEEEccEEEEEEEEEEccc
cccEEEEEEccccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccccccccccccccccccccccccccccccccEEccccHHHHHHHHHccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcEEEEccEEEEEEEEEEEcc
MLDYYKVLgvdkqsstgdikkashssmLDYYKVLgvdkqsstgdIKKAYRKLALKwhpdknpdnqseANKKFKEISEAYEVLSdekkrriyddrgkggyedsrqrgryrsqakydddhdddfggfhrgfrfrdpedvfreffgsaspfndifgirprnnrgdetqlfhtgplgfhnlgdifshsdafssfggfdfnssgrggaavkttststrfidgkkvtTKKMAFMNS
MLDYYKVLgvdkqsstgdikkashssmLDYYKVLgvdkqsstgDIKKAYRKLAlkwhpdknpdnqseankkFKEISEAyevlsdekkrriyddrgkggyedsrqrgryrsqakydddhdddFGGFHRGFRFRDPEDVFREFFGsaspfndifgirprNNRGDETQLFHTGPLGFHNLGDIFSHSDAFSSFGGFdfnssgrggaavkttststrfidgkkvttkkmafmns
MLDYYKVLGVDKQSSTGDIKKASHSSMLDYYKVLGVDKQSSTGDIKKAYRKLALKWHPDKNPDNQSEANKKFKEISEAYEVLSDEKKRRIYDDRGKGGYEDSRQRGRYRSQAKYdddhdddfggfhrgfrfrdPEDVFREFFGSASPFNDIFGIRPRNNRGDETQLFHTGPLGFHNLGDIfshsdafssfggfdfnssgrggAAVKTTSTSTRFIDGKKVTTKKMAFMNS
******V*******************MLDYYKVLGVD*******IKKAYRKLALKW*****************************************************************FGGFHRGFRFRDPEDVFREFFGSASPFNDIFGIRPRNNRGDETQLFHTGPLGFHNLGDIFSHSDAFSSFGGFDF***********************************
*LDYYKVLGVD*************SSMLDYYKVLGVDKQSSTGDIKKAYRKLALKWHPDKNPDNQSEANKKFKEISEAYEVLSDEKKRRIYDDRG**************************FGGFHRGFRFRDPEDVFREFFGSASPFN**************************************************************TRFIDGKKVTTKKMAF***
MLDYYKVLGVDKQSSTGDIKKASHSSMLDYYKVLGVDKQSSTGDIKKAYRKLALKWHPDKNPDNQSEANKKFKEISEAYEVLSDEKKRRIYDDRGKGGYEDSRQRGRYRSQAKYDDDHDDDFGGFHRGFRFRDPEDVFREFFGSASPFNDIFGIRPRNNRGDETQLFHTGPLGFHNLGDIFSHSDAFSSFGGFDFNSS***********TSTRFIDGKKVTTKKMAFMNS
*LDYYKVLGVDKQSSTGDIKK*SHSSMLDYYKVLGVDKQSSTGDIKKAYRKLALKWHPDKNPDNQSEANKKFKEISEAYEVLSDEKKRRIYDDRGKGGYE*******************DDFGGFHRGFRFRDPEDVFREFFGSASPFNDIFGIRPRN****ETQLFHTGPLGFHNLGDIFSHSDAFSSFGGFDFNSSGRGGAAVKTTSTSTRFIDGKKVTTKKMAFMNS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLDYYKVLGVDKQSSTGDIKKASHSSMLDYYKVLGVDKQSSTGDIKKAYRKLALKWHPDKNPDNQSEANKKFKEISEAYEVLSDEKKRRIYDDRGKGGYEDSRQRGRYRSQAKYDDDHDDDFGGFHRGFRFRDPEDVFREFFGSASPFNDIFGIRPRNNRGDETQLFHTGPLGFHNLGDIFSHSDAFSSFGGFDFNSSGRGGAAVKTTSTSTRFIDGKKVTTKKMAFMNS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query230 2.2.26 [Sep-21-2011]
Q9QYI7227 DnaJ homolog subfamily B yes N/A 0.778 0.788 0.437 2e-37
Q862Z4242 DnaJ homolog subfamily B N/A N/A 0.8 0.760 0.423 8e-34
Q5F3Z5 326 DnaJ homolog subfamily B yes N/A 0.795 0.561 0.424 1e-33
Q0III6242 DnaJ homolog subfamily B no N/A 0.795 0.756 0.436 2e-33
Q4R7Y5241 DnaJ homolog subfamily B N/A N/A 0.817 0.780 0.438 3e-33
O54946 365 DnaJ homolog subfamily B no N/A 0.8 0.504 0.446 3e-33
Q9QYI5277 DnaJ homolog subfamily B no N/A 0.782 0.649 0.428 4e-33
O35723242 DnaJ homolog subfamily B no N/A 0.821 0.780 0.429 8e-33
Q5R8H0 326 DnaJ homolog subfamily B yes N/A 0.795 0.561 0.429 2e-32
O75190 326 DnaJ homolog subfamily B no N/A 0.795 0.561 0.429 2e-32
>sp|Q9QYI7|DNJB8_MOUSE DnaJ homolog subfamily B member 8 OS=Mus musculus GN=Dnajb8 PE=2 SV=1 Back     alignment and function desciption
 Score =  155 bits (393), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 94/215 (43%), Positives = 121/215 (56%), Gaps = 36/215 (16%)

Query: 27  MLDYYKVLGVDKQSSTGDIKKAYRKLALKWHPDKNPDNQSEANKKFKEISEAYEVLSDEK 86
           M +YY+VLGV   +S  DIKKAYRKLAL+WHPDKNPDN+ EA KKFK++SEAYEVLSD K
Sbjct: 1   MANYYEVLGVQSSASPEDIKKAYRKLALRWHPDKNPDNKEEAEKKFKQVSEAYEVLSDSK 60

Query: 87  KRRIYDDRGKGGYEDSRQRGRYRSQAKYDDDHDDDFGGFHRGFRFRDPEDVFREFFGSAS 146
           KR +YD  G           R+R+    +  H   FG    G+ FR+PED+FREFFG   
Sbjct: 61  KRSVYDRAGC---------DRWRAGGGANVPHSSPFGA---GYPFRNPEDIFREFFGGLD 108

Query: 147 PFNDIFGIRPRNNRGDETQLFHTGPLGFHNLGDIFSHSDAFSSFGGFDFNSSGRGGAAVK 206
           PF+  F   P + RG    L    P GF   G+  +  +A SS     FN+ G GG +  
Sbjct: 109 PFSFEFWDTPFSGRGRPHGLHRVFPSGF---GEFPAFMEALSS-----FNTLGHGGGSRS 160

Query: 207 T----------------TSTSTRFIDGKKVTTKKM 225
           T                  +ST  ++G+KVTTK++
Sbjct: 161 TFSSASFGGSGSSGFKSVMSSTEMVNGRKVTTKRI 195

Mus musculus (taxid: 10090)
>sp|Q862Z4|DNJB3_MACFU DnaJ homolog subfamily B member 3 OS=Macaca fuscata fuscata GN=DNAJB3 PE=2 SV=1 Back     alignment and function description
>sp|Q5F3Z5|DNJB6_CHICK DnaJ homolog subfamily B member 6 OS=Gallus gallus GN=DNAJB6 PE=2 SV=1 Back     alignment and function description
>sp|Q0III6|DNJB6_BOVIN DnaJ homolog subfamily B member 6 OS=Bos taurus GN=DNAJB6 PE=2 SV=1 Back     alignment and function description
>sp|Q4R7Y5|DNJB6_MACFA DnaJ homolog subfamily B member 6 OS=Macaca fascicularis GN=DNAJB6 PE=2 SV=1 Back     alignment and function description
>sp|O54946|DNJB6_MOUSE DnaJ homolog subfamily B member 6 OS=Mus musculus GN=Dnajb6 PE=1 SV=4 Back     alignment and function description
>sp|Q9QYI5|DNJB2_MOUSE DnaJ homolog subfamily B member 2 OS=Mus musculus GN=Dnajb2 PE=2 SV=2 Back     alignment and function description
>sp|O35723|DNJB3_MOUSE DnaJ homolog subfamily B member 3 OS=Mus musculus GN=Dnajb3 PE=2 SV=1 Back     alignment and function description
>sp|Q5R8H0|DNJB6_PONAB DnaJ homolog subfamily B member 6 OS=Pongo abelii GN=DNAJB6 PE=2 SV=1 Back     alignment and function description
>sp|O75190|DNJB6_HUMAN DnaJ homolog subfamily B member 6 OS=Homo sapiens GN=DNAJB6 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query230
357621007232 DnaJ-like protein 4 [Danaus plexippus] 0.834 0.827 0.504 4e-46
307169918289 DnaJ-like protein subfamily B member 6 [ 0.813 0.647 0.520 8e-44
255652883236 DnaJ (Hsp40) homolog 4 [Bombyx mori] gi| 0.834 0.813 0.509 1e-43
383851407276 PREDICTED: dnaJ homolog subfamily B memb 0.808 0.673 0.526 3e-43
328784860323 PREDICTED: dnaJ homolog subfamily B memb 0.813 0.578 0.522 4e-43
350424718330 PREDICTED: dnaJ homolog subfamily B memb 0.813 0.566 0.518 4e-43
380020528323 PREDICTED: dnaJ homolog subfamily B memb 0.813 0.578 0.522 4e-43
345490265317 PREDICTED: dnaJ homolog subfamily B memb 0.804 0.583 0.467 4e-41
157109512254 hypothetical protein AaeL_AAEL005305 [Ae 0.843 0.763 0.469 6e-40
24654066259 mrj, isoform A [Drosophila melanogaster] 0.839 0.745 0.443 1e-39
>gi|357621007|gb|EHJ72993.1| DnaJ-like protein 4 [Danaus plexippus] Back     alignment and taxonomy information
 Score =  190 bits (483), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 138/210 (65%), Gaps = 18/210 (8%)

Query: 27  MLDYYKVLGVDKQSSTGDIKKAYRKLALKWHPDKNPDNQSEANKKFKEISEAYEVLSDEK 86
           M+DYY++LGV + S+  +IKKAYRKLALKWHPDKNPDN  EAN++FKEISEAYEVLSDE+
Sbjct: 1   MVDYYRILGVSRSSTDAEIKKAYRKLALKWHPDKNPDNADEANRRFKEISEAYEVLSDER 60

Query: 87  KRRIYDDRGKGGYEDSRQRGRYRSQAKYDDDHDDDFGGFHRGFRFRDPEDVFREFFGSAS 146
           KRR+YD  GK G  +SR R      +  D+D+D  + GF   F FRDPE+VFREFFG  S
Sbjct: 61  KRRVYDQYGKEGLNNSRGR-----HSASDEDYDFGYHGFP--FTFRDPEEVFREFFG-GS 112

Query: 147 PFNDIF------GIRPRNNRGDETQLFHTGPLGF--HNLGDIFSHS--DAFSSFGGFDFN 196
           PF ++F      G   R             P GF    L DIF H+  + F+SF  F+  
Sbjct: 113 PFGELFPELNGHGRHGRRGPSTSLTSSLFSPFGFGMQGLDDIFGHTNGNTFTSFSTFNSA 172

Query: 197 SSGRGGAAVKTTSTSTRFIDGKKVTTKKMA 226
            +G G A +++T+T+TR ++GKK+TTKK+ 
Sbjct: 173 MAGPGSANMRSTTTTTRIVNGKKITTKKVT 202

Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307169918|gb|EFN62427.1| DnaJ-like protein subfamily B member 6 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|255652883|ref|NP_001157382.1| DnaJ (Hsp40) homolog 4 [Bombyx mori] gi|253721949|gb|ACT34038.1| DnaJ-4 [Bombyx mori] gi|378465770|gb|AFC01218.1| DnaJ-4 [Bombyx mori] Back     alignment and taxonomy information
>gi|383851407|ref|XP_003701224.1| PREDICTED: dnaJ homolog subfamily B member 6-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|328784860|ref|XP_392495.2| PREDICTED: dnaJ homolog subfamily B member 6-like [Apis mellifera] Back     alignment and taxonomy information
>gi|350424718|ref|XP_003493889.1| PREDICTED: dnaJ homolog subfamily B member 6-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|380020528|ref|XP_003694135.1| PREDICTED: dnaJ homolog subfamily B member 6-like [Apis florea] Back     alignment and taxonomy information
>gi|345490265|ref|XP_001605242.2| PREDICTED: dnaJ homolog subfamily B member 6-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|157109512|ref|XP_001650706.1| hypothetical protein AaeL_AAEL005305 [Aedes aegypti] gi|108879036|gb|EAT43261.1| AAEL005305-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|24654066|ref|NP_725541.1| mrj, isoform A [Drosophila melanogaster] gi|24654068|ref|NP_725542.1| mrj, isoform B [Drosophila melanogaster] gi|24654070|ref|NP_725543.1| mrj, isoform C [Drosophila melanogaster] gi|24654072|ref|NP_725544.1| mrj, isoform D [Drosophila melanogaster] gi|21429032|gb|AAM50235.1| LD10702p [Drosophila melanogaster] gi|21627108|gb|AAF58043.2| mrj, isoform A [Drosophila melanogaster] gi|21627109|gb|AAF58042.2| mrj, isoform B [Drosophila melanogaster] gi|21627110|gb|AAM68506.1| mrj, isoform C [Drosophila melanogaster] gi|21627111|gb|AAM68507.1| mrj, isoform D [Drosophila melanogaster] gi|119361601|tpg|DAA01527.1| TPA_exp: DnaJ-related co-chaperone MRJ [Drosophila melanogaster] gi|220942974|gb|ACL84030.1| mrj-PA [synthetic construct] gi|220953124|gb|ACL89105.1| mrj-PA [synthetic construct] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query230
FB|FBgn0034091 346 mrj "mrj" [Drosophila melanoga 0.295 0.196 0.705 1.4e-41
ZFIN|ZDB-GENE-040718-45 331 dnajb6a "DnaJ (Hsp40) homolog, 0.508 0.353 0.538 8.1e-35
ZFIN|ZDB-GENE-040426-1122 311 dnajb6b "DnaJ (Hsp40) homolog, 0.473 0.350 0.564 1.9e-33
UNIPROTKB|Q32L64244 LOC528549 "Uncharacterized pro 0.517 0.487 0.507 1.8e-31
UNIPROTKB|C9J2C4228 DNAJB6 "DnaJ homolog subfamily 0.808 0.815 0.393 8.8e-31
UNIPROTKB|O75190 326 DNAJB6 "DnaJ homolog subfamily 0.808 0.570 0.393 8.8e-31
UNIPROTKB|Q5R8H0 326 DNAJB6 "DnaJ homolog subfamily 0.808 0.570 0.393 8.8e-31
UNIPROTKB|Q4R7Y5241 DNAJB6 "DnaJ homolog subfamily 0.808 0.771 0.389 1.1e-30
UNIPROTKB|F1SM19241 DNAJB6 "Uncharacterized protei 0.491 0.468 0.496 1.3e-30
UNIPROTKB|Q0III6242 DNAJB6 "DnaJ homolog subfamily 0.808 0.768 0.396 1.4e-30
FB|FBgn0034091 mrj "mrj" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 273 (101.2 bits), Expect = 1.4e-41, Sum P(3) = 1.4e-41
 Identities = 48/68 (70%), Positives = 59/68 (86%)

Query:    27 MLDYYKVLGVDKQSSTGDIKKAYRKLALKWHPDKNPDNQSEANKKFKEISEAYEVLSDEK 86
             M+DYYK+L V + ++  ++KKAYRKLALKWHPDKNPDN  EANK+F+E+SEAYEVLSD +
Sbjct:     1 MVDYYKILDVSRSATDSEVKKAYRKLALKWHPDKNPDNLDEANKRFRELSEAYEVLSDAR 60

Query:    87 KRRIYDDR 94
             KRRIYD R
Sbjct:    61 KRRIYDAR 68
GO:0005575 "cellular_component" evidence=ND
GO:0006457 "protein folding" evidence=ISS
GO:0051082 "unfolded protein binding" evidence=ISS
ZFIN|ZDB-GENE-040718-45 dnajb6a "DnaJ (Hsp40) homolog, subfamily B, member 6a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1122 dnajb6b "DnaJ (Hsp40) homolog, subfamily B, member 6b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q32L64 LOC528549 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|C9J2C4 DNAJB6 "DnaJ homolog subfamily B member 6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|O75190 DNAJB6 "DnaJ homolog subfamily B member 6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R8H0 DNAJB6 "DnaJ homolog subfamily B member 6" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
UNIPROTKB|Q4R7Y5 DNAJB6 "DnaJ homolog subfamily B member 6" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms
UNIPROTKB|F1SM19 DNAJB6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q0III6 DNAJB6 "DnaJ homolog subfamily B member 6" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9HJ83DNAJ_THEACNo assigned EC number0.52520.41730.2630yesN/A
Q9QYI7DNJB8_MOUSENo assigned EC number0.43720.77820.7885yesN/A
Q7WGI5DNAJ_BORBRNo assigned EC number0.51570.40860.2520yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query230
PRK10767 371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 6e-36
COG0484 371 COG0484, DnaJ, DnaJ-class molecular chaperone with 2e-35
TIGR02349 354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 3e-35
pfam0022663 pfam00226, DnaJ, DnaJ domain 3e-32
PRK14290 365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 2e-30
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 5e-29
PRK14291 382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 2e-28
PRK14294 366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 3e-28
PRK14281 397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 1e-27
PRK14277 386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 1e-26
PRK14278 378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 8e-26
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 1e-25
PRK14284 391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 3e-25
PRK14301 373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 4e-25
PRK14298 377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 8e-25
PRK14280 376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 1e-24
PRK14297 380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 3e-24
PRK14282 369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 8e-24
PRK14276 380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 2e-23
PRK14283 378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 2e-23
PRK14289 386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 3e-23
PRK14295 389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 5e-23
PRK14292 371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 6e-23
PTZ00037 421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 1e-21
PRK14279 392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 2e-21
COG2214237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 2e-21
PRK14299291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 9e-21
PRK14300 372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 2e-20
PRK14286 372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 4e-20
PRK14293 374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 1e-19
PRK14285 365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 2e-19
PRK14288 369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 3e-18
PRK14296 372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 2e-17
PRK10266306 PRK10266, PRK10266, curved DNA-binding protein Cbp 2e-17
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 4e-17
PRK14287 371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 8e-16
COG5407 610 COG5407, SEC63, Preprotein translocase subunit Sec 2e-14
PRK09430267 PRK09430, djlA, Dna-J like membrane chaperone prot 1e-08
PTZ00341 1136 PTZ00341, PTZ00341, Ring-infected erythrocyte surf 3e-07
COG5269 379 COG5269, ZUO1, Ribosome-associated chaperone zuoti 1e-06
PHA02624 647 PHA02624, PHA02624, large T antigen; Provisional 7e-04
PHA03102153 PHA03102, PHA03102, Small T antigen; Reviewed 8e-04
COG1076174 COG1076, DjlA, DnaJ-domain-containing proteins 1 [ 0.001
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information 
 Score =  129 bits (328), Expect = 6e-36
 Identities = 62/142 (43%), Positives = 77/142 (54%), Gaps = 32/142 (22%)

Query: 26  SMLDYYKVLGVDKQSSTGDIKKAYRKLALKWHPDKNPDNQSEANKKFKEISEAYEVLSDE 85
           +  DYY+VLGV + +S  +IKKAYRKLA+K+HPD+NP ++ EA +KFKEI EAYEVLSD 
Sbjct: 2   AKRDYYEVLGVSRNASEDEIKKAYRKLAMKYHPDRNPGDK-EAEEKFKEIKEAYEVLSDP 60

Query: 86  KKRRIYDDRGKGGYEDSRQRGRYRSQAKYDDDHDDDFGGFHRGFRFRDPEDVFREFFGSA 145
           +KR  YD  G   +E     G               FGG   GF      D+F + FG  
Sbjct: 61  QKRAAYDQYGHAAFEQGGGGG--------------GFGGG-GGF-----GDIFGDIFG-- 98

Query: 146 SPFNDIFG-----IRPRNNRGD 162
               DIFG      R R  RG 
Sbjct: 99  ----DIFGGGRGGGRQRARRGA 116

Length = 371
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|236512 PRK09430, djlA, Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|222912 PHA02624, PHA02624, large T antigen; Provisional Back     alignment and domain information
>gnl|CDD|222986 PHA03102, PHA03102, Small T antigen; Reviewed Back     alignment and domain information
>gnl|CDD|224002 COG1076, DjlA, DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 230
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 99.98
KOG0713|consensus 336 99.95
PRK14288 369 chaperone protein DnaJ; Provisional 99.93
PRK14296 372 chaperone protein DnaJ; Provisional 99.93
KOG0712|consensus 337 99.93
PRK14286 372 chaperone protein DnaJ; Provisional 99.93
PRK14299291 chaperone protein DnaJ; Provisional 99.92
PRK14285 365 chaperone protein DnaJ; Provisional 99.92
PRK14276 380 chaperone protein DnaJ; Provisional 99.92
PRK14287 371 chaperone protein DnaJ; Provisional 99.92
PRK14277 386 chaperone protein DnaJ; Provisional 99.91
PRK14297 380 chaperone protein DnaJ; Provisional 99.91
PRK14282 369 chaperone protein DnaJ; Provisional 99.91
PRK14298 377 chaperone protein DnaJ; Provisional 99.91
PRK14294 366 chaperone protein DnaJ; Provisional 99.91
PTZ00037 421 DnaJ_C chaperone protein; Provisional 99.9
PRK14280 376 chaperone protein DnaJ; Provisional 99.9
PRK14279 392 chaperone protein DnaJ; Provisional 99.9
PRK14278 378 chaperone protein DnaJ; Provisional 99.9
PRK14290 365 chaperone protein DnaJ; Provisional 99.9
PRK14284 391 chaperone protein DnaJ; Provisional 99.9
PRK14292 371 chaperone protein DnaJ; Provisional 99.9
PRK14301 373 chaperone protein DnaJ; Provisional 99.9
PRK14291 382 chaperone protein DnaJ; Provisional 99.9
PRK14295 389 chaperone protein DnaJ; Provisional 99.89
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 99.89
PRK10767 371 chaperone protein DnaJ; Provisional 99.89
PRK14283 378 chaperone protein DnaJ; Provisional 99.89
PRK14281 397 chaperone protein DnaJ; Provisional 99.88
PRK10266 306 curved DNA-binding protein CbpA; Provisional 99.87
PRK14300 372 chaperone protein DnaJ; Provisional 99.86
KOG0691|consensus 296 99.86
PRK14293 374 chaperone protein DnaJ; Provisional 99.86
PRK14289 386 chaperone protein DnaJ; Provisional 99.85
KOG0716|consensus279 99.85
KOG0717|consensus 508 99.85
KOG0718|consensus 546 99.85
KOG0715|consensus288 99.84
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.83
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.82
KOG0714|consensus 306 99.81
KOG0624|consensus504 99.81
KOG0719|consensus264 99.78
PHA03102153 Small T antigen; Reviewed 99.75
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.75
COG2214237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.74
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.74
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.73
KOG0721|consensus230 99.69
KOG0550|consensus486 99.67
PRK01356166 hscB co-chaperone HscB; Provisional 99.61
PRK05014171 hscB co-chaperone HscB; Provisional 99.59
KOG0720|consensus490 99.54
PRK03578176 hscB co-chaperone HscB; Provisional 99.51
KOG0722|consensus329 99.51
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.49
PRK00294173 hscB co-chaperone HscB; Provisional 99.49
PTZ00100116 DnaJ chaperone protein; Provisional 99.47
PHA02624 647 large T antigen; Provisional 99.4
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 99.34
KOG1150|consensus250 99.29
PRK01773173 hscB co-chaperone HscB; Provisional 99.25
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 99.1
COG5269 379 ZUO1 Ribosome-associated chaperone zuotin [Transla 98.88
KOG1789|consensus 2235 98.66
KOG0568|consensus342 98.51
KOG0723|consensus112 98.16
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 97.49
KOG3192|consensus168 97.34
KOG0431|consensus453 96.81
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 96.24
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 95.34
PF1344662 RPT: A repeated domain in UCH-protein 95.3
PF14687112 DUF4460: Domain of unknown function (DUF4460) 91.31
KOG0724|consensus 335 88.97
PF11833194 DUF3353: Protein of unknown function (DUF3353); In 84.46
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 82.84
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.98  E-value=2.9e-32  Score=249.66  Aligned_cols=100  Identities=55%  Similarity=0.924  Sum_probs=84.8

Q ss_pred             ccchhhhhCCCCCCCHHHHHHHHHHHHHHhCCCCCCCchHHHHHHHHHHHHHHHhhhhhhhhhhhhhcCCCCCCCCCCCC
Q psy13284         27 MLDYYKVLGVDKQSSTGDIKKAYRKLALKWHPDKNPDNQSEANKKFKEISEAYEVLSDEKKRRIYDDRGKGGYEDSRQRG  106 (230)
Q Consensus        27 ~~dyY~iLgv~~~as~~eIKkaYrklalk~HPDkn~~~~~~a~~~F~~I~eAYevLsd~~kR~~YD~~g~~g~~~~~~~~  106 (230)
                      .+|||+||||+++||.+||||||||||+|||||+|+.+ ++|+++||+|+||||||+||+||++||+||.+++.+++.++
T Consensus         3 ~~dyYeiLGV~k~As~~EIKkAYRkLA~kyHPD~n~g~-~~AeeKFKEI~eAYEVLsD~eKRa~YD~fG~~~~~~gg~gg   81 (371)
T COG0484           3 KRDYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGD-KEAEEKFKEINEAYEVLSDPEKRAAYDQFGHAGFKAGGFGG   81 (371)
T ss_pred             ccchhhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCC-HHHHHHHHHHHHHHHHhCCHHHHHHhhccCccccccCCcCC
Confidence            47999999999999999999999999999999999964 68999999999999999999999999999999987433221


Q ss_pred             CcccCCCCCCCCCCCCCCCcCCcccCCHHHHHHHhhCCC
Q psy13284        107 RYRSQAKYDDDHDDDFGGFHRGFRFRDPEDVFREFFGSA  145 (230)
Q Consensus       107 ~~~~~~~~~~~~~~~f~~~~~~f~f~~p~diF~~fFG~~  145 (230)
                                   .+|+    +|.. ++.|||.+|||+.
T Consensus        82 -------------~g~~----~fgg-~~~DIF~~~FgGg  102 (371)
T COG0484          82 -------------FGFG----GFGG-DFGDIFEDFFGGG  102 (371)
T ss_pred             -------------CCcC----CCCC-CHHHHHHHhhcCC
Confidence                         0122    2222 7899999999744

>KOG0713|consensus Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0712|consensus Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0691|consensus Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0716|consensus Back     alignment and domain information
>KOG0717|consensus Back     alignment and domain information
>KOG0718|consensus Back     alignment and domain information
>KOG0715|consensus Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>KOG0714|consensus Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>KOG0719|consensus Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>KOG0721|consensus Back     alignment and domain information
>KOG0550|consensus Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0720|consensus Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0722|consensus Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1150|consensus Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1789|consensus Back     alignment and domain information
>KOG0568|consensus Back     alignment and domain information
>KOG0723|consensus Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3192|consensus Back     alignment and domain information
>KOG0431|consensus Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>PF13446 RPT: A repeated domain in UCH-protein Back     alignment and domain information
>PF14687 DUF4460: Domain of unknown function (DUF4460) Back     alignment and domain information
>KOG0724|consensus Back     alignment and domain information
>PF11833 DUF3353: Protein of unknown function (DUF3353); InterPro: IPR021788 This family of proteins are functionally uncharacterised Back     alignment and domain information
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query230
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 1e-23
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 3e-23
2lgw_A99 Solution Structure Of The J Domain Of Hsj1a Length 1e-20
2ctw_A109 Solution Structure Of J-Domain From Mouse Dnaj Subf 1e-17
2och_A73 J-domain Of Dnj-12 From Caenorhabditis Elegans Leng 4e-17
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 8e-16
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 8e-16
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 9e-16
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 1e-15
3apo_A 780 Crystal Structure Of Full-Length Erdj5 Length = 780 1e-15
3apq_A210 Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt 3e-15
2cug_A88 Solution Structure Of The J Domain Of The Pseudo Dn 6e-15
2dn9_A79 Solution Structure Of J-Domain From The Dnaj Homolo 1e-14
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 5e-14
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 6e-14
2ctr_A88 Solution Structure Of J-Domain From Human Dnaj Subf 8e-14
3lz8_A329 Structure Of A Putative Chaperone Dnaj From Klebsie 1e-11
2o37_A92 J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S 1e-11
2kqx_A73 Nmr Structure Of The J-Domain (Residues 2-72) In Th 2e-11
2y4t_A450 Crystal Structure Of The Human Co-Chaperone P58(Ipk 9e-11
2y4u_A450 Crystal Structure Of Human P58(Ipk) In Space Group 1e-10
2l6l_A155 Solution Structure Of Human J-Protein Co-Chaperone, 2e-08
1wjz_A94 Soluiotn Structure Of J-Domain Of Mouse Dnaj Like P 5e-08
2ctq_A112 Solution Structure Of J-Domain From Human Dnaj Subf 1e-07
2yua_A99 Solution Structure Of The Dnaj Domain From Human Wi 2e-07
1iur_A88 Dnaj Domain Of Human Kiaa0730 Protein Length = 88 2e-04
2qsa_A109 Crystal Structure Of J-Domain Of Dnaj Homolog Dnj-2 2e-04
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure 
Iteration: 1

 Score =  105 bits (263), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 61/73 (83%)
Query: 25 SSMLDYYKVLGVDKQSSTGDIKKAYRKLALKWHPDKNPDNQSEANKKFKEISEAYEVLSD 84
          S M+DYY+VL V +Q+S+  IKKAYRKLALKWHPDKNP+N+ EA ++FK+++EAYEVLSD
Sbjct: 6  SGMVDYYEVLDVPRQASSEAIKKAYRKLALKWHPDKNPENKEEAERRFKQVAEAYEVLSD 65
Query: 85 EKKRRIYDDRGKG 97
           KKR IYD  G G
Sbjct: 66 AKKRDIYDRYGSG 78
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure
>pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 Back     alignment and structure
>pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 Back     alignment and structure
>pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure
>pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure
>pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 Back     alignment and structure
>pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 Back     alignment and structure
>pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 Back     alignment and structure
>pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 Back     alignment and structure
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure
>pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 Back     alignment and structure
>pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 Back     alignment and structure
>pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 Back     alignment and structure
>pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 Back     alignment and structure
>pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 Back     alignment and structure
>pdb|2Y4U|A Chain A, Crystal Structure Of Human P58(Ipk) In Space Group P312 Length = 450 Back     alignment and structure
>pdb|2L6L|A Chain A, Solution Structure Of Human J-Protein Co-Chaperone, Dph4 Length = 155 Back     alignment and structure
>pdb|1WJZ|A Chain A, Soluiotn Structure Of J-Domain Of Mouse Dnaj Like Protein Length = 94 Back     alignment and structure
>pdb|2CTQ|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily C Menber 12 Length = 112 Back     alignment and structure
>pdb|2YUA|A Chain A, Solution Structure Of The Dnaj Domain From Human Williams- Beuren Syndrome Chromosome Region 18 Protein Length = 99 Back     alignment and structure
>pdb|1IUR|A Chain A, Dnaj Domain Of Human Kiaa0730 Protein Length = 88 Back     alignment and structure
>pdb|2QSA|A Chain A, Crystal Structure Of J-Domain Of Dnaj Homolog Dnj-2 Precursor From C.Elegans Length = 109 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query230
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 3e-40
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 2e-39
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 1e-38
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 1e-38
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 4e-38
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 2e-35
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 5e-35
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 8e-35
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 2e-33
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 2e-33
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 3e-33
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 4e-33
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 8e-33
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 2e-32
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 2e-32
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 3e-32
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 3e-32
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 4e-32
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 1e-31
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 1e-31
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 4e-28
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 1e-27
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 2e-27
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-25
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 1e-24
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 3e-19
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 1e-18
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 5e-18
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 8e-16
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 3e-15
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 3e-14
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 4e-14
2guz_A71 Mitochondrial import inner membrane translocase su 9e-13
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 2e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-06
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
 Score =  131 bits (333), Expect = 3e-40
 Identities = 49/80 (61%), Positives = 62/80 (77%)

Query: 21  KASHSSMLDYYKVLGVDKQSSTGDIKKAYRKLALKWHPDKNPDNQSEANKKFKEISEAYE 80
            +  S M+DYY+VL V +Q+S+  IKKAYRKLALKWHPDKNP+N+ EA ++FK+++EAYE
Sbjct: 2   SSGSSGMVDYYEVLDVPRQASSEAIKKAYRKLALKWHPDKNPENKEEAERRFKQVAEAYE 61

Query: 81  VLSDEKKRRIYDDRGKGGYE 100
           VLSD KKR IYD  G G   
Sbjct: 62  VLSDAKKRDIYDRYGSGPSS 81
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query230
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.92
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.92
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.91
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.91
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.9
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.9
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.9
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.9
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.9
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.89
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.88
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.87
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.87
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.87
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.87
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 99.87
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.87
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.85
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.82
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.82
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.82
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.8
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.8
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.78
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.77
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.76
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.76
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.75
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.75
2guz_A71 Mitochondrial import inner membrane translocase su 99.72
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.72
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.71
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.71
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.33
2guz_B65 Mitochondrial import inner membrane translocase su 98.99
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 93.47
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
Probab=99.92  E-value=2.3e-25  Score=163.00  Aligned_cols=76  Identities=64%  Similarity=1.061  Sum_probs=71.3

Q ss_pred             cCccchhhhhCCCCCCCHHHHHHHHHHHHHHhCCCCCCCchHHHHHHHHHHHHHHHhhhhhhhhhhhhhcCCCCCC
Q psy13284         25 SSMLDYYKVLGVDKQSSTGDIKKAYRKLALKWHPDKNPDNQSEANKKFKEISEAYEVLSDEKKRRIYDDRGKGGYE  100 (230)
Q Consensus        25 ~~~~dyY~iLgv~~~as~~eIKkaYrklalk~HPDkn~~~~~~a~~~F~~I~eAYevLsd~~kR~~YD~~g~~g~~  100 (230)
                      ..+.|||+||||+++|+.++||+|||+|+++||||+++...+.++++|++|++||+||+||.+|..||++|..++.
T Consensus         6 ~~~~~~y~iLgv~~~as~~eIk~ayr~l~~~~HPDk~~~~~~~a~~~f~~i~~Ay~~L~d~~~R~~YD~~g~~~~~   81 (82)
T 2ej7_A            6 SGMVDYYEVLDVPRQASSEAIKKAYRKLALKWHPDKNPENKEEAERRFKQVAEAYEVLSDAKKRDIYDRYGSGPSS   81 (82)
T ss_dssp             SSSCCHHHHTTCCTTCCHHHHHHHHHHHHTTSCTTTCSTTHHHHHHHHHHHHHHHHHHSSTTHHHHHHHTCCCSCC
T ss_pred             CCCcCHHHHcCCCCCCCHHHHHHHHHHHHHHHCcCCCCCcHHHHHHHHHHHHHHHHHHCCHHHHHHHHHcCccccC
Confidence            4578999999999999999999999999999999999987778999999999999999999999999999987754
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 230
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 4e-21
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 1e-19
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 2e-19
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 3e-19
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 2e-18
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 7e-17
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 1e-16
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 5e-13
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: Auxilin J-domain
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 82.3 bits (203), Expect = 4e-21
 Identities = 17/65 (26%), Positives = 32/65 (49%), Gaps = 2/65 (3%)

Query: 29 DYYKVLGVDKQSSTGDIKKAYRKLALKWHPDKNPDN--QSEANKKFKEISEAYEVLSDEK 86
            +K +G+    +   +KK YRK  L  HPDK      +  A   F E+++A+    ++ 
Sbjct: 34 TKWKPVGMADLVTPEQVKKVYRKAVLVVHPDKATGQPYEQYAKMIFMELNDAWSEFENQG 93

Query: 87 KRRIY 91
          ++ +Y
Sbjct: 94 QKPLY 98
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query230
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.93
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.88
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.86
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.81
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.79
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.78
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.71
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 83.66
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

Probab=99.93  E-value=1.6e-26  Score=165.73  Aligned_cols=72  Identities=53%  Similarity=0.962  Sum_probs=67.4

Q ss_pred             cchhhhhCCCCCCCHHHHHHHHHHHHHHhCCCCCCCchHHHHHHHHHHHHHHHhhhhhhhhhhhhhcCCCCCC
Q psy13284         28 LDYYKVLGVDKQSSTGDIKKAYRKLALKWHPDKNPDNQSEANKKFKEISEAYEVLSDEKKRRIYDDRGKGGYE  100 (230)
Q Consensus        28 ~dyY~iLgv~~~as~~eIKkaYrklalk~HPDkn~~~~~~a~~~F~~I~eAYevLsd~~kR~~YD~~g~~g~~  100 (230)
                      .|||+||||+++||.+|||+|||+|+++||||+++.+ +.++++|++|++||+||+||.+|..||++|..++.
T Consensus         3 ~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~-~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~~~e   74 (75)
T d1xbla_           3 QDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGD-KEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAAFE   74 (75)
T ss_dssp             CCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTT-CHHHHHHHHHHHHHHHTTSSHHHHHHHHHTTSSCC
T ss_pred             CCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCC-hHHHHHHHHHHHHHHhcCCHHHHHHHHHhCccccC
Confidence            6999999999999999999999999999999999875 46788999999999999999999999999988764
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure