Psyllid ID: psy13326


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140---
MKEAHGNSQFSSDSSTKVIFLLCLDGMLSWLQNILAFSVMSLVTSLTYAVASASKRIFVIAVSLLALGNPVTGTNVFGMMLAICGVLAYNKVSTYTGCARKTLTMAQGRHHFQQGTVGHFPNFGFISEKSKVQKTTKMSVFRS
ccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccHHHHHcccHHHcccccccccccccccccccccHHHHHHccccccccc
cccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHccccccccccccHHHHHccccccEEEEEcc
mkeahgnsqfssdssTKVIFLLCLDGMLSWLQNILAFSVMSLVTSLTYAVASASKRIFVIAVSLLAlgnpvtgtnVFGMMLAICGVLAYNKVSTYTGCARKTLTmaqgrhhfqqgtvghfpnfgfisekskvqkttkmsvfrs
mkeahgnsqfssdssTKVIFLLCLDGMLSWLQNILAFSVMSLVTSLTYAVASASKRIFVIAVSLLALGNPVTGTNVFGMMLAICGVLAYNKVSTYTGCARKTLTMAQGRHHFQQGTVGHFPNFGFIsekskvqkttkmsvfrs
MKEAHGNSQFSSDSSTKVIFLLCLDGMLSWLQNILAFSVMSLVTSLTYAVASASKRIFVIAVSLLALGNPVTGTNVFGMMLAICGVLAYNKVSTYTGCARKTLTMAQGRHHFQQGTVGHFPNFGFISEKSKVQKTTKMSVFRS
****************KVIFLLCLDGMLSWLQNILAFSVMSLVTSLTYAVASASKRIFVIAVSLLALGNPVTGTNVFGMMLAICGVLAYNKVSTYTGCARKTLTMAQGRHHFQQGTVGHFPNFGFI*****************
********QFSSDSSTKVIFLLCLDGMLSWLQNILAFSVMSLVTSLTYAVASASKRIFVIAVSLLALGNPVTGTNVFGMMLAICGVLAYN*****************************************************
**************STKVIFLLCLDGMLSWLQNILAFSVMSLVTSLTYAVASASKRIFVIAVSLLALGNPVTGTNVFGMMLAICGVLAYNKVSTYTGCARKTLTMAQGRHHFQQGTVGHFPNFGFISEKS*************
***********SDSSTKVIFLLCLDGMLSWLQNILAFSVMSLVTSLTYAVASASKRIFVIAVSLLALGNPVTGTNVFGMMLAICGVLAYNKVSTYTGCARK******************FPNFGFISEKSKVQKTTKMSVFRS
oooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKEAHGNSQFSSDSSTKVIFLLCLDGMLSWLQNILAFSVMSLVTSLTYAVASASKRIFVIAVSLLALGNPVTGTNVFGMMLAICGVLAYNKVSTYTGCARKTLTMAQGRHHFQQGTVGHFPNFGFISEKSKVQKTTKMSVFRS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query143 2.2.26 [Sep-21-2011]
Q9VR50373 Solute carrier family 35 yes N/A 0.636 0.243 0.673 2e-25
P0C6B1409 Solute carrier family 35 yes N/A 0.510 0.178 0.561 1e-16
Q96K37410 Solute carrier family 35 yes N/A 0.510 0.178 0.561 2e-16
Q8CD26409 Solute carrier family 35 yes N/A 0.510 0.178 0.547 4e-16
Q8C811405 Solute carrier family 35 no N/A 0.734 0.259 0.333 4e-09
P0CK96405 Solute carrier family 35 no N/A 0.727 0.256 0.346 5e-09
O94695449 Putative transporter C83. yes N/A 0.580 0.184 0.356 1e-06
P39542402 Uncharacterized transport yes N/A 0.517 0.184 0.324 3e-06
P22215453 Uncharacterized transport no N/A 0.594 0.187 0.344 4e-06
P11869404 Triose phosphate/phosphat N/A N/A 0.615 0.217 0.370 8e-06
>sp|Q9VR50|S35E1_DROME Solute carrier family 35 member E1 homolog OS=Drosophila melanogaster GN=CG14621 PE=2 SV=1 Back     alignment and function desciption
 Score =  114 bits (286), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 71/92 (77%), Gaps = 1/92 (1%)

Query: 17  KVIFLLCLDGMLSWLQNILAFSVMSLVTSLTYAVASASKRIFVIAVSLLALGNPVTGTNV 76
           +VI LL  DG+L+WLQNI+AFSV+SLVT LTYAVASASKRIFVIAVSLL LGNPVT  N 
Sbjct: 227 RVIALLFADGVLNWLQNIIAFSVLSLVTPLTYAVASASKRIFVIAVSLLILGNPVTWVNC 286

Query: 77  FGMMLAICGVLAYNKVSTYT-GCARKTLTMAQ 107
            GM LAI GVL YN+    T G  + TL ++Q
Sbjct: 287 VGMTLAIVGVLCYNRAKQLTRGREQPTLPLSQ 318




Putative transporter.
Drosophila melanogaster (taxid: 7227)
>sp|P0C6B1|S35E1_RAT Solute carrier family 35 member E1 OS=Rattus norvegicus GN=Slc35e1 PE=2 SV=1 Back     alignment and function description
>sp|Q96K37|S35E1_HUMAN Solute carrier family 35 member E1 OS=Homo sapiens GN=SLC35E1 PE=1 SV=2 Back     alignment and function description
>sp|Q8CD26|S35E1_MOUSE Solute carrier family 35 member E1 OS=Mus musculus GN=Slc35e1 PE=1 SV=2 Back     alignment and function description
>sp|Q8C811|S35E2_MOUSE Solute carrier family 35 member E2 OS=Mus musculus GN=Slc35e2 PE=2 SV=1 Back     alignment and function description
>sp|P0CK96|S352B_HUMAN Solute carrier family 35 member E2B OS=Homo sapiens GN=SLC35E2B PE=2 SV=1 Back     alignment and function description
>sp|O94695|YG1B_SCHPO Putative transporter C83.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC83.11 PE=1 SV=2 Back     alignment and function description
>sp|P39542|YJT3_YEAST Uncharacterized transporter YJL193W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJL193W PE=1 SV=1 Back     alignment and function description
>sp|P22215|SLY41_YEAST Uncharacterized transporter SLY41 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLY41 PE=1 SV=2 Back     alignment and function description
>sp|P11869|TPT_SPIOL Triose phosphate/phosphate translocator, chloroplastic OS=Spinacia oleracea PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query143
156545082 352 PREDICTED: solute carrier family 35 memb 0.573 0.232 0.731 1e-26
91090644 368 PREDICTED: similar to conserved hypothet 0.720 0.279 0.631 2e-26
340727169 349 PREDICTED: solute carrier family 35 memb 0.566 0.232 0.728 8e-25
350424686 349 PREDICTED: solute carrier family 35 memb 0.566 0.232 0.728 8e-25
48096658 350 PREDICTED: solute carrier family 35 memb 0.699 0.285 0.613 1e-24
195482362 373 GE17936 [Drosophila yakuba] gi|194189541 0.657 0.252 0.663 2e-24
380020522 350 PREDICTED: solute carrier family 35 memb 0.699 0.285 0.613 2e-24
194897776 373 GG19741 [Drosophila erecta] gi|190650369 0.657 0.252 0.663 3e-24
194763841 377 GF20934 [Drosophila ananassae] gi|190618 0.657 0.249 0.663 3e-24
195356141 373 GM11727 [Drosophila sechellia] gi|194132 0.657 0.252 0.663 4e-24
>gi|156545082|ref|XP_001601391.1| PREDICTED: solute carrier family 35 member E1 homolog isoform 1 [Nasonia vitripennis] gi|345481936|ref|XP_003424488.1| PREDICTED: solute carrier family 35 member E1 homolog isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 73/82 (89%)

Query: 10  FSSDSSTKVIFLLCLDGMLSWLQNILAFSVMSLVTSLTYAVASASKRIFVIAVSLLALGN 69
           F++D+S++ I LL +DG+L+WLQNI+AFSVMS+VT LTYAVASASKRIFVIAV+L  LGN
Sbjct: 226 FTTDNSSRTITLLLIDGILNWLQNIVAFSVMSIVTPLTYAVASASKRIFVIAVTLFILGN 285

Query: 70  PVTGTNVFGMMLAICGVLAYNK 91
           PVTGTNV GM++AI GVL YNK
Sbjct: 286 PVTGTNVLGMVMAIGGVLCYNK 307




Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|91090644|ref|XP_973866.1| PREDICTED: similar to conserved hypothetical protein [Tribolium castaneum] gi|270013322|gb|EFA09770.1| hypothetical protein TcasGA2_TC011911 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|340727169|ref|XP_003401921.1| PREDICTED: solute carrier family 35 member E1 homolog [Bombus terrestris] Back     alignment and taxonomy information
>gi|350424686|ref|XP_003493879.1| PREDICTED: solute carrier family 35 member E1 homolog [Bombus impatiens] Back     alignment and taxonomy information
>gi|48096658|ref|XP_394742.1| PREDICTED: solute carrier family 35 member E1 homolog isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|195482362|ref|XP_002102017.1| GE17936 [Drosophila yakuba] gi|194189541|gb|EDX03125.1| GE17936 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|380020522|ref|XP_003694132.1| PREDICTED: solute carrier family 35 member E1 homolog [Apis florea] Back     alignment and taxonomy information
>gi|194897776|ref|XP_001978720.1| GG19741 [Drosophila erecta] gi|190650369|gb|EDV47647.1| GG19741 [Drosophila erecta] Back     alignment and taxonomy information
>gi|194763841|ref|XP_001964041.1| GF20934 [Drosophila ananassae] gi|190618966|gb|EDV34490.1| GF20934 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195356141|ref|XP_002044539.1| GM11727 [Drosophila sechellia] gi|194132161|gb|EDW53788.1| GM11727 [Drosophila sechellia] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query143
FB|FBgn0031183373 CG14621 [Drosophila melanogast 0.636 0.243 0.673 9.7e-25
UNIPROTKB|C9JK45116 SLC35E1 "Solute carrier family 0.510 0.629 0.561 3.2e-17
RGD|1561342409 Slc35e1 "solute carrier family 0.510 0.178 0.561 7.1e-17
UNIPROTKB|P0C6B1409 Slc35e1 "Solute carrier family 0.510 0.178 0.561 7.1e-17
UNIPROTKB|Q96K37410 SLC35E1 "Solute carrier family 0.510 0.178 0.561 1.2e-16
UNIPROTKB|F1NE93383 SLC35E1 "Uncharacterized prote 0.510 0.190 0.547 1.2e-16
MGI|MGI:2142403409 Slc35e1 "solute carrier family 0.510 0.178 0.547 1.5e-16
UNIPROTKB|E2RIR4410 SLC35E1 "Uncharacterized prote 0.510 0.178 0.547 1.5e-16
UNIPROTKB|F1S9W2412 SLC35E1 "Uncharacterized prote 0.510 0.177 0.547 1.6e-16
ZFIN|ZDB-GENE-040426-2033375 slc35e1 "solute carrier family 0.545 0.208 0.538 2.4e-16
FB|FBgn0031183 CG14621 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 282 (104.3 bits), Expect = 9.7e-25, P = 9.7e-25
 Identities = 62/92 (67%), Positives = 71/92 (77%)

Query:    17 KVIFLLCLDGMLSWLQNILAFSVMSLVTSLTYAVASASKRIFVIAVSLLALGNPVTGTNV 76
             +VI LL  DG+L+WLQNI+AFSV+SLVT LTYAVASASKRIFVIAVSLL LGNPVT  N 
Sbjct:   227 RVIALLFADGVLNWLQNIIAFSVLSLVTPLTYAVASASKRIFVIAVSLLILGNPVTWVNC 286

Query:    77 FGMMLAICGVLAYNKVSTYT-GCARKTLTMAQ 107
              GM LAI GVL YN+    T G  + TL ++Q
Sbjct:   287 VGMTLAIVGVLCYNRAKQLTRGREQPTLPLSQ 318




GO:0008524 "glucose 6-phosphate:phosphate antiporter activity" evidence=ISS
GO:0008150 "biological_process" evidence=ND
GO:0016020 "membrane" evidence=IEA
UNIPROTKB|C9JK45 SLC35E1 "Solute carrier family 35 member E1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1561342 Slc35e1 "solute carrier family 35, member E1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P0C6B1 Slc35e1 "Solute carrier family 35 member E1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q96K37 SLC35E1 "Solute carrier family 35 member E1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NE93 SLC35E1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:2142403 Slc35e1 "solute carrier family 35, member E1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2RIR4 SLC35E1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1S9W2 SLC35E1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2033 slc35e1 "solute carrier family 35, member E1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P0C6B1S35E1_RATNo assigned EC number0.56160.51040.1784yesN/A
Q8CD26S35E1_MOUSENo assigned EC number0.54790.51040.1784yesN/A
Q96K37S35E1_HUMANNo assigned EC number0.56160.51040.1780yesN/A
Q9VR50S35E1_DROMENo assigned EC number0.67390.63630.2439yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query143
pfam03151149 pfam03151, TPT, Triose-phosphate Transporter famil 2e-19
PTZ00343350 PTZ00343, PTZ00343, triose or hexose phosphate/pho 1e-11
TIGR00817302 TIGR00817, tpt, Tpt phosphate/phosphoenolpyruvate 2e-10
>gnl|CDD|217390 pfam03151, TPT, Triose-phosphate Transporter family Back     alignment and domain information
 Score = 78.8 bits (195), Expect = 2e-19
 Identities = 30/86 (34%), Positives = 52/86 (60%)

Query: 5   HGNSQFSSDSSTKVIFLLCLDGMLSWLQNILAFSVMSLVTSLTYAVASASKRIFVIAVSL 64
                F    +++ + LL L G+L++L N+ AF ++   + LT +VA   KR+ VI +S+
Sbjct: 63  FILKFFGDLKTSRYVLLLLLSGVLAFLYNLSAFGLLGRTSPLTSSVAGTVKRVVVIVLSV 122

Query: 65  LALGNPVTGTNVFGMMLAICGVLAYN 90
           +  G+PVT  N+ G+ +AI GV+ Y+
Sbjct: 123 IIFGDPVTFLNILGLAIAILGVVLYS 148


This family includes transporters with a specificity for triose phosphate. Length = 149

>gnl|CDD|240371 PTZ00343, PTZ00343, triose or hexose phosphate/phosphate translocator; Provisional Back     alignment and domain information
>gnl|CDD|129898 TIGR00817, tpt, Tpt phosphate/phosphoenolpyruvate translocator Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 143
KOG1441|consensus316 99.76
PF03151153 TPT: Triose-phosphate Transporter family; InterPro 99.72
PTZ00343350 triose or hexose phosphate/phosphate translocator; 99.45
PF08449303 UAA: UAA transporter family; InterPro: IPR013657 T 99.3
KOG1442|consensus347 99.27
KOG1444|consensus314 99.26
TIGR00817302 tpt Tpt phosphate/phosphoenolpyruvate translocator 99.21
KOG1580|consensus337 98.99
KOG1581|consensus327 98.92
KOG1583|consensus330 98.92
COG5070309 VRG4 Nucleotide-sugar transporter [Carbohydrate tr 98.89
KOG1443|consensus349 98.84
TIGR00803222 nst UDP-galactose transporter. NSTs generally appe 98.36
PF06027334 DUF914: Eukaryotic protein of unknown function (DU 98.05
PF04142 244 Nuc_sug_transp: Nucleotide-sugar transporter; Inte 98.0
PRK11689295 aromatic amino acid exporter; Provisional 97.86
PLN00411358 nodulin MtN21 family protein; Provisional 97.84
PRK10532293 threonine and homoserine efflux system; Provisiona 97.82
PF00892126 EamA: EamA-like transporter family; InterPro: IPR0 97.75
TIGR00817 302 tpt Tpt phosphate/phosphoenolpyruvate translocator 97.41
PRK15430296 putative chloramphenical resistance permease RarD; 97.41
KOG1582|consensus367 97.38
TIGR00950260 2A78 Carboxylate/Amino Acid/Amine Transporter. 97.35
PRK11453299 O-acetylserine/cysteine export protein; Provisiona 97.32
PF13536113 EmrE: Multidrug resistance efflux transporter 97.25
TIGR00688256 rarD rarD protein. This uncharacterized protein is 97.23
TIGR00950260 2A78 Carboxylate/Amino Acid/Amine Transporter. 97.23
PRK15430296 putative chloramphenical resistance permease RarD; 97.21
PRK15051111 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol fl 97.2
PLN00411 358 nodulin MtN21 family protein; Provisional 97.19
COG2510140 Predicted membrane protein [Function unknown] 97.18
PRK11272292 putative DMT superfamily transporter inner membran 97.13
TIGR03340281 phn_DUF6 phosphonate utilization associated putati 97.09
PTZ00343 350 triose or hexose phosphate/phosphate translocator; 97.05
TIGR03340281 phn_DUF6 phosphonate utilization associated putati 96.82
COG0697292 RhaT Permeases of the drug/metabolite transporter 96.73
PF08449 303 UAA: UAA transporter family; InterPro: IPR013657 T 96.71
PRK02971129 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol fl 96.63
PRK09541110 emrE multidrug efflux protein; Reviewed 96.62
PRK10452120 multidrug efflux system protein MdtJ; Provisional 96.56
PRK10650109 multidrug efflux system protein MdtI; Provisional 96.48
PRK11431105 multidrug efflux system protein; Provisional 96.46
KOG2234|consensus 345 96.28
PF06027 334 DUF914: Eukaryotic protein of unknown function (DU 96.28
COG2076106 EmrE Membrane transporters of cations and cationic 96.23
TIGR00776290 RhaT RhaT L-rhamnose-proton symporter family prote 95.91
PRK11689 295 aromatic amino acid exporter; Provisional 95.73
COG0697292 RhaT Permeases of the drug/metabolite transporter 95.47
KOG2234|consensus345 95.41
PRK11272292 putative DMT superfamily transporter inner membran 95.08
KOG3912|consensus372 94.8
PF0089393 Multi_Drug_Res: Small Multidrug Resistance protein 94.76
PRK11453 299 O-acetylserine/cysteine export protein; Provisiona 94.24
TIGR00776 290 RhaT RhaT L-rhamnose-proton symporter family prote 92.65
COG2962293 RarD Predicted permeases [General function predict 92.57
PF04142244 Nuc_sug_transp: Nucleotide-sugar transporter; Inte 92.21
KOG2765|consensus 416 92.14
PF04657138 DUF606: Protein of unknown function, DUF606; Inter 89.16
COG2962293 RarD Predicted permeases [General function predict 89.08
PF06800269 Sugar_transport: Sugar transport protein; InterPro 87.46
PF07857254 DUF1632: CEO family (DUF1632); InterPro: IPR012435 87.43
KOG4510|consensus 346 86.18
KOG3912|consensus 372 84.86
COG5006292 rhtA Threonine/homoserine efflux transporter [Amin 83.1
PF10639113 UPF0546: Uncharacterised protein family UPF0546; I 82.96
KOG2766|consensus336 82.9
PF05653 300 Mg_trans_NIPA: Magnesium transporter NIPA; InterPr 81.56
>KOG1441|consensus Back     alignment and domain information
Probab=99.76  E-value=4.9e-19  Score=149.08  Aligned_cols=86  Identities=38%  Similarity=0.519  Sum_probs=78.9

Q ss_pred             CCcHHHHHHHHHHHHHHHHHHHHHHHHHhccChhhHhhhhhhhhHHHhhhhhhccCCcccccchhhHHHHHHHHHHHhhc
Q psy13326         13 DSSTKVIFLLCLDGMLSWLQNILAFSVMSLVTSLTYAVASASKRIFVIAVSLLALGNPVTGTNVFGMMLAICGVLAYNKV   92 (143)
Q Consensus        13 ~~~~~~~~~l~lsg~~af~~N~s~f~~i~~tSaLT~sV~g~lK~i~~ivls~~ifg~~ls~~~~iG~~lal~G~~lYs~~   92 (143)
                      +++...+.+++.+ +++|++|+++|++|++||||||+|+|++|++++++.|+++|++|+|+.|.+|++++++|+++|+++
T Consensus       230 ~~~~~~~~~~~~s-v~~f~~Nls~f~~ig~tSalT~~V~g~~K~~~vi~~s~~iF~~pvt~~n~~G~~iai~Gv~~Y~~~  308 (316)
T KOG1441|consen  230 PWFVTFLILLLNS-VLAFLLNLSAFLVIGRTSALTYSVAGHMKRIVVIVVSWLIFGNPVTFLNALGYAIAILGVFLYSRA  308 (316)
T ss_pred             ccchhhHHHHHHH-HHHHHHHHHHHHHHcccCchhhhhhccceEEEEEEeEeeeecCCCchhhHHHHHHHHHHHHHHHHH
Confidence            5555666566666 999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccch
Q psy13326         93 STYTGCA   99 (143)
Q Consensus        93 k~~~~~~   99 (143)
                      |.+++++
T Consensus       309 k~~~~~~  315 (316)
T KOG1441|consen  309 KLKEKKG  315 (316)
T ss_pred             hhhhhcc
Confidence            9988754



>PF03151 TPT: Triose-phosphate Transporter family; InterPro: IPR004853 This family consists entirely of aligned regions from Drosophila melanogaster proteins Back     alignment and domain information
>PTZ00343 triose or hexose phosphate/phosphate translocator; Provisional Back     alignment and domain information
>PF08449 UAA: UAA transporter family; InterPro: IPR013657 This family includes transporters with a specificity for UDP-N-acetylglucosamine [] Back     alignment and domain information
>KOG1442|consensus Back     alignment and domain information
>KOG1444|consensus Back     alignment and domain information
>TIGR00817 tpt Tpt phosphate/phosphoenolpyruvate translocator Back     alignment and domain information
>KOG1580|consensus Back     alignment and domain information
>KOG1581|consensus Back     alignment and domain information
>KOG1583|consensus Back     alignment and domain information
>COG5070 VRG4 Nucleotide-sugar transporter [Carbohydrate transport and metabolism / Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1443|consensus Back     alignment and domain information
>TIGR00803 nst UDP-galactose transporter Back     alignment and domain information
>PF06027 DUF914: Eukaryotic protein of unknown function (DUF914); InterPro: IPR009262 This family consists of several hypothetical proteins of unknown function Back     alignment and domain information
>PF04142 Nuc_sug_transp: Nucleotide-sugar transporter; InterPro: IPR007271 This family of membrane proteins transport nucleotide sugars from the cytoplasm into golgi vesicles Back     alignment and domain information
>PRK11689 aromatic amino acid exporter; Provisional Back     alignment and domain information
>PLN00411 nodulin MtN21 family protein; Provisional Back     alignment and domain information
>PRK10532 threonine and homoserine efflux system; Provisional Back     alignment and domain information
>PF00892 EamA: EamA-like transporter family; InterPro: IPR000620 This domain is found in proteins including the Erwinia chrysanthemi PecM protein, which is involved in pectinase, cellulase and blue pigment regulation; and the Salmonella typhimurium PagO protein, the function of which is unknown Back     alignment and domain information
>TIGR00817 tpt Tpt phosphate/phosphoenolpyruvate translocator Back     alignment and domain information
>PRK15430 putative chloramphenical resistance permease RarD; Provisional Back     alignment and domain information
>KOG1582|consensus Back     alignment and domain information
>TIGR00950 2A78 Carboxylate/Amino Acid/Amine Transporter Back     alignment and domain information
>PRK11453 O-acetylserine/cysteine export protein; Provisional Back     alignment and domain information
>PF13536 EmrE: Multidrug resistance efflux transporter Back     alignment and domain information
>TIGR00688 rarD rarD protein Back     alignment and domain information
>TIGR00950 2A78 Carboxylate/Amino Acid/Amine Transporter Back     alignment and domain information
>PRK15430 putative chloramphenical resistance permease RarD; Provisional Back     alignment and domain information
>PRK15051 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; Provisional Back     alignment and domain information
>PLN00411 nodulin MtN21 family protein; Provisional Back     alignment and domain information
>COG2510 Predicted membrane protein [Function unknown] Back     alignment and domain information
>PRK11272 putative DMT superfamily transporter inner membrane protein; Provisional Back     alignment and domain information
>TIGR03340 phn_DUF6 phosphonate utilization associated putative membrane protein Back     alignment and domain information
>PTZ00343 triose or hexose phosphate/phosphate translocator; Provisional Back     alignment and domain information
>TIGR03340 phn_DUF6 phosphonate utilization associated putative membrane protein Back     alignment and domain information
>COG0697 RhaT Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PF08449 UAA: UAA transporter family; InterPro: IPR013657 This family includes transporters with a specificity for UDP-N-acetylglucosamine [] Back     alignment and domain information
>PRK02971 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF; Provisional Back     alignment and domain information
>PRK09541 emrE multidrug efflux protein; Reviewed Back     alignment and domain information
>PRK10452 multidrug efflux system protein MdtJ; Provisional Back     alignment and domain information
>PRK10650 multidrug efflux system protein MdtI; Provisional Back     alignment and domain information
>PRK11431 multidrug efflux system protein; Provisional Back     alignment and domain information
>KOG2234|consensus Back     alignment and domain information
>PF06027 DUF914: Eukaryotic protein of unknown function (DUF914); InterPro: IPR009262 This family consists of several hypothetical proteins of unknown function Back     alignment and domain information
>COG2076 EmrE Membrane transporters of cations and cationic drugs [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00776 RhaT RhaT L-rhamnose-proton symporter family protein Back     alignment and domain information
>PRK11689 aromatic amino acid exporter; Provisional Back     alignment and domain information
>COG0697 RhaT Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>KOG2234|consensus Back     alignment and domain information
>PRK11272 putative DMT superfamily transporter inner membrane protein; Provisional Back     alignment and domain information
>KOG3912|consensus Back     alignment and domain information
>PF00893 Multi_Drug_Res: Small Multidrug Resistance protein; InterPro: IPR000390 Members of this family which have been characterised, belong to the small multidrug resistance (Smr) protein family and are integral membrane proteins Back     alignment and domain information
>PRK11453 O-acetylserine/cysteine export protein; Provisional Back     alignment and domain information
>TIGR00776 RhaT RhaT L-rhamnose-proton symporter family protein Back     alignment and domain information
>COG2962 RarD Predicted permeases [General function prediction only] Back     alignment and domain information
>PF04142 Nuc_sug_transp: Nucleotide-sugar transporter; InterPro: IPR007271 This family of membrane proteins transport nucleotide sugars from the cytoplasm into golgi vesicles Back     alignment and domain information
>KOG2765|consensus Back     alignment and domain information
>PF04657 DUF606: Protein of unknown function, DUF606; InterPro: IPR006750 This family contains uncharacterised bacterial proteins Back     alignment and domain information
>COG2962 RarD Predicted permeases [General function prediction only] Back     alignment and domain information
>PF06800 Sugar_transport: Sugar transport protein; InterPro: IPR010651 This is a family of bacterial sugar transporters approximately 300 residues long Back     alignment and domain information
>PF07857 DUF1632: CEO family (DUF1632); InterPro: IPR012435 These sequences are found in hypothetical eukaryotic proteins of unknown function Back     alignment and domain information
>KOG4510|consensus Back     alignment and domain information
>KOG3912|consensus Back     alignment and domain information
>COG5006 rhtA Threonine/homoserine efflux transporter [Amino acid transport and metabolism] Back     alignment and domain information
>PF10639 UPF0546: Uncharacterised protein family UPF0546; InterPro: IPR018908 This family of proteins has no known function Back     alignment and domain information
>KOG2766|consensus Back     alignment and domain information
>PF05653 Mg_trans_NIPA: Magnesium transporter NIPA; InterPro: IPR008521 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query143
2i68_A137 Protein EMRE; transmembrane protein, small-multidr 97.52
3b5d_A110 Multidrug transporter EMRE; helical membrane prote 97.14
>2i68_A Protein EMRE; transmembrane protein, small-multidrug resistance, transporter, homodimer, dual topology, transport protein; NMR {Escherichia coli} Back     alignment and structure
Probab=97.52  E-value=0.00016  Score=53.33  Aligned_cols=57  Identities=25%  Similarity=0.341  Sum_probs=36.9

Q ss_pred             HHHHhccChh-hHhhhhhhhhHHHhhhhhhccCCcccccchhhHHHHHHHHHHHhhcc
Q psy13326         37 FSVMSLVTSL-TYAVASASKRIFVIAVSLLALGNPVTGTNVFGMMLAICGVLAYNKVS   93 (143)
Q Consensus        37 f~~i~~tSaL-T~sV~g~lK~i~~ivls~~ifg~~ls~~~~iG~~lal~G~~lYs~~k   93 (143)
                      +..+++..+- .|.+...+--++++++|+++|+|++++.+++|++++++|+++.+..+
T Consensus        48 ~~alk~i~~s~ay~iw~~l~pv~~~l~g~l~lgE~ls~~~~~Gi~LIi~GV~ll~~~~  105 (137)
T 2i68_A           48 AQTLAYIPTGIAYAIWSGVGIVLISLLSWGFFGQRLDLPAIIGMMLICAGVLIINLLS  105 (137)
T ss_dssp             HHHHC-----CHHHHHHHHHHHHHHHHHHHHHC------CHHHHHHHHHHHHHHHHC-
T ss_pred             HHHHHhCChhHHHHHHHHHHHHHHHHHHHHHhCCCCCHHHHHHHHHHHHHHHHHhcCC
Confidence            3345544433 44554678888999999999999999999999999999999988654



>3b5d_A Multidrug transporter EMRE; helical membrane protein, multidrug resistance transporter, SMR, antiport, inner membrane, transmembrane; HET: P4P; 3.80A {Escherichia coli K12} PDB: 3b61_A 3b62_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

No hit with probability above 80.00