Psyllid ID: psy13326
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 143 | ||||||
| 156545082 | 352 | PREDICTED: solute carrier family 35 memb | 0.573 | 0.232 | 0.731 | 1e-26 | |
| 91090644 | 368 | PREDICTED: similar to conserved hypothet | 0.720 | 0.279 | 0.631 | 2e-26 | |
| 340727169 | 349 | PREDICTED: solute carrier family 35 memb | 0.566 | 0.232 | 0.728 | 8e-25 | |
| 350424686 | 349 | PREDICTED: solute carrier family 35 memb | 0.566 | 0.232 | 0.728 | 8e-25 | |
| 48096658 | 350 | PREDICTED: solute carrier family 35 memb | 0.699 | 0.285 | 0.613 | 1e-24 | |
| 195482362 | 373 | GE17936 [Drosophila yakuba] gi|194189541 | 0.657 | 0.252 | 0.663 | 2e-24 | |
| 380020522 | 350 | PREDICTED: solute carrier family 35 memb | 0.699 | 0.285 | 0.613 | 2e-24 | |
| 194897776 | 373 | GG19741 [Drosophila erecta] gi|190650369 | 0.657 | 0.252 | 0.663 | 3e-24 | |
| 194763841 | 377 | GF20934 [Drosophila ananassae] gi|190618 | 0.657 | 0.249 | 0.663 | 3e-24 | |
| 195356141 | 373 | GM11727 [Drosophila sechellia] gi|194132 | 0.657 | 0.252 | 0.663 | 4e-24 |
| >gi|156545082|ref|XP_001601391.1| PREDICTED: solute carrier family 35 member E1 homolog isoform 1 [Nasonia vitripennis] gi|345481936|ref|XP_003424488.1| PREDICTED: solute carrier family 35 member E1 homolog isoform 2 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
Score = 124 bits (311), Expect = 1e-26, Method: Compositional matrix adjust.
Identities = 60/82 (73%), Positives = 73/82 (89%)
Query: 10 FSSDSSTKVIFLLCLDGMLSWLQNILAFSVMSLVTSLTYAVASASKRIFVIAVSLLALGN 69
F++D+S++ I LL +DG+L+WLQNI+AFSVMS+VT LTYAVASASKRIFVIAV+L LGN
Sbjct: 226 FTTDNSSRTITLLLIDGILNWLQNIVAFSVMSIVTPLTYAVASASKRIFVIAVTLFILGN 285
Query: 70 PVTGTNVFGMMLAICGVLAYNK 91
PVTGTNV GM++AI GVL YNK
Sbjct: 286 PVTGTNVLGMVMAIGGVLCYNK 307
|
Source: Nasonia vitripennis Species: Nasonia vitripennis Genus: Nasonia Family: Pteromalidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|91090644|ref|XP_973866.1| PREDICTED: similar to conserved hypothetical protein [Tribolium castaneum] gi|270013322|gb|EFA09770.1| hypothetical protein TcasGA2_TC011911 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|340727169|ref|XP_003401921.1| PREDICTED: solute carrier family 35 member E1 homolog [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350424686|ref|XP_003493879.1| PREDICTED: solute carrier family 35 member E1 homolog [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|48096658|ref|XP_394742.1| PREDICTED: solute carrier family 35 member E1 homolog isoform 1 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|195482362|ref|XP_002102017.1| GE17936 [Drosophila yakuba] gi|194189541|gb|EDX03125.1| GE17936 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
| >gi|380020522|ref|XP_003694132.1| PREDICTED: solute carrier family 35 member E1 homolog [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|194897776|ref|XP_001978720.1| GG19741 [Drosophila erecta] gi|190650369|gb|EDV47647.1| GG19741 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|194763841|ref|XP_001964041.1| GF20934 [Drosophila ananassae] gi|190618966|gb|EDV34490.1| GF20934 [Drosophila ananassae] | Back alignment and taxonomy information |
|---|
| >gi|195356141|ref|XP_002044539.1| GM11727 [Drosophila sechellia] gi|194132161|gb|EDW53788.1| GM11727 [Drosophila sechellia] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 143 | ||||||
| FB|FBgn0031183 | 373 | CG14621 [Drosophila melanogast | 0.636 | 0.243 | 0.673 | 9.7e-25 | |
| UNIPROTKB|C9JK45 | 116 | SLC35E1 "Solute carrier family | 0.510 | 0.629 | 0.561 | 3.2e-17 | |
| RGD|1561342 | 409 | Slc35e1 "solute carrier family | 0.510 | 0.178 | 0.561 | 7.1e-17 | |
| UNIPROTKB|P0C6B1 | 409 | Slc35e1 "Solute carrier family | 0.510 | 0.178 | 0.561 | 7.1e-17 | |
| UNIPROTKB|Q96K37 | 410 | SLC35E1 "Solute carrier family | 0.510 | 0.178 | 0.561 | 1.2e-16 | |
| UNIPROTKB|F1NE93 | 383 | SLC35E1 "Uncharacterized prote | 0.510 | 0.190 | 0.547 | 1.2e-16 | |
| MGI|MGI:2142403 | 409 | Slc35e1 "solute carrier family | 0.510 | 0.178 | 0.547 | 1.5e-16 | |
| UNIPROTKB|E2RIR4 | 410 | SLC35E1 "Uncharacterized prote | 0.510 | 0.178 | 0.547 | 1.5e-16 | |
| UNIPROTKB|F1S9W2 | 412 | SLC35E1 "Uncharacterized prote | 0.510 | 0.177 | 0.547 | 1.6e-16 | |
| ZFIN|ZDB-GENE-040426-2033 | 375 | slc35e1 "solute carrier family | 0.545 | 0.208 | 0.538 | 2.4e-16 |
| FB|FBgn0031183 CG14621 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 282 (104.3 bits), Expect = 9.7e-25, P = 9.7e-25
Identities = 62/92 (67%), Positives = 71/92 (77%)
Query: 17 KVIFLLCLDGMLSWLQNILAFSVMSLVTSLTYAVASASKRIFVIAVSLLALGNPVTGTNV 76
+VI LL DG+L+WLQNI+AFSV+SLVT LTYAVASASKRIFVIAVSLL LGNPVT N
Sbjct: 227 RVIALLFADGVLNWLQNIIAFSVLSLVTPLTYAVASASKRIFVIAVSLLILGNPVTWVNC 286
Query: 77 FGMMLAICGVLAYNKVSTYT-GCARKTLTMAQ 107
GM LAI GVL YN+ T G + TL ++Q
Sbjct: 287 VGMTLAIVGVLCYNRAKQLTRGREQPTLPLSQ 318
|
|
| UNIPROTKB|C9JK45 SLC35E1 "Solute carrier family 35 member E1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|1561342 Slc35e1 "solute carrier family 35, member E1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P0C6B1 Slc35e1 "Solute carrier family 35 member E1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q96K37 SLC35E1 "Solute carrier family 35 member E1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NE93 SLC35E1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2142403 Slc35e1 "solute carrier family 35, member E1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RIR4 SLC35E1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S9W2 SLC35E1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-2033 slc35e1 "solute carrier family 35, member E1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 143 | |||
| pfam03151 | 149 | pfam03151, TPT, Triose-phosphate Transporter famil | 2e-19 | |
| PTZ00343 | 350 | PTZ00343, PTZ00343, triose or hexose phosphate/pho | 1e-11 | |
| TIGR00817 | 302 | TIGR00817, tpt, Tpt phosphate/phosphoenolpyruvate | 2e-10 |
| >gnl|CDD|217390 pfam03151, TPT, Triose-phosphate Transporter family | Back alignment and domain information |
|---|
Score = 78.8 bits (195), Expect = 2e-19
Identities = 30/86 (34%), Positives = 52/86 (60%)
Query: 5 HGNSQFSSDSSTKVIFLLCLDGMLSWLQNILAFSVMSLVTSLTYAVASASKRIFVIAVSL 64
F +++ + LL L G+L++L N+ AF ++ + LT +VA KR+ VI +S+
Sbjct: 63 FILKFFGDLKTSRYVLLLLLSGVLAFLYNLSAFGLLGRTSPLTSSVAGTVKRVVVIVLSV 122
Query: 65 LALGNPVTGTNVFGMMLAICGVLAYN 90
+ G+PVT N+ G+ +AI GV+ Y+
Sbjct: 123 IIFGDPVTFLNILGLAIAILGVVLYS 148
|
This family includes transporters with a specificity for triose phosphate. Length = 149 |
| >gnl|CDD|240371 PTZ00343, PTZ00343, triose or hexose phosphate/phosphate translocator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|129898 TIGR00817, tpt, Tpt phosphate/phosphoenolpyruvate translocator | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 143 | |||
| KOG1441|consensus | 316 | 99.76 | ||
| PF03151 | 153 | TPT: Triose-phosphate Transporter family; InterPro | 99.72 | |
| PTZ00343 | 350 | triose or hexose phosphate/phosphate translocator; | 99.45 | |
| PF08449 | 303 | UAA: UAA transporter family; InterPro: IPR013657 T | 99.3 | |
| KOG1442|consensus | 347 | 99.27 | ||
| KOG1444|consensus | 314 | 99.26 | ||
| TIGR00817 | 302 | tpt Tpt phosphate/phosphoenolpyruvate translocator | 99.21 | |
| KOG1580|consensus | 337 | 98.99 | ||
| KOG1581|consensus | 327 | 98.92 | ||
| KOG1583|consensus | 330 | 98.92 | ||
| COG5070 | 309 | VRG4 Nucleotide-sugar transporter [Carbohydrate tr | 98.89 | |
| KOG1443|consensus | 349 | 98.84 | ||
| TIGR00803 | 222 | nst UDP-galactose transporter. NSTs generally appe | 98.36 | |
| PF06027 | 334 | DUF914: Eukaryotic protein of unknown function (DU | 98.05 | |
| PF04142 | 244 | Nuc_sug_transp: Nucleotide-sugar transporter; Inte | 98.0 | |
| PRK11689 | 295 | aromatic amino acid exporter; Provisional | 97.86 | |
| PLN00411 | 358 | nodulin MtN21 family protein; Provisional | 97.84 | |
| PRK10532 | 293 | threonine and homoserine efflux system; Provisiona | 97.82 | |
| PF00892 | 126 | EamA: EamA-like transporter family; InterPro: IPR0 | 97.75 | |
| TIGR00817 | 302 | tpt Tpt phosphate/phosphoenolpyruvate translocator | 97.41 | |
| PRK15430 | 296 | putative chloramphenical resistance permease RarD; | 97.41 | |
| KOG1582|consensus | 367 | 97.38 | ||
| TIGR00950 | 260 | 2A78 Carboxylate/Amino Acid/Amine Transporter. | 97.35 | |
| PRK11453 | 299 | O-acetylserine/cysteine export protein; Provisiona | 97.32 | |
| PF13536 | 113 | EmrE: Multidrug resistance efflux transporter | 97.25 | |
| TIGR00688 | 256 | rarD rarD protein. This uncharacterized protein is | 97.23 | |
| TIGR00950 | 260 | 2A78 Carboxylate/Amino Acid/Amine Transporter. | 97.23 | |
| PRK15430 | 296 | putative chloramphenical resistance permease RarD; | 97.21 | |
| PRK15051 | 111 | 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol fl | 97.2 | |
| PLN00411 | 358 | nodulin MtN21 family protein; Provisional | 97.19 | |
| COG2510 | 140 | Predicted membrane protein [Function unknown] | 97.18 | |
| PRK11272 | 292 | putative DMT superfamily transporter inner membran | 97.13 | |
| TIGR03340 | 281 | phn_DUF6 phosphonate utilization associated putati | 97.09 | |
| PTZ00343 | 350 | triose or hexose phosphate/phosphate translocator; | 97.05 | |
| TIGR03340 | 281 | phn_DUF6 phosphonate utilization associated putati | 96.82 | |
| COG0697 | 292 | RhaT Permeases of the drug/metabolite transporter | 96.73 | |
| PF08449 | 303 | UAA: UAA transporter family; InterPro: IPR013657 T | 96.71 | |
| PRK02971 | 129 | 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol fl | 96.63 | |
| PRK09541 | 110 | emrE multidrug efflux protein; Reviewed | 96.62 | |
| PRK10452 | 120 | multidrug efflux system protein MdtJ; Provisional | 96.56 | |
| PRK10650 | 109 | multidrug efflux system protein MdtI; Provisional | 96.48 | |
| PRK11431 | 105 | multidrug efflux system protein; Provisional | 96.46 | |
| KOG2234|consensus | 345 | 96.28 | ||
| PF06027 | 334 | DUF914: Eukaryotic protein of unknown function (DU | 96.28 | |
| COG2076 | 106 | EmrE Membrane transporters of cations and cationic | 96.23 | |
| TIGR00776 | 290 | RhaT RhaT L-rhamnose-proton symporter family prote | 95.91 | |
| PRK11689 | 295 | aromatic amino acid exporter; Provisional | 95.73 | |
| COG0697 | 292 | RhaT Permeases of the drug/metabolite transporter | 95.47 | |
| KOG2234|consensus | 345 | 95.41 | ||
| PRK11272 | 292 | putative DMT superfamily transporter inner membran | 95.08 | |
| KOG3912|consensus | 372 | 94.8 | ||
| PF00893 | 93 | Multi_Drug_Res: Small Multidrug Resistance protein | 94.76 | |
| PRK11453 | 299 | O-acetylserine/cysteine export protein; Provisiona | 94.24 | |
| TIGR00776 | 290 | RhaT RhaT L-rhamnose-proton symporter family prote | 92.65 | |
| COG2962 | 293 | RarD Predicted permeases [General function predict | 92.57 | |
| PF04142 | 244 | Nuc_sug_transp: Nucleotide-sugar transporter; Inte | 92.21 | |
| KOG2765|consensus | 416 | 92.14 | ||
| PF04657 | 138 | DUF606: Protein of unknown function, DUF606; Inter | 89.16 | |
| COG2962 | 293 | RarD Predicted permeases [General function predict | 89.08 | |
| PF06800 | 269 | Sugar_transport: Sugar transport protein; InterPro | 87.46 | |
| PF07857 | 254 | DUF1632: CEO family (DUF1632); InterPro: IPR012435 | 87.43 | |
| KOG4510|consensus | 346 | 86.18 | ||
| KOG3912|consensus | 372 | 84.86 | ||
| COG5006 | 292 | rhtA Threonine/homoserine efflux transporter [Amin | 83.1 | |
| PF10639 | 113 | UPF0546: Uncharacterised protein family UPF0546; I | 82.96 | |
| KOG2766|consensus | 336 | 82.9 | ||
| PF05653 | 300 | Mg_trans_NIPA: Magnesium transporter NIPA; InterPr | 81.56 |
| >KOG1441|consensus | Back alignment and domain information |
|---|
Probab=99.76 E-value=4.9e-19 Score=149.08 Aligned_cols=86 Identities=38% Similarity=0.519 Sum_probs=78.9
Q ss_pred CCcHHHHHHHHHHHHHHHHHHHHHHHHHhccChhhHhhhhhhhhHHHhhhhhhccCCcccccchhhHHHHHHHHHHHhhc
Q psy13326 13 DSSTKVIFLLCLDGMLSWLQNILAFSVMSLVTSLTYAVASASKRIFVIAVSLLALGNPVTGTNVFGMMLAICGVLAYNKV 92 (143)
Q Consensus 13 ~~~~~~~~~l~lsg~~af~~N~s~f~~i~~tSaLT~sV~g~lK~i~~ivls~~ifg~~ls~~~~iG~~lal~G~~lYs~~ 92 (143)
+++...+.+++.+ +++|++|+++|++|++||||||+|+|++|++++++.|+++|++|+|+.|.+|++++++|+++|+++
T Consensus 230 ~~~~~~~~~~~~s-v~~f~~Nls~f~~ig~tSalT~~V~g~~K~~~vi~~s~~iF~~pvt~~n~~G~~iai~Gv~~Y~~~ 308 (316)
T KOG1441|consen 230 PWFVTFLILLLNS-VLAFLLNLSAFLVIGRTSALTYSVAGHMKRIVVIVVSWLIFGNPVTFLNALGYAIAILGVFLYSRA 308 (316)
T ss_pred ccchhhHHHHHHH-HHHHHHHHHHHHHHcccCchhhhhhccceEEEEEEeEeeeecCCCchhhHHHHHHHHHHHHHHHHH
Confidence 5555666566666 999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cccccch
Q psy13326 93 STYTGCA 99 (143)
Q Consensus 93 k~~~~~~ 99 (143)
|.+++++
T Consensus 309 k~~~~~~ 315 (316)
T KOG1441|consen 309 KLKEKKG 315 (316)
T ss_pred hhhhhcc
Confidence 9988754
|
|
| >PF03151 TPT: Triose-phosphate Transporter family; InterPro: IPR004853 This family consists entirely of aligned regions from Drosophila melanogaster proteins | Back alignment and domain information |
|---|
| >PTZ00343 triose or hexose phosphate/phosphate translocator; Provisional | Back alignment and domain information |
|---|
| >PF08449 UAA: UAA transporter family; InterPro: IPR013657 This family includes transporters with a specificity for UDP-N-acetylglucosamine [] | Back alignment and domain information |
|---|
| >KOG1442|consensus | Back alignment and domain information |
|---|
| >KOG1444|consensus | Back alignment and domain information |
|---|
| >TIGR00817 tpt Tpt phosphate/phosphoenolpyruvate translocator | Back alignment and domain information |
|---|
| >KOG1580|consensus | Back alignment and domain information |
|---|
| >KOG1581|consensus | Back alignment and domain information |
|---|
| >KOG1583|consensus | Back alignment and domain information |
|---|
| >COG5070 VRG4 Nucleotide-sugar transporter [Carbohydrate transport and metabolism / Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG1443|consensus | Back alignment and domain information |
|---|
| >TIGR00803 nst UDP-galactose transporter | Back alignment and domain information |
|---|
| >PF06027 DUF914: Eukaryotic protein of unknown function (DUF914); InterPro: IPR009262 This family consists of several hypothetical proteins of unknown function | Back alignment and domain information |
|---|
| >PF04142 Nuc_sug_transp: Nucleotide-sugar transporter; InterPro: IPR007271 This family of membrane proteins transport nucleotide sugars from the cytoplasm into golgi vesicles | Back alignment and domain information |
|---|
| >PRK11689 aromatic amino acid exporter; Provisional | Back alignment and domain information |
|---|
| >PLN00411 nodulin MtN21 family protein; Provisional | Back alignment and domain information |
|---|
| >PRK10532 threonine and homoserine efflux system; Provisional | Back alignment and domain information |
|---|
| >PF00892 EamA: EamA-like transporter family; InterPro: IPR000620 This domain is found in proteins including the Erwinia chrysanthemi PecM protein, which is involved in pectinase, cellulase and blue pigment regulation; and the Salmonella typhimurium PagO protein, the function of which is unknown | Back alignment and domain information |
|---|
| >TIGR00817 tpt Tpt phosphate/phosphoenolpyruvate translocator | Back alignment and domain information |
|---|
| >PRK15430 putative chloramphenical resistance permease RarD; Provisional | Back alignment and domain information |
|---|
| >KOG1582|consensus | Back alignment and domain information |
|---|
| >TIGR00950 2A78 Carboxylate/Amino Acid/Amine Transporter | Back alignment and domain information |
|---|
| >PRK11453 O-acetylserine/cysteine export protein; Provisional | Back alignment and domain information |
|---|
| >PF13536 EmrE: Multidrug resistance efflux transporter | Back alignment and domain information |
|---|
| >TIGR00688 rarD rarD protein | Back alignment and domain information |
|---|
| >TIGR00950 2A78 Carboxylate/Amino Acid/Amine Transporter | Back alignment and domain information |
|---|
| >PRK15430 putative chloramphenical resistance permease RarD; Provisional | Back alignment and domain information |
|---|
| >PRK15051 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; Provisional | Back alignment and domain information |
|---|
| >PLN00411 nodulin MtN21 family protein; Provisional | Back alignment and domain information |
|---|
| >COG2510 Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK11272 putative DMT superfamily transporter inner membrane protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03340 phn_DUF6 phosphonate utilization associated putative membrane protein | Back alignment and domain information |
|---|
| >PTZ00343 triose or hexose phosphate/phosphate translocator; Provisional | Back alignment and domain information |
|---|
| >TIGR03340 phn_DUF6 phosphonate utilization associated putative membrane protein | Back alignment and domain information |
|---|
| >COG0697 RhaT Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PF08449 UAA: UAA transporter family; InterPro: IPR013657 This family includes transporters with a specificity for UDP-N-acetylglucosamine [] | Back alignment and domain information |
|---|
| >PRK02971 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF; Provisional | Back alignment and domain information |
|---|
| >PRK09541 emrE multidrug efflux protein; Reviewed | Back alignment and domain information |
|---|
| >PRK10452 multidrug efflux system protein MdtJ; Provisional | Back alignment and domain information |
|---|
| >PRK10650 multidrug efflux system protein MdtI; Provisional | Back alignment and domain information |
|---|
| >PRK11431 multidrug efflux system protein; Provisional | Back alignment and domain information |
|---|
| >KOG2234|consensus | Back alignment and domain information |
|---|
| >PF06027 DUF914: Eukaryotic protein of unknown function (DUF914); InterPro: IPR009262 This family consists of several hypothetical proteins of unknown function | Back alignment and domain information |
|---|
| >COG2076 EmrE Membrane transporters of cations and cationic drugs [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00776 RhaT RhaT L-rhamnose-proton symporter family protein | Back alignment and domain information |
|---|
| >PRK11689 aromatic amino acid exporter; Provisional | Back alignment and domain information |
|---|
| >COG0697 RhaT Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >KOG2234|consensus | Back alignment and domain information |
|---|
| >PRK11272 putative DMT superfamily transporter inner membrane protein; Provisional | Back alignment and domain information |
|---|
| >KOG3912|consensus | Back alignment and domain information |
|---|
| >PF00893 Multi_Drug_Res: Small Multidrug Resistance protein; InterPro: IPR000390 Members of this family which have been characterised, belong to the small multidrug resistance (Smr) protein family and are integral membrane proteins | Back alignment and domain information |
|---|
| >PRK11453 O-acetylserine/cysteine export protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00776 RhaT RhaT L-rhamnose-proton symporter family protein | Back alignment and domain information |
|---|
| >COG2962 RarD Predicted permeases [General function prediction only] | Back alignment and domain information |
|---|
| >PF04142 Nuc_sug_transp: Nucleotide-sugar transporter; InterPro: IPR007271 This family of membrane proteins transport nucleotide sugars from the cytoplasm into golgi vesicles | Back alignment and domain information |
|---|
| >KOG2765|consensus | Back alignment and domain information |
|---|
| >PF04657 DUF606: Protein of unknown function, DUF606; InterPro: IPR006750 This family contains uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >COG2962 RarD Predicted permeases [General function prediction only] | Back alignment and domain information |
|---|
| >PF06800 Sugar_transport: Sugar transport protein; InterPro: IPR010651 This is a family of bacterial sugar transporters approximately 300 residues long | Back alignment and domain information |
|---|
| >PF07857 DUF1632: CEO family (DUF1632); InterPro: IPR012435 These sequences are found in hypothetical eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >KOG4510|consensus | Back alignment and domain information |
|---|
| >KOG3912|consensus | Back alignment and domain information |
|---|
| >COG5006 rhtA Threonine/homoserine efflux transporter [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF10639 UPF0546: Uncharacterised protein family UPF0546; InterPro: IPR018908 This family of proteins has no known function | Back alignment and domain information |
|---|
| >KOG2766|consensus | Back alignment and domain information |
|---|
| >PF05653 Mg_trans_NIPA: Magnesium transporter NIPA; InterPro: IPR008521 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 143 | |||
| 2i68_A | 137 | Protein EMRE; transmembrane protein, small-multidr | 97.52 | |
| 3b5d_A | 110 | Multidrug transporter EMRE; helical membrane prote | 97.14 |
| >2i68_A Protein EMRE; transmembrane protein, small-multidrug resistance, transporter, homodimer, dual topology, transport protein; NMR {Escherichia coli} | Back alignment and structure |
|---|
Probab=97.52 E-value=0.00016 Score=53.33 Aligned_cols=57 Identities=25% Similarity=0.341 Sum_probs=36.9
Q ss_pred HHHHhccChh-hHhhhhhhhhHHHhhhhhhccCCcccccchhhHHHHHHHHHHHhhcc
Q psy13326 37 FSVMSLVTSL-TYAVASASKRIFVIAVSLLALGNPVTGTNVFGMMLAICGVLAYNKVS 93 (143)
Q Consensus 37 f~~i~~tSaL-T~sV~g~lK~i~~ivls~~ifg~~ls~~~~iG~~lal~G~~lYs~~k 93 (143)
+..+++..+- .|.+...+--++++++|+++|+|++++.+++|++++++|+++.+..+
T Consensus 48 ~~alk~i~~s~ay~iw~~l~pv~~~l~g~l~lgE~ls~~~~~Gi~LIi~GV~ll~~~~ 105 (137)
T 2i68_A 48 AQTLAYIPTGIAYAIWSGVGIVLISLLSWGFFGQRLDLPAIIGMMLICAGVLIINLLS 105 (137)
T ss_dssp HHHHC-----CHHHHHHHHHHHHHHHHHHHHHC------CHHHHHHHHHHHHHHHHC-
T ss_pred HHHHHhCChhHHHHHHHHHHHHHHHHHHHHHhCCCCCHHHHHHHHHHHHHHHHHhcCC
Confidence 3345544433 44554678888999999999999999999999999999999988654
|
| >3b5d_A Multidrug transporter EMRE; helical membrane protein, multidrug resistance transporter, SMR, antiport, inner membrane, transmembrane; HET: P4P; 3.80A {Escherichia coli K12} PDB: 3b61_A 3b62_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00