Psyllid ID: psy13480
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 615 | 2.2.26 [Sep-21-2011] | |||||||
| P31400 | 617 | V-type proton ATPase cata | N/A | N/A | 0.995 | 0.991 | 0.906 | 0.0 | |
| Q2TJ56 | 614 | V-type proton ATPase cata | N/A | N/A | 0.998 | 1.0 | 0.905 | 0.0 | |
| O16109 | 614 | V-type proton ATPase cata | N/A | N/A | 0.998 | 1.0 | 0.905 | 0.0 | |
| Q5TTG1 | 614 | V-type proton ATPase cata | yes | N/A | 0.993 | 0.995 | 0.898 | 0.0 | |
| Q27331 | 614 | V-type proton ATPase cata | yes | N/A | 0.993 | 0.995 | 0.901 | 0.0 | |
| P48602 | 614 | V-type proton ATPase cata | no | N/A | 0.993 | 0.995 | 0.872 | 0.0 | |
| P31404 | 617 | V-type proton ATPase cata | yes | N/A | 0.996 | 0.993 | 0.833 | 0.0 | |
| P38606 | 617 | V-type proton ATPase cata | yes | N/A | 0.996 | 0.993 | 0.830 | 0.0 | |
| P50516 | 617 | V-type proton ATPase cata | yes | N/A | 0.996 | 0.993 | 0.830 | 0.0 | |
| Q5R5H2 | 617 | V-type proton ATPase cata | yes | N/A | 0.996 | 0.993 | 0.828 | 0.0 |
| >sp|P31400|VATA_MANSE V-type proton ATPase catalytic subunit A OS=Manduca sexta GN=VHAA PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 1173 bits (3035), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 555/612 (90%), Positives = 594/612 (97%)
Query: 4 ALGKMADEDREGRFGFVYAVSGPVVTAEKMSGSAMYELVRVGYFELVGEIIRLEGDMATI 63
L +A+E+ E RFG+V+AVSGPVVTAEKMSGSAMYELVRVGY ELVGEIIRLEGDMATI
Sbjct: 6 GLKTIANEENEERFGYVFAVSGPVVTAEKMSGSAMYELVRVGYNELVGEIIRLEGDMATI 65
Query: 64 QVYEETSGVTVGDPVLRTGKPLSVELGPGILGSIFDGIQRPLKDINELSQSIYIPKGVNI 123
QVYEETSGVTVGDPVLRTGKPLSVELGPGILGSIFDGIQRPLKDINEL+QSIYIPKGVN+
Sbjct: 66 QVYEETSGVTVGDPVLRTGKPLSVELGPGILGSIFDGIQRPLKDINELTQSIYIPKGVNV 125
Query: 124 PALNRDVSWEFNPMNLKIGSHITGGDQYGLVHENTLVKHKMIMPPKAKGTVTYIAPAGNY 183
P+L R+V WEFNP+N+K+GSHITGGD YG+VHENTLVKHKM+MPP+AKGTVTYIAPAGNY
Sbjct: 126 PSLAREVDWEFNPLNVKVGSHITGGDLYGIVHENTLVKHKMLMPPRAKGTVTYIAPAGNY 185
Query: 184 KVDEVVLETEFDGEKSKYTMVQVWPVRQPRPVTEKLPANYPLLTGQRVLDSLFPCVLGGT 243
KV +VVLETEFDGEK++YTM+QVWPVRQPRPVTEKLPAN+PLLTGQRVLDSLFPCV GGT
Sbjct: 186 KVTDVVLETEFDGEKAQYTMLQVWPVRQPRPVTEKLPANHPLLTGQRVLDSLFPCVQGGT 245
Query: 244 TAIPGAFGCGKTVISQALSKYSNSDVIVYVGCGERGNEMAEVLRDFPELTIEVDGVTESI 303
TAIPGAFGCGKTVISQALSKYSNSDVI+YVGCGERGNEM+EVLRDFPELT+E++GVTESI
Sbjct: 246 TAIPGAFGCGKTVISQALSKYSNSDVIIYVGCGERGNEMSEVLRDFPELTVEIEGVTESI 305
Query: 304 MKRTTLVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRL 363
MKRT LVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRL
Sbjct: 306 MKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRL 365
Query: 364 AEMPADSGYPAYLGARLASFYERAGRVKCLGNPDREGSVSIVGAVSPPGGDFSDPVTSAT 423
AEMPADSGYPAYLGARLASFYERAGRVKCLGNPDREGSVSIVGAVSPPGGDFSDPVT+AT
Sbjct: 366 AEMPADSGYPAYLGARLASFYERAGRVKCLGNPDREGSVSIVGAVSPPGGDFSDPVTAAT 425
Query: 424 LGIVQVFWGLDKKLAQRKHFPSINWLISYSKYMRALDDFYDKNHPEFVPLRTKVKEILQE 483
LGIVQVFWGLDKKLAQRKHFPSINWLISYSKYMRALDDFY+KN+PEFVPLRTKVKEILQE
Sbjct: 426 LGIVQVFWGLDKKLAQRKHFPSINWLISYSKYMRALDDFYEKNYPEFVPLRTKVKEILQE 485
Query: 484 EEDLSEIVQLVGKASLAESDKITLEVAKLLKDDFLQQNSYSPYDRFCPFYKTVGMLRNMI 543
EEDLSEIVQLVGKASLAE+DKITLEVAKLLKDDFLQQNSYS YDRFCPFYKTVGML+N+I
Sbjct: 486 EEDLSEIVQLVGKASLAETDKITLEVAKLLKDDFLQQNSYSSYDRFCPFYKTVGMLKNII 545
Query: 544 AFYDMSRHAVESTAQSENKITWSVIRDSMSNILYQLSSMKFKDPVKDGEAKTRADFDQLY 603
+FYDMSRHAVESTAQS+NK+TW+VIRD+M N+LYQLSSMKFKDPVKDGEAK +ADFDQL
Sbjct: 546 SFYDMSRHAVESTAQSDNKVTWNVIRDAMGNVLYQLSSMKFKDPVKDGEAKIKADFDQLL 605
Query: 604 EDIQQAFRNLED 615
ED+ AFRNLED
Sbjct: 606 EDMSAAFRNLED 617
|
Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. This is a catalytic subunit. V-ATPase is responsible for energizing electrophoretic K(+)/2H(+) antiport by generating a transmembrane voltage of more than 200mV. Manduca sexta (taxid: 7130) EC: 3EC: .EC: 6EC: .EC: 3EC: .EC: 1EC: 4 |
| >sp|Q2TJ56|VATA_AEDAL V-type proton ATPase catalytic subunit A OS=Aedes albopictus GN=VhaA PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|O16109|VATA_AEDAE V-type proton ATPase catalytic subunit A OS=Aedes aegypti GN=VhaA PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q5TTG1|VATA_ANOGA V-type proton ATPase catalytic subunit A OS=Anopheles gambiae GN=Vha68-2 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q27331|VATA2_DROME V-type proton ATPase catalytic subunit A isoform 2 OS=Drosophila melanogaster GN=Vha68-2 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|P48602|VATA1_DROME V-type proton ATPase catalytic subunit A isoform 1 OS=Drosophila melanogaster GN=Vha68-1 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|P31404|VATA_BOVIN V-type proton ATPase catalytic subunit A OS=Bos taurus GN=ATP6V1A PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|P38606|VATA_HUMAN V-type proton ATPase catalytic subunit A OS=Homo sapiens GN=ATP6V1A PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|P50516|VATA_MOUSE V-type proton ATPase catalytic subunit A OS=Mus musculus GN=Atp6v1a PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q5R5H2|VATA_PONAB V-type proton ATPase catalytic subunit A OS=Pongo abelii GN=ATP6V1A PE=2 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 615 | ||||||
| 307184603 | 616 | Vacuolar ATP synthase catalytic subunit | 0.995 | 0.993 | 0.928 | 0.0 | |
| 322791035 | 616 | hypothetical protein SINV_11459 [Solenop | 0.995 | 0.993 | 0.924 | 0.0 | |
| 383848807 | 616 | PREDICTED: V-type proton ATPase catalyti | 0.998 | 0.996 | 0.913 | 0.0 | |
| 307196686 | 616 | Vacuolar ATP synthase catalytic subunit | 0.995 | 0.993 | 0.918 | 0.0 | |
| 156538350 | 613 | PREDICTED: V-type proton ATPase catalyti | 0.993 | 0.996 | 0.923 | 0.0 | |
| 291866 | 615 | ATPase [Homo sapiens] | 1.0 | 1.0 | 0.907 | 0.0 | |
| 332028118 | 616 | V-type proton ATPase catalytic subunit A | 0.995 | 0.993 | 0.915 | 0.0 | |
| 380012277 | 616 | PREDICTED: V-type proton ATPase catalyti | 0.998 | 0.996 | 0.910 | 0.0 | |
| 326509331 | 614 | predicted protein [Hordeum vulgare subsp | 0.996 | 0.998 | 0.916 | 0.0 | |
| 193690627 | 614 | PREDICTED: v-type proton ATPase catalyti | 0.996 | 0.998 | 0.918 | 0.0 |
| >gi|307184603|gb|EFN70941.1| Vacuolar ATP synthase catalytic subunit A [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
Score = 1191 bits (3081), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 568/612 (92%), Positives = 595/612 (97%)
Query: 4 ALGKMADEDREGRFGFVYAVSGPVVTAEKMSGSAMYELVRVGYFELVGEIIRLEGDMATI 63
+L K+A E+REG+FG+VYAVSGPVVTAEKMSGSAMYELVRVGY+ELVGEIIRLEGDMATI
Sbjct: 5 SLAKIAHEEREGKFGYVYAVSGPVVTAEKMSGSAMYELVRVGYYELVGEIIRLEGDMATI 64
Query: 64 QVYEETSGVTVGDPVLRTGKPLSVELGPGILGSIFDGIQRPLKDINELSQSIYIPKGVNI 123
QVYEETSGVTVGDPVLRTGKPLSVELGPGILGSIFDGIQRPLKDINEL+ SIYIPKGVN+
Sbjct: 65 QVYEETSGVTVGDPVLRTGKPLSVELGPGILGSIFDGIQRPLKDINELTSSIYIPKGVNV 124
Query: 124 PALNRDVSWEFNPMNLKIGSHITGGDQYGLVHENTLVKHKMIMPPKAKGTVTYIAPAGNY 183
PAL+R SWEFNP N+K GSHITGGD YG+VHENTLVKH MI+PPK KGTVTYIAPAGNY
Sbjct: 125 PALSRTASWEFNPHNIKNGSHITGGDMYGVVHENTLVKHWMILPPKCKGTVTYIAPAGNY 184
Query: 184 KVDEVVLETEFDGEKSKYTMVQVWPVRQPRPVTEKLPANYPLLTGQRVLDSLFPCVLGGT 243
VD+VVLETEFDGE+ KYTM+QVWPVRQPRPVTEKLPAN+PLLTGQRVLDSLFPCV GGT
Sbjct: 185 TVDDVVLETEFDGERQKYTMLQVWPVRQPRPVTEKLPANHPLLTGQRVLDSLFPCVQGGT 244
Query: 244 TAIPGAFGCGKTVISQALSKYSNSDVIVYVGCGERGNEMAEVLRDFPELTIEVDGVTESI 303
TAIPGAFGCGKTVISQALSKYSNSDVI+YVGCGERGNEM+EVLRDFPELT+E+DGVTESI
Sbjct: 245 TAIPGAFGCGKTVISQALSKYSNSDVIIYVGCGERGNEMSEVLRDFPELTVEIDGVTESI 304
Query: 304 MKRTTLVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRL 363
MKRT LVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRL
Sbjct: 305 MKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRL 364
Query: 364 AEMPADSGYPAYLGARLASFYERAGRVKCLGNPDREGSVSIVGAVSPPGGDFSDPVTSAT 423
AEMPADSGYPAYLGARLASFYERAGRVKCLGNPDREGSVSIVGAVSPPGGDFSDPVTSAT
Sbjct: 365 AEMPADSGYPAYLGARLASFYERAGRVKCLGNPDREGSVSIVGAVSPPGGDFSDPVTSAT 424
Query: 424 LGIVQVFWGLDKKLAQRKHFPSINWLISYSKYMRALDDFYDKNHPEFVPLRTKVKEILQE 483
LGIVQVFWGLDKKLAQRKHFPSINWLISYSKY+RALDDFYDKN PEFVPLRTKVKEILQE
Sbjct: 425 LGIVQVFWGLDKKLAQRKHFPSINWLISYSKYLRALDDFYDKNFPEFVPLRTKVKEILQE 484
Query: 484 EEDLSEIVQLVGKASLAESDKITLEVAKLLKDDFLQQNSYSPYDRFCPFYKTVGMLRNMI 543
EEDLSEIVQLVGKASLAE+DKITLEVAKLLKDDFLQQNSYSPYDRFCPFYKTVGMLRNMI
Sbjct: 485 EEDLSEIVQLVGKASLAETDKITLEVAKLLKDDFLQQNSYSPYDRFCPFYKTVGMLRNMI 544
Query: 544 AFYDMSRHAVESTAQSENKITWSVIRDSMSNILYQLSSMKFKDPVKDGEAKTRADFDQLY 603
AFYDM+RHAVESTAQS+NKITW+VIRDSM NILYQLSSMKFKDPVKDGEAK R+DFDQL+
Sbjct: 545 AFYDMARHAVESTAQSDNKITWNVIRDSMGNILYQLSSMKFKDPVKDGEAKIRSDFDQLH 604
Query: 604 EDIQQAFRNLED 615
EDIQQAFRNLED
Sbjct: 605 EDIQQAFRNLED 616
|
Source: Camponotus floridanus Species: Camponotus floridanus Genus: Camponotus Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|322791035|gb|EFZ15643.1| hypothetical protein SINV_11459 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|383848807|ref|XP_003700039.1| PREDICTED: V-type proton ATPase catalytic subunit A-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|307196686|gb|EFN78145.1| Vacuolar ATP synthase catalytic subunit A [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|156538350|ref|XP_001604685.1| PREDICTED: V-type proton ATPase catalytic subunit A isoform 1 [Nasonia vitripennis] gi|345491380|ref|XP_003426585.1| PREDICTED: V-type proton ATPase catalytic subunit A isoform 2 [Nasonia vitripennis] gi|345491382|ref|XP_003426586.1| PREDICTED: V-type proton ATPase catalytic subunit A isoform 3 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|291866|gb|AAA35578.1| ATPase [Homo sapiens] | Back alignment and taxonomy information |
|---|
| >gi|332028118|gb|EGI68169.1| V-type proton ATPase catalytic subunit A [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|380012277|ref|XP_003690212.1| PREDICTED: V-type proton ATPase catalytic subunit A-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|326509331|dbj|BAJ91582.1| predicted protein [Hordeum vulgare subsp. vulgare] | Back alignment and taxonomy information |
|---|
| >gi|193690627|ref|XP_001950890.1| PREDICTED: v-type proton ATPase catalytic subunit A-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 615 | ||||||
| FB|FBgn0263598 | 614 | Vha68-2 "Vacuolar H[+] ATPase | 0.993 | 0.995 | 0.883 | 1.1e-293 | |
| ZFIN|ZDB-GENE-030131-9529 | 617 | atp6v1ab "ATPase, H+ transport | 0.993 | 0.990 | 0.826 | 7.7e-277 | |
| ZFIN|ZDB-GENE-040426-1143 | 617 | atp6v1aa "ATPase, H+ transport | 0.993 | 0.990 | 0.816 | 2.7e-274 | |
| UNIPROTKB|F1SP93 | 618 | ATP6V1A "V-type proton ATPase | 0.993 | 0.988 | 0.818 | 2.4e-273 | |
| UNIPROTKB|P31404 | 617 | ATP6V1A "V-type proton ATPase | 0.993 | 0.990 | 0.818 | 3.1e-273 | |
| UNIPROTKB|P38606 | 617 | ATP6V1A "V-type proton ATPase | 0.993 | 0.990 | 0.815 | 6.4e-273 | |
| UNIPROTKB|E2QYG6 | 618 | ATP6V1A "Uncharacterized prote | 0.993 | 0.988 | 0.816 | 1.3e-272 | |
| UNIPROTKB|Q5R5H2 | 617 | ATP6V1A "V-type proton ATPase | 0.993 | 0.990 | 0.813 | 1.3e-272 | |
| UNIPROTKB|F1NBW2 | 617 | LOC100859311 "Uncharacterized | 0.993 | 0.990 | 0.813 | 1.7e-272 | |
| MGI|MGI:1201780 | 617 | Atp6v1a "ATPase, H+ transporti | 0.993 | 0.990 | 0.815 | 1.7e-272 |
| FB|FBgn0263598 Vha68-2 "Vacuolar H[+] ATPase 68 kDa subunit 2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 2820 (997.7 bits), Expect = 1.1e-293, P = 1.1e-293
Identities = 540/611 (88%), Positives = 580/611 (94%)
Query: 5 LGKMADEDREGRFGFVYAVSGPVVTAEKMSGSAMYELVRVGYFELVGEIIRLEGDMATIQ 64
L + DE+RE ++G V+AVSGPVVTAE MSGSAMYELVRVGY+ELVGEIIRLEGDMATIQ
Sbjct: 4 LKRFDDEERESKYGRVFAVSGPVVTAEAMSGSAMYELVRVGYYELVGEIIRLEGDMATIQ 63
Query: 65 VYEETSGVTVGDPVLRTGKPLSVELGPGILGSIFDGIQRPLKDINELSQSIYIPKGVNIP 124
VYEETSGVTVGDPVLRTGKPLSVELGPGI+GSIFDGIQRPLKDINEL++SIYIPKGVN+P
Sbjct: 64 VYEETSGVTVGDPVLRTGKPLSVELGPGIMGSIFDGIQRPLKDINELTESIYIPKGVNVP 123
Query: 125 ALNRDVSWEFNPMNLKIGSHITGGDQYGLVHENTLVKHKMIMPPKAKGTVTYIAPAGNYK 184
+L+R SWEFNP+N+K+GSHITGGD YGLVHENTLVKHKMI+ P+AKGTV YIAP+GNYK
Sbjct: 124 SLSRVASWEFNPLNVKVGSHITGGDLYGLVHENTLVKHKMIVNPRAKGTVRYIAPSGNYK 183
Query: 185 VDEVVLETEFDGEKSKYTMXXXXXXXXXXXXTEKLPANYPLLTGQRVLDSLFPCVLGGTT 244
VD+VVLETEFDGE +K+TM TEKLPAN+PLLTGQRVLDSLFPCV GGTT
Sbjct: 184 VDDVVLETEFDGEITKHTMLQVWPVRQPRPVTEKLPANHPLLTGQRVLDSLFPCVQGGTT 243
Query: 245 AIPGAFGCGKTVISQALSKYSNSDVIVYVGCGERGNEMAEVLRDFPELTIEVDGVTESIM 304
AIPGAFGCGKTVISQALSKYSNSDVI+YVGCGERGNEM+EVLRDFPEL++E+DGVTESIM
Sbjct: 244 AIPGAFGCGKTVISQALSKYSNSDVIIYVGCGERGNEMSEVLRDFPELSVEIDGVTESIM 303
Query: 305 KRTTLVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLA 364
KRT LVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLA
Sbjct: 304 KRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLA 363
Query: 365 EMPADSGYPAYLGARLASFYERAGRVKCLGNPDREGSVSIVGAVSPPGGDFSDPVTSATL 424
EMPADSGYPAYLGARLASFYERAGRVKCLGNP+REGSVSIVGAVSPPGGDFSDPVTSATL
Sbjct: 364 EMPADSGYPAYLGARLASFYERAGRVKCLGNPEREGSVSIVGAVSPPGGDFSDPVTSATL 423
Query: 425 GIVQVFWGLDKKLAQRKHFPSINWLISYSKYMRALDDFYDKNHPEFVPLRTKVKEILQEE 484
GIVQVFWGLDKKLAQRKHFPSINWLISYSKYMRALDDFYDKN PEFVPLRTKVKEILQEE
Sbjct: 424 GIVQVFWGLDKKLAQRKHFPSINWLISYSKYMRALDDFYDKNFPEFVPLRTKVKEILQEE 483
Query: 485 EDLSEIVQLVGKASLAESDKITLEVAKLLKDDFLQQNSYSPYDRFCPFYKTVGMLRNMIA 544
EDLSEIVQLVGKASLAE+DKITLEVAKLLKDDFLQQNSYS YDRFCPFYKTVGMLRN+I
Sbjct: 484 EDLSEIVQLVGKASLAETDKITLEVAKLLKDDFLQQNSYSSYDRFCPFYKTVGMLRNIID 543
Query: 545 FYDMSRHAVESTAQSENKITWSVIRDSMSNILYQLSSMKFKDPVKDGEAKTRADFDQLYE 604
FYDM+RH+VESTAQSENKITW+VIR++M NI+YQLSSMKFKDPVKDGEAK +ADF+QL+E
Sbjct: 544 FYDMARHSVESTAQSENKITWNVIREAMGNIMYQLSSMKFKDPVKDGEAKIKADFEQLHE 603
Query: 605 DIQQAFRNLED 615
D+QQAFRNLED
Sbjct: 604 DLQQAFRNLED 614
|
|
| ZFIN|ZDB-GENE-030131-9529 atp6v1ab "ATPase, H+ transporting, lysosomal V1 subunit Ab" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-1143 atp6v1aa "ATPase, H+ transporting, lysosomal V1 subunit Aa" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SP93 ATP6V1A "V-type proton ATPase catalytic subunit A" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P31404 ATP6V1A "V-type proton ATPase catalytic subunit A" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P38606 ATP6V1A "V-type proton ATPase catalytic subunit A" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QYG6 ATP6V1A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5R5H2 ATP6V1A "V-type proton ATPase catalytic subunit A" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NBW2 LOC100859311 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1201780 Atp6v1a "ATPase, H+ transporting, lysosomal V1 subunit A" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q57670 | VATA_METJA | 3, ., 6, ., 3, ., 1, 4 | 0.5467 | 0.8910 | 0.9335 | yes | N/A |
| Q97QA8 | VATA_STRPN | 3, ., 6, ., 3, ., 1, 4 | 0.5150 | 0.9040 | 0.9407 | yes | N/A |
| P11592 | VATA_NEUCR | 3, ., 6, ., 3, ., 1, 4 | 0.6494 | 0.9593 | 0.9719 | N/A | N/A |
| O32466 | VATA_THESI | 3, ., 6, ., 3, ., 1, 4 | 0.5016 | 0.9430 | 0.9914 | N/A | N/A |
| Q5TTG1 | VATA_ANOGA | 3, ., 6, ., 3, ., 1, 4 | 0.8985 | 0.9934 | 0.9951 | yes | N/A |
| Q9UVJ8 | VATA_ASHGO | 3, ., 6, ., 3, ., 1, 4 | 0.6622 | 0.9739 | 0.9708 | yes | N/A |
| Q27331 | VATA2_DROME | 3, ., 6, ., 3, ., 1, 4 | 0.9018 | 0.9934 | 0.9951 | yes | N/A |
| P54647 | VATA_DICDI | 3, ., 6, ., 3, ., 1, 4 | 0.6959 | 0.9951 | 0.9902 | yes | N/A |
| Q9SM09 | VATA_CITUN | 3, ., 6, ., 3, ., 1, 4 | 0.6933 | 0.9918 | 0.9791 | N/A | N/A |
| A3CK48 | VATA_STRSV | 3, ., 6, ., 3, ., 1, 4 | 0.5306 | 0.8666 | 0.8942 | yes | N/A |
| P31400 | VATA_MANSE | 3, ., 6, ., 3, ., 1, 4 | 0.9068 | 0.9951 | 0.9918 | N/A | N/A |
| P31406 | VATA_SCHPO | 3, ., 6, ., 3, ., 1, 4 | 0.6721 | 0.9739 | 0.9676 | yes | N/A |
| B0K8E8 | VATA_THEP3 | 3, ., 6, ., 3, ., 1, 4 | 0.4991 | 0.9365 | 0.9762 | yes | N/A |
| P31404 | VATA_BOVIN | 3, ., 6, ., 3, ., 1, 4 | 0.8338 | 0.9967 | 0.9935 | yes | N/A |
| P31405 | VATA_GOSHI | 3, ., 6, ., 3, ., 1, 4 | 0.6884 | 0.9918 | 0.9791 | N/A | N/A |
| Q5R5H2 | VATA_PONAB | 3, ., 6, ., 3, ., 1, 4 | 0.8289 | 0.9967 | 0.9935 | yes | N/A |
| Q61VZ4 | VATA_CAEBR | 3, ., 6, ., 3, ., 1, 4 | 0.8059 | 0.9788 | 0.9933 | N/A | N/A |
| C1CES2 | VATA_STRZJ | 3, ., 6, ., 3, ., 1, 4 | 0.5150 | 0.9040 | 0.9407 | yes | N/A |
| P49087 | VATA_MAIZE | 3, ., 6, ., 3, ., 1, 4 | 0.7127 | 0.9008 | 0.9875 | N/A | N/A |
| P13548 | VATA_VIGRR | 3, ., 6, ., 3, ., 1, 4 | 0.6982 | 0.9918 | 0.9791 | N/A | N/A |
| A0PZC6 | VATA_CLONN | 3, ., 6, ., 3, ., 1, 4 | 0.525 | 0.9008 | 0.9373 | yes | N/A |
| Q90647 | VATA_CHICK | 3, ., 6, ., 3, ., 1, 4 | 0.8273 | 0.9967 | 0.9935 | yes | N/A |
| Q40002 | VATA_HORVU | 3, ., 6, ., 3, ., 1, 4 | 0.7041 | 0.9349 | 0.9913 | N/A | N/A |
| Q29048 | VATA_PIG | 3, ., 6, ., 3, ., 1, 4 | 0.8273 | 0.9967 | 0.9935 | yes | N/A |
| P48602 | VATA1_DROME | 3, ., 6, ., 3, ., 1, 4 | 0.8723 | 0.9934 | 0.9951 | no | N/A |
| Q38677 | VATA2_ACEAT | 3, ., 6, ., 3, ., 1, 4 | 0.6919 | 0.9788 | 0.9820 | N/A | N/A |
| Q38676 | VATA1_ACEAT | 3, ., 6, ., 3, ., 1, 4 | 0.7001 | 0.9788 | 0.9820 | N/A | N/A |
| A6UT35 | VATA_META3 | 3, ., 6, ., 3, ., 1, 4 | 0.5269 | 0.8910 | 0.9351 | yes | N/A |
| Q26975 | VATA_TRYCO | 3, ., 6, ., 3, ., 1, 4 | 0.6555 | 0.9707 | 0.9786 | N/A | N/A |
| A2BKX6 | VATA_HYPBU | 3, ., 6, ., 3, ., 1, 4 | 0.4983 | 0.9479 | 0.9700 | yes | N/A |
| B8ZK31 | VATA_STRPJ | 3, ., 6, ., 3, ., 1, 4 | 0.5150 | 0.9040 | 0.9407 | yes | N/A |
| P50516 | VATA_MOUSE | 3, ., 6, ., 3, ., 1, 4 | 0.8306 | 0.9967 | 0.9935 | yes | N/A |
| Q8TWL6 | VATA_METKA | 3, ., 6, ., 3, ., 1, 4 | 0.5210 | 0.9414 | 0.9780 | yes | N/A |
| Q39442 | VATA_BETVU | 3, ., 6, ., 3, ., 1, 4 | 0.6957 | 0.9837 | 0.9711 | N/A | N/A |
| Q76NM6 | VATA_PLAF7 | 3, ., 6, ., 3, ., 1, 4 | 0.6187 | 0.9674 | 0.9738 | yes | N/A |
| C5A336 | VATA_THEGJ | 3, ., 6, ., 3, ., 1, 4 | 0.5092 | 0.9365 | 0.9846 | yes | N/A |
| Q9XW92 | VATA_CAEEL | 3, ., 6, ., 3, ., 1, 4 | 0.8009 | 0.9788 | 0.9933 | yes | N/A |
| Q03498 | VATA_PLAFA | 3, ., 6, ., 3, ., 1, 4 | 0.6187 | 0.9674 | 0.9738 | yes | N/A |
| O16109 | VATA_AEDAE | 3, ., 6, ., 3, ., 1, 4 | 0.9056 | 0.9983 | 1.0 | N/A | N/A |
| Q39291 | VATA_BRANA | 3, ., 6, ., 3, ., 1, 4 | 0.6916 | 0.9918 | 0.9791 | N/A | N/A |
| O06504 | VATA_DESSY | 3, ., 6, ., 3, ., 1, 4 | 0.5050 | 0.9430 | 0.9914 | N/A | N/A |
| P48414 | VATA_CYACA | 3, ., 6, ., 3, ., 1, 4 | 0.7120 | 0.9268 | 0.9710 | N/A | N/A |
| P38606 | VATA_HUMAN | 3, ., 6, ., 3, ., 1, 4 | 0.8306 | 0.9967 | 0.9935 | yes | N/A |
| O23654 | VATA_ARATH | 3, ., 6, ., 3, ., 1, 4 | 0.6965 | 0.9918 | 0.9791 | yes | N/A |
| B5E552 | VATA_STRP4 | 3, ., 6, ., 3, ., 1, 4 | 0.5150 | 0.9040 | 0.9407 | yes | N/A |
| Q2TJ56 | VATA_AEDAL | 3, ., 6, ., 3, ., 1, 4 | 0.9056 | 0.9983 | 1.0 | N/A | N/A |
| O27036 | VATA_METTH | 3, ., 6, ., 3, ., 1, 4 | 0.5415 | 0.8926 | 0.9400 | yes | N/A |
| B1ICC9 | VATA_STRPI | 3, ., 6, ., 3, ., 1, 4 | 0.5186 | 0.9040 | 0.9407 | yes | N/A |
| P09469 | VATA_DAUCA | 3, ., 6, ., 3, ., 1, 4 | 0.6867 | 0.9918 | 0.9791 | N/A | N/A |
| Q8SQU9 | VATA_ENCCU | 3, ., 6, ., 3, ., 1, 4 | 0.6392 | 0.9495 | 0.9621 | yes | N/A |
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.6.3.14 | 0.993 |
| 3rd Layer | 3.6.3 | 0.998 |
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 615 | |||
| TIGR01042 | 591 | TIGR01042, V-ATPase_V1_A, V-type (H+)-ATPase V1, A | 0.0 | |
| COG1155 | 588 | COG1155, NtpA, Archaeal/vacuolar-type H+-ATPase su | 0.0 | |
| PRK04192 | 586 | PRK04192, PRK04192, V-type ATP synthase subunit A; | 0.0 | |
| cd01134 | 369 | cd01134, V_A-ATPase_A, V/A-type ATP synthase catal | 0.0 | |
| TIGR01043 | 578 | TIGR01043, ATP_syn_A_arch, ATP synthase archaeal, | 0.0 | |
| PRK14698 | 1017 | PRK14698, PRK14698, V-type ATP synthase subunit A; | 1e-119 | |
| pfam00006 | 213 | pfam00006, ATP-synt_ab, ATP synthase alpha/beta fa | 3e-92 | |
| PRK14698 | 1017 | PRK14698, PRK14698, V-type ATP synthase subunit A; | 2e-71 | |
| TIGR02546 | 422 | TIGR02546, III_secr_ATP, type III secretion appara | 6e-41 | |
| cd01136 | 326 | cd01136, ATPase_flagellum-secretory_path_III, Flag | 1e-40 | |
| TIGR03498 | 418 | TIGR03498, FliI_clade3, flagellar protein export A | 2e-40 | |
| COG1157 | 441 | COG1157, FliI, Flagellar biosynthesis/type III sec | 1e-38 | |
| TIGR03497 | 413 | TIGR03497, FliI_clade2, flagellar protein export A | 9e-37 | |
| TIGR01026 | 440 | TIGR01026, fliI_yscN, ATPase FliI/YscN family | 2e-36 | |
| PRK06820 | 440 | PRK06820, PRK06820, type III secretion system ATPa | 5e-35 | |
| PRK08149 | 428 | PRK08149, PRK08149, ATP synthase SpaL; Validated | 5e-35 | |
| PRK06936 | 439 | PRK06936, PRK06936, type III secretion system ATPa | 2e-34 | |
| PRK07721 | 438 | PRK07721, fliI, flagellum-specific ATP synthase; V | 8e-32 | |
| TIGR03496 | 411 | TIGR03496, FliI_clade1, flagellar protein export A | 1e-31 | |
| PRK08927 | 442 | PRK08927, fliI, flagellum-specific ATP synthase; V | 3e-31 | |
| TIGR01039 | 461 | TIGR01039, atpD, ATP synthase, F1 beta subunit | 4e-31 | |
| PRK07594 | 433 | PRK07594, PRK07594, type III secretion system ATPa | 1e-29 | |
| COG0055 | 468 | COG0055, AtpD, F0F1-type ATP synthase, beta subuni | 4e-28 | |
| PRK06315 | 442 | PRK06315, PRK06315, type III secretion system ATPa | 7e-28 | |
| PRK12597 | 461 | PRK12597, PRK12597, F0F1 ATP synthase subunit beta | 1e-27 | |
| PRK09099 | 441 | PRK09099, PRK09099, type III secretion system ATPa | 3e-27 | |
| PRK08972 | 444 | PRK08972, fliI, flagellum-specific ATP synthase; V | 4e-25 | |
| TIGR03305 | 449 | TIGR03305, alt_F1F0_F1_bet, alternate F1F0 ATPase, | 1e-24 | |
| PRK05688 | 451 | PRK05688, fliI, flagellum-specific ATP synthase; V | 1e-24 | |
| PRK07196 | 434 | PRK07196, fliI, flagellum-specific ATP synthase; V | 2e-24 | |
| PRK06002 | 450 | PRK06002, fliI, flagellum-specific ATP synthase; V | 6e-24 | |
| pfam00306 | 110 | pfam00306, ATP-synt_ab_C, ATP synthase alpha/beta | 1e-23 | |
| cd01133 | 274 | cd01133, F1-ATPase_beta, F1 ATP synthase beta subu | 6e-23 | |
| PRK07960 | 455 | PRK07960, fliI, flagellum-specific ATP synthase; V | 8e-22 | |
| TIGR01041 | 458 | TIGR01041, ATP_syn_B_arch, ATP synthase archaeal, | 5e-21 | |
| PRK04196 | 460 | PRK04196, PRK04196, V-type ATP synthase subunit B; | 7e-21 | |
| PRK09280 | 463 | PRK09280, PRK09280, F0F1 ATP synthase subunit beta | 1e-20 | |
| cd01135 | 276 | cd01135, V_A-ATPase_B, V/A-type ATP synthase (non- | 2e-20 | |
| PRK06793 | 432 | PRK06793, fliI, flagellum-specific ATP synthase; V | 6e-20 | |
| COG1156 | 463 | COG1156, NtpB, Archaeal/vacuolar-type H+-ATPase su | 1e-19 | |
| PRK08472 | 434 | PRK08472, fliI, flagellum-specific ATP synthase; V | 2e-18 | |
| TIGR01040 | 466 | TIGR01040, V-ATPase_V1_B, V-type (H+)-ATPase V1, B | 2e-18 | |
| CHL00060 | 494 | CHL00060, atpB, ATP synthase CF1 beta subunit | 2e-18 | |
| TIGR00962 | 501 | TIGR00962, atpA, proton translocating ATP synthase | 2e-18 | |
| PRK05922 | 434 | PRK05922, PRK05922, type III secretion system ATPa | 9e-18 | |
| cd01132 | 274 | cd01132, F1_ATPase_alpha, F1 ATP synthase alpha, c | 5e-17 | |
| cd01120 | 165 | cd01120, RecA-like_NTPases, RecA-like NTPases | 4e-16 | |
| PTZ00185 | 574 | PTZ00185, PTZ00185, ATPase alpha subunit; Provisio | 7e-15 | |
| pfam02874 | 69 | pfam02874, ATP-synt_ab_N, ATP synthase alpha/beta | 1e-14 | |
| PRK13343 | 502 | PRK13343, PRK13343, F0F1 ATP synthase subunit alph | 2e-14 | |
| COG0056 | 504 | COG0056, AtpA, F0F1-type ATP synthase, alpha subun | 1e-13 | |
| CHL00059 | 485 | CHL00059, atpA, ATP synthase CF1 alpha subunit | 3e-12 | |
| COG1156 | 463 | COG1156, NtpB, Archaeal/vacuolar-type H+-ATPase su | 5e-12 | |
| PRK04196 | 460 | PRK04196, PRK04196, V-type ATP synthase subunit B; | 1e-10 | |
| TIGR03324 | 497 | TIGR03324, alt_F1F0_F1_al, alternate F1F0 ATPase, | 1e-10 | |
| TIGR02546 | 422 | TIGR02546, III_secr_ATP, type III secretion appara | 1e-08 | |
| PRK09281 | 502 | PRK09281, PRK09281, F0F1 ATP synthase subunit alph | 5e-08 | |
| PRK06820 | 440 | PRK06820, PRK06820, type III secretion system ATPa | 6e-08 | |
| TIGR01026 | 440 | TIGR01026, fliI_yscN, ATPase FliI/YscN family | 7e-08 | |
| PRK02118 | 436 | PRK02118, PRK02118, V-type ATP synthase subunit B; | 7e-08 | |
| COG1157 | 441 | COG1157, FliI, Flagellar biosynthesis/type III sec | 8e-08 | |
| TIGR03498 | 418 | TIGR03498, FliI_clade3, flagellar protein export A | 1e-06 | |
| PRK02118 | 436 | PRK02118, PRK02118, V-type ATP synthase subunit B; | 3e-06 | |
| TIGR03496 | 411 | TIGR03496, FliI_clade1, flagellar protein export A | 4e-06 | |
| TIGR01041 | 458 | TIGR01041, ATP_syn_B_arch, ATP synthase archaeal, | 5e-06 | |
| PRK12597 | 461 | PRK12597, PRK12597, F0F1 ATP synthase subunit beta | 7e-06 | |
| TIGR03497 | 413 | TIGR03497, FliI_clade2, flagellar protein export A | 1e-05 | |
| COG0055 | 468 | COG0055, AtpD, F0F1-type ATP synthase, beta subuni | 2e-05 | |
| PRK13343 | 502 | PRK13343, PRK13343, F0F1 ATP synthase subunit alph | 2e-05 | |
| PRK07594 | 433 | PRK07594, PRK07594, type III secretion system ATPa | 6e-05 | |
| TIGR01040 | 466 | TIGR01040, V-ATPase_V1_B, V-type (H+)-ATPase V1, B | 3e-04 | |
| PRK09280 | 463 | PRK09280, PRK09280, F0F1 ATP synthase subunit beta | 4e-04 | |
| PRK09099 | 441 | PRK09099, PRK09099, type III secretion system ATPa | 6e-04 | |
| PRK06315 | 442 | PRK06315, PRK06315, type III secretion system ATPa | 0.003 | |
| TIGR03305 | 449 | TIGR03305, alt_F1F0_F1_bet, alternate F1F0 ATPase, | 0.004 |
| >gnl|CDD|233245 TIGR01042, V-ATPase_V1_A, V-type (H+)-ATPase V1, A subunit | Back alignment and domain information |
|---|
Score = 1224 bits (3168), Expect = 0.0
Identities = 489/592 (82%), Positives = 548/592 (92%), Gaps = 1/592 (0%)
Query: 16 RFGFVYAVSGPVVTAEKMSGSAMYELVRVGYFELVGEIIRLEGDMATIQVYEETSGVTVG 75
+G++Y VSGPVV AE M+G+AMYELVRVG+ ELVGEIIRLEGD ATIQVYEETSG+TVG
Sbjct: 1 EYGYIYKVSGPVVVAENMAGAAMYELVRVGHDELVGEIIRLEGDKATIQVYEETSGLTVG 60
Query: 76 DPVLRTGKPLSVELGPGILGSIFDGIQRPLKDINELSQSIYIPKGVNIPALNRDVSWEFN 135
DPVLRTGKPLSVELGPGILG+IFDGIQRPLK I E SQSIYIP+GVN+PAL+RD WEF
Sbjct: 61 DPVLRTGKPLSVELGPGILGNIFDGIQRPLKAIAEQSQSIYIPRGVNVPALDRDKKWEFT 120
Query: 136 PMNLKIGSHITGGDQYGLVHENTLVKHKMIMPPKAKGTVTYIAPAGNYKVDEVVLETEFD 195
P L++G HITGGD YG V EN+L+KHK+++PP+A+GT+TYIAPAGNY VD+ VLE EF
Sbjct: 121 PKKLRVGDHITGGDIYGTVFENSLIKHKIMLPPRARGTITYIAPAGNYTVDDTVLEVEFQ 180
Query: 196 GEKSKYTMVQVWPVRQPRPVTEKLPANYPLLTGQRVLDSLFPCVLGGTTAIPGAFGCGKT 255
G K K++M+Q WPVR PRPVTEKLPAN PLLTGQRVLD+LFPCV GGTTAIPGAFGCGKT
Sbjct: 181 GVKKKFSMLQTWPVRSPRPVTEKLPANTPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKT 240
Query: 256 VISQALSKYSNSDVIVYVGCGERGNEMAEVLRDFPELTIEVDGVTESIMKRTTLVANTSN 315
VISQ+LSKYSNSD IVYVGCGERGNEMAEVL DFPELT+EVDG ESIMKRTTLVANTSN
Sbjct: 241 VISQSLSKYSNSDAIVYVGCGERGNEMAEVLMDFPELTMEVDGREESIMKRTTLVANTSN 300
Query: 316 MPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAY 375
MPVAAREASIYTGITL+EYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAY
Sbjct: 301 MPVAAREASIYTGITLAEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAY 360
Query: 376 LGARLASFYERAGRVKCLGNPDREGSVSIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDK 435
LGARLASFYERAGRVKCLG+P+REGSVSIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDK
Sbjct: 361 LGARLASFYERAGRVKCLGSPEREGSVSIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDK 420
Query: 436 KLAQRKHFPSINWLISYSKYMRALDDFYDKNHPEFVPLRTKVKEILQEEEDLSEIVQLVG 495
KLAQRKHFPS+NWLISYSKYMRAL++FY+K +PEFVPLRTK KEILQEEEDL+EIVQLVG
Sbjct: 421 KLAQRKHFPSVNWLISYSKYMRALEEFYEKFYPEFVPLRTKAKEILQEEEDLNEIVQLVG 480
Query: 496 KASLAESDKITLEVAKLLKDDFLQQNSYSPYDRFCPFYKTVGMLRNMIAFYDMSRHAVES 555
K +LAE+DKITLEVAKL+K+DFLQQN Y+PYDRFCPFYKTVGM+RNMIAFYD++R AVE
Sbjct: 481 KDALAETDKITLEVAKLIKEDFLQQNGYTPYDRFCPFYKTVGMMRNMIAFYDLARQAVER 540
Query: 556 TAQSENKITWSVIRDSMSNILYQLSSMKFKDPVKDGEAKTRADFDQLYEDIQ 607
TAQ +NKITWS+I++S+ ++LY+LSSMKF+DP DGEAK +AD+++L ED+Q
Sbjct: 541 TAQDDNKITWSIIKESLGDLLYRLSSMKFEDPS-DGEAKIKADYEKLNEDMQ 591
|
This models eukaryotic vacuolar (H+)-ATPase that is responsible for acidifying cellular compartments. This enzyme shares extensive sequence similarity with archaeal ATP synthase [Transport and binding proteins, Cations and iron carrying compounds]. Length = 591 |
| >gnl|CDD|224077 COG1155, NtpA, Archaeal/vacuolar-type H+-ATPase subunit A [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|235248 PRK04192, PRK04192, V-type ATP synthase subunit A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238554 cd01134, V_A-ATPase_A, V/A-type ATP synthase catalytic subunit A | Back alignment and domain information |
|---|
| >gnl|CDD|130115 TIGR01043, ATP_syn_A_arch, ATP synthase archaeal, A subunit | Back alignment and domain information |
|---|
| >gnl|CDD|184795 PRK14698, PRK14698, V-type ATP synthase subunit A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215651 pfam00006, ATP-synt_ab, ATP synthase alpha/beta family, nucleotide-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|184795 PRK14698, PRK14698, V-type ATP synthase subunit A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233918 TIGR02546, III_secr_ATP, type III secretion apparatus H+-transporting two-sector ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|238556 cd01136, ATPase_flagellum-secretory_path_III, Flagellum-specific ATPase/type III secretory pathway virulence-related protein | Back alignment and domain information |
|---|
| >gnl|CDD|163293 TIGR03498, FliI_clade3, flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >gnl|CDD|224079 COG1157, FliI, Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|211826 TIGR03497, FliI_clade2, flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >gnl|CDD|233237 TIGR01026, fliI_yscN, ATPase FliI/YscN family | Back alignment and domain information |
|---|
| >gnl|CDD|180712 PRK06820, PRK06820, type III secretion system ATPase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236166 PRK08149, PRK08149, ATP synthase SpaL; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180762 PRK06936, PRK06936, type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181092 PRK07721, fliI, flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213817 TIGR03496, FliI_clade1, flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >gnl|CDD|236351 PRK08927, fliI, flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|211621 TIGR01039, atpD, ATP synthase, F1 beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|136438 PRK07594, PRK07594, type III secretion system ATPase SsaN; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223133 COG0055, AtpD, F0F1-type ATP synthase, beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|180526 PRK06315, PRK06315, type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183615 PRK12597, PRK12597, F0F1 ATP synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|169656 PRK09099, PRK09099, type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181599 PRK08972, fliI, flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|132348 TIGR03305, alt_F1F0_F1_bet, alternate F1F0 ATPase, F1 subunit beta | Back alignment and domain information |
|---|
| >gnl|CDD|168181 PRK05688, fliI, flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180875 PRK07196, fliI, flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235666 PRK06002, fliI, flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|215848 pfam00306, ATP-synt_ab_C, ATP synthase alpha/beta chain, C terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|238553 cd01133, F1-ATPase_beta, F1 ATP synthase beta subunit, nucleotide-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|181182 PRK07960, fliI, flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|200071 TIGR01041, ATP_syn_B_arch, ATP synthase archaeal, B subunit | Back alignment and domain information |
|---|
| >gnl|CDD|235251 PRK04196, PRK04196, V-type ATP synthase subunit B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236447 PRK09280, PRK09280, F0F1 ATP synthase subunit beta; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|238555 cd01135, V_A-ATPase_B, V/A-type ATP synthase (non-catalytic) subunit B | Back alignment and domain information |
|---|
| >gnl|CDD|180696 PRK06793, fliI, flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|224078 COG1156, NtpB, Archaeal/vacuolar-type H+-ATPase subunit B [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|181439 PRK08472, fliI, flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|233244 TIGR01040, V-ATPase_V1_B, V-type (H+)-ATPase V1, B subunit | Back alignment and domain information |
|---|
| >gnl|CDD|214349 CHL00060, atpB, ATP synthase CF1 beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|233211 TIGR00962, atpA, proton translocating ATP synthase, F1 alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|102061 PRK05922, PRK05922, type III secretion system ATPase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|238552 cd01132, F1_ATPase_alpha, F1 ATP synthase alpha, central domain | Back alignment and domain information |
|---|
| >gnl|CDD|238540 cd01120, RecA-like_NTPases, RecA-like NTPases | Back alignment and domain information |
|---|
| >gnl|CDD|140212 PTZ00185, PTZ00185, ATPase alpha subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217261 pfam02874, ATP-synt_ab_N, ATP synthase alpha/beta family, beta-barrel domain | Back alignment and domain information |
|---|
| >gnl|CDD|183987 PRK13343, PRK13343, F0F1 ATP synthase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223134 COG0056, AtpA, F0F1-type ATP synthase, alpha subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|176999 CHL00059, atpA, ATP synthase CF1 alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|224078 COG1156, NtpB, Archaeal/vacuolar-type H+-ATPase subunit B [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|235251 PRK04196, PRK04196, V-type ATP synthase subunit B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132367 TIGR03324, alt_F1F0_F1_al, alternate F1F0 ATPase, F1 subunit alpha | Back alignment and domain information |
|---|
| >gnl|CDD|233918 TIGR02546, III_secr_ATP, type III secretion apparatus H+-transporting two-sector ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|236448 PRK09281, PRK09281, F0F1 ATP synthase subunit alpha; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180712 PRK06820, PRK06820, type III secretion system ATPase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|233237 TIGR01026, fliI_yscN, ATPase FliI/YscN family | Back alignment and domain information |
|---|
| >gnl|CDD|179373 PRK02118, PRK02118, V-type ATP synthase subunit B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224079 COG1157, FliI, Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|163293 TIGR03498, FliI_clade3, flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >gnl|CDD|179373 PRK02118, PRK02118, V-type ATP synthase subunit B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213817 TIGR03496, FliI_clade1, flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >gnl|CDD|200071 TIGR01041, ATP_syn_B_arch, ATP synthase archaeal, B subunit | Back alignment and domain information |
|---|
| >gnl|CDD|183615 PRK12597, PRK12597, F0F1 ATP synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|211826 TIGR03497, FliI_clade2, flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >gnl|CDD|223133 COG0055, AtpD, F0F1-type ATP synthase, beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|183987 PRK13343, PRK13343, F0F1 ATP synthase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|136438 PRK07594, PRK07594, type III secretion system ATPase SsaN; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|233244 TIGR01040, V-ATPase_V1_B, V-type (H+)-ATPase V1, B subunit | Back alignment and domain information |
|---|
| >gnl|CDD|236447 PRK09280, PRK09280, F0F1 ATP synthase subunit beta; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|169656 PRK09099, PRK09099, type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180526 PRK06315, PRK06315, type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132348 TIGR03305, alt_F1F0_F1_bet, alternate F1F0 ATPase, F1 subunit beta | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 615 | |||
| KOG1352|consensus | 618 | 100.0 | ||
| TIGR01042 | 591 | V-ATPase_V1_A V-type (H+)-ATPase V1, A subunit. Th | 100.0 | |
| COG1155 | 588 | NtpA Archaeal/vacuolar-type H+-ATPase subunit A [E | 100.0 | |
| TIGR01043 | 578 | ATP_syn_A_arch ATP synthase archaeal, A subunit. A | 100.0 | |
| PRK04192 | 586 | V-type ATP synthase subunit A; Provisional | 100.0 | |
| PRK14698 | 1017 | V-type ATP synthase subunit A; Provisional | 100.0 | |
| cd01134 | 369 | V_A-ATPase_A V/A-type ATP synthase catalytic subun | 100.0 | |
| PRK04196 | 460 | V-type ATP synthase subunit B; Provisional | 100.0 | |
| TIGR01041 | 458 | ATP_syn_B_arch ATP synthase archaeal, B subunit. A | 100.0 | |
| PRK09280 | 463 | F0F1 ATP synthase subunit beta; Validated | 100.0 | |
| COG1157 | 441 | FliI Flagellar biosynthesis/type III secretory pat | 100.0 | |
| TIGR00962 | 501 | atpA proton translocating ATP synthase, F1 alpha s | 100.0 | |
| PRK09281 | 502 | F0F1 ATP synthase subunit alpha; Validated | 100.0 | |
| TIGR03324 | 497 | alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit a | 100.0 | |
| PRK06936 | 439 | type III secretion system ATPase; Provisional | 100.0 | |
| PRK13343 | 502 | F0F1 ATP synthase subunit alpha; Provisional | 100.0 | |
| PRK12597 | 461 | F0F1 ATP synthase subunit beta; Provisional | 100.0 | |
| TIGR01039 | 461 | atpD ATP synthase, F1 beta subunit. The sequences | 100.0 | |
| PRK08972 | 444 | fliI flagellum-specific ATP synthase; Validated | 100.0 | |
| CHL00060 | 494 | atpB ATP synthase CF1 beta subunit | 100.0 | |
| CHL00059 | 485 | atpA ATP synthase CF1 alpha subunit | 100.0 | |
| TIGR03305 | 449 | alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit | 100.0 | |
| TIGR01040 | 466 | V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit. Th | 100.0 | |
| PRK08927 | 442 | fliI flagellum-specific ATP synthase; Validated | 100.0 | |
| PRK09099 | 441 | type III secretion system ATPase; Provisional | 100.0 | |
| PRK06820 | 440 | type III secretion system ATPase; Validated | 100.0 | |
| PRK05688 | 451 | fliI flagellum-specific ATP synthase; Validated | 100.0 | |
| PRK07165 | 507 | F0F1 ATP synthase subunit alpha; Validated | 100.0 | |
| TIGR03496 | 411 | FliI_clade1 flagellar protein export ATPase FliI. | 100.0 | |
| PRK07594 | 433 | type III secretion system ATPase SsaN; Validated | 100.0 | |
| PRK02118 | 436 | V-type ATP synthase subunit B; Provisional | 100.0 | |
| PRK08472 | 434 | fliI flagellum-specific ATP synthase; Validated | 100.0 | |
| TIGR03498 | 418 | FliI_clade3 flagellar protein export ATPase FliI. | 100.0 | |
| TIGR03497 | 413 | FliI_clade2 flagellar protein export ATPase FliI. | 100.0 | |
| PRK08149 | 428 | ATP synthase SpaL; Validated | 100.0 | |
| PRK05922 | 434 | type III secretion system ATPase; Validated | 100.0 | |
| TIGR02546 | 422 | III_secr_ATP type III secretion apparatus H+-trans | 100.0 | |
| PRK07960 | 455 | fliI flagellum-specific ATP synthase; Validated | 100.0 | |
| PTZ00185 | 574 | ATPase alpha subunit; Provisional | 100.0 | |
| TIGR01026 | 440 | fliI_yscN ATPase FliI/YscN family. This family of | 100.0 | |
| PRK07196 | 434 | fliI flagellum-specific ATP synthase; Validated | 100.0 | |
| PRK06002 | 450 | fliI flagellum-specific ATP synthase; Validated | 100.0 | |
| PRK07721 | 438 | fliI flagellum-specific ATP synthase; Validated | 100.0 | |
| PRK06315 | 442 | type III secretion system ATPase; Provisional | 100.0 | |
| PRK06793 | 432 | fliI flagellum-specific ATP synthase; Validated | 100.0 | |
| COG0056 | 504 | AtpA F0F1-type ATP synthase, alpha subunit [Energy | 100.0 | |
| cd01135 | 276 | V_A-ATPase_B V/A-type ATP synthase (non-catalytic) | 100.0 | |
| cd01133 | 274 | F1-ATPase_beta F1 ATP synthase beta subunit, nucle | 100.0 | |
| cd01132 | 274 | F1_ATPase_alpha F1 ATP synthase alpha, central dom | 100.0 | |
| cd01136 | 326 | ATPase_flagellum-secretory_path_III Flagellum-spec | 100.0 | |
| COG0055 | 468 | AtpD F0F1-type ATP synthase, beta subunit [Energy | 100.0 | |
| COG1156 | 463 | NtpB Archaeal/vacuolar-type H+-ATPase subunit B [E | 100.0 | |
| PF00006 | 215 | ATP-synt_ab: ATP synthase alpha/beta family, nucle | 100.0 | |
| KOG1351|consensus | 489 | 100.0 | ||
| KOG1350|consensus | 521 | 100.0 | ||
| PRK12608 | 380 | transcription termination factor Rho; Provisional | 100.0 | |
| PRK09376 | 416 | rho transcription termination factor Rho; Provisio | 100.0 | |
| PRK12678 | 672 | transcription termination factor Rho; Provisional | 100.0 | |
| TIGR00767 | 415 | rho transcription termination factor Rho. Members | 100.0 | |
| cd01128 | 249 | rho_factor Transcription termination factor rho is | 100.0 | |
| KOG1353|consensus | 340 | 100.0 | ||
| COG1158 | 422 | Rho Transcription termination factor [Transcriptio | 100.0 | |
| COG1155 | 588 | NtpA Archaeal/vacuolar-type H+-ATPase subunit A [E | 99.39 | |
| PF00306 | 113 | ATP-synt_ab_C: ATP synthase alpha/beta chain, C te | 99.37 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 99.13 | |
| PF02874 | 69 | ATP-synt_ab_N: ATP synthase alpha/beta family, bet | 98.94 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 97.73 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 97.65 | |
| cd01123 | 235 | Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r | 97.58 | |
| TIGR02236 | 310 | recomb_radA DNA repair and recombination protein R | 97.56 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 97.54 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 97.44 | |
| PLN03187 | 344 | meiotic recombination protein DMC1 homolog; Provis | 97.39 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 97.34 | |
| TIGR02238 | 313 | recomb_DMC1 meiotic recombinase Dmc1. This model d | 97.29 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 97.26 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 97.22 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 97.01 | |
| PRK04301 | 317 | radA DNA repair and recombination protein RadA; Va | 96.97 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 96.97 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 96.95 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 96.94 | |
| PTZ00035 | 337 | Rad51 protein; Provisional | 96.93 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 96.87 | |
| PLN03186 | 342 | DNA repair protein RAD51 homolog; Provisional | 96.87 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 96.87 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 96.77 | |
| TIGR02239 | 316 | recomb_RAD51 DNA repair protein RAD51. This eukary | 96.73 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 96.68 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 96.67 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 96.53 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 96.52 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 96.47 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 96.35 | |
| TIGR03880 | 224 | KaiC_arch_3 KaiC domain protein, AF_0351 family. T | 96.3 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 96.29 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 96.2 | |
| PRK09519 | 790 | recA DNA recombination protein RecA; Reviewed | 96.08 | |
| COG1124 | 252 | DppF ABC-type dipeptide/oligopeptide/nickel transp | 96.02 | |
| TIGR03881 | 229 | KaiC_arch_4 KaiC domain protein, PAE1156 family. M | 95.99 | |
| PF08423 | 256 | Rad51: Rad51; InterPro: IPR013632 This domain is f | 95.86 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 95.68 | |
| cd00544 | 169 | CobU Adenosylcobinamide kinase / adenosylcobinamid | 95.51 | |
| PF05729 | 166 | NACHT: NACHT domain | 95.42 | |
| COG2874 | 235 | FlaH Predicted ATPases involved in biogenesis of a | 95.39 | |
| COG3842 | 352 | PotA ABC-type spermidine/putrescine transport syst | 95.39 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 95.36 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 95.31 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 95.27 | |
| COG4619 | 223 | ABC-type uncharacterized transport system, ATPase | 95.24 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 95.24 | |
| TIGR01166 | 190 | cbiO cobalt transport protein ATP-binding subunit. | 95.23 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 95.21 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 95.13 | |
| cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 94.99 | |
| PRK05800 | 170 | cobU adenosylcobinamide kinase/adenosylcobinamide- | 94.98 | |
| cd03258 | 233 | ABC_MetN_methionine_transporter MetN (also known a | 94.93 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 94.9 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 94.89 | |
| cd03229 | 178 | ABC_Class3 This class is comprised of all BPD (Bin | 94.87 | |
| TIGR02211 | 221 | LolD_lipo_ex lipoprotein releasing system, ATP-bin | 94.86 | |
| TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 94.85 | |
| cd03235 | 213 | ABC_Metallic_Cations ABC component of the metal-ty | 94.8 | |
| cd03226 | 205 | ABC_cobalt_CbiO_domain2 Domain II of the ABC compo | 94.78 | |
| cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 94.76 | |
| cd03256 | 241 | ABC_PhnC_transporter ABC-type phosphate/phosphonat | 94.75 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 94.72 | |
| cd03224 | 222 | ABC_TM1139_LivF_branched LivF (TM1139) is part of | 94.72 | |
| cd03254 | 229 | ABCC_Glucan_exporter_like Glucan exporter ATP-bind | 94.71 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 94.67 | |
| cd03262 | 213 | ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- | 94.65 | |
| cd03265 | 220 | ABC_DrrA DrrA is the ATP-binding protein component | 94.64 | |
| cd03257 | 228 | ABC_NikE_OppD_transporters The ABC transporter sub | 94.64 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 94.63 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 94.62 | |
| TIGR03608 | 206 | L_ocin_972_ABC putative bacteriocin export ABC tra | 94.6 | |
| cd03269 | 210 | ABC_putative_ATPase This subfamily is involved in | 94.56 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 94.56 | |
| cd03259 | 213 | ABC_Carb_Solutes_like ABC Carbohydrate and Solute | 94.55 | |
| cd03215 | 182 | ABC_Carb_Monos_II This family represents domain II | 94.55 | |
| TIGR03410 | 230 | urea_trans_UrtE urea ABC transporter, ATP-binding | 94.54 | |
| PRK13540 | 200 | cytochrome c biogenesis protein CcmA; Provisional | 94.54 | |
| TIGR03864 | 236 | PQQ_ABC_ATP ABC transporter, ATP-binding subunit, | 94.53 | |
| PRK11124 | 242 | artP arginine transporter ATP-binding subunit; Pro | 94.53 | |
| PF00005 | 137 | ABC_tran: ABC transporter This structure is on hol | 94.52 | |
| cd03296 | 239 | ABC_CysA_sulfate_importer Part of the ABC transpor | 94.51 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 94.5 | |
| cd03219 | 236 | ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans | 94.5 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 94.5 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 94.5 | |
| cd00820 | 107 | PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC | 94.48 | |
| cd03218 | 232 | ABC_YhbG The ABC transporters belonging to the Yhb | 94.48 | |
| cd03298 | 211 | ABC_ThiQ_thiamine_transporter ABC-type thiamine tr | 94.45 | |
| cd03261 | 235 | ABC_Org_Solvent_Resistant ABC (ATP-binding cassett | 94.45 | |
| COG3638 | 258 | ABC-type phosphate/phosphonate transport system, A | 94.44 | |
| cd03245 | 220 | ABCC_bacteriocin_exporters ABC-type bacteriocin ex | 94.44 | |
| cd03260 | 227 | ABC_PstB_phosphate_transporter Phosphate uptake is | 94.43 | |
| PRK13539 | 207 | cytochrome c biogenesis protein CcmA; Provisional | 94.43 | |
| cd03295 | 242 | ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin | 94.42 | |
| cd03250 | 204 | ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. | 94.38 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 94.36 | |
| cd03293 | 220 | ABC_NrtD_SsuB_transporters NrtD and SsuB are the A | 94.36 | |
| PRK14255 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 94.35 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 94.32 | |
| PRK14247 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 94.31 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 94.31 | |
| PRK11144 | 352 | modC molybdate transporter ATP-binding protein; Pr | 94.28 | |
| cd03268 | 208 | ABC_BcrA_bacitracin_resist The BcrA subfamily repr | 94.28 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 94.27 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 94.27 | |
| PF13173 | 128 | AAA_14: AAA domain | 94.27 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 94.26 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 94.25 | |
| PRK14240 | 250 | phosphate transporter ATP-binding protein; Provisi | 94.24 | |
| cd03266 | 218 | ABC_NatA_sodium_exporter NatA is the ATPase compon | 94.22 | |
| PRK13541 | 195 | cytochrome c biogenesis protein CcmA; Provisional | 94.22 | |
| PRK10584 | 228 | putative ABC transporter ATP-binding protein YbbA; | 94.22 | |
| TIGR01184 | 230 | ntrCD nitrate transport ATP-binding subunits C and | 94.2 | |
| PRK10908 | 222 | cell division protein FtsE; Provisional | 94.2 | |
| PF13521 | 163 | AAA_28: AAA domain; PDB: 1LW7_A. | 94.19 | |
| PRK10575 | 265 | iron-hydroxamate transporter ATP-binding subunit; | 94.19 | |
| cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 94.19 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 94.18 | |
| cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 94.18 | |
| cd03301 | 213 | ABC_MalK_N The N-terminal ATPase domain of the mal | 94.17 | |
| PF00154 | 322 | RecA: recA bacterial DNA recombination protein; In | 94.17 | |
| PRK08727 | 233 | hypothetical protein; Validated | 94.15 | |
| PRK11248 | 255 | tauB taurine transporter ATP-binding subunit; Prov | 94.14 | |
| PRK10771 | 232 | thiQ thiamine transporter ATP-binding subunit; Pro | 94.14 | |
| TIGR01978 | 243 | sufC FeS assembly ATPase SufC. SufC is part of the | 94.13 | |
| PRK14242 | 253 | phosphate transporter ATP-binding protein; Provisi | 94.12 | |
| PRK15177 | 213 | Vi polysaccharide export ATP-binding protein VexC; | 94.1 | |
| cd03251 | 234 | ABCC_MsbA MsbA is an essential ABC transporter, cl | 94.1 | |
| cd03231 | 201 | ABC_CcmA_heme_exporter CcmA, the ATP-binding compo | 94.09 | |
| TIGR03771 | 223 | anch_rpt_ABC anchored repeat-type ABC transporter, | 94.09 | |
| PRK13543 | 214 | cytochrome c biogenesis protein CcmA; Provisional | 94.09 | |
| cd03233 | 202 | ABC_PDR_domain1 The pleiotropic drug resistance (P | 94.07 | |
| TIGR01526 | 325 | nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr | 94.07 | |
| PRK11432 | 351 | fbpC ferric transporter ATP-binding subunit; Provi | 94.07 | |
| COG4525 | 259 | TauB ABC-type taurine transport system, ATPase com | 94.06 | |
| PRK11629 | 233 | lolD lipoprotein transporter ATP-binding subunit; | 94.05 | |
| PRK10895 | 241 | lipopolysaccharide ABC transporter ATP-binding pro | 94.04 | |
| PRK11264 | 250 | putative amino-acid ABC transporter ATP-binding pr | 94.04 | |
| PRK14250 | 241 | phosphate ABC transporter ATP-binding protein; Pro | 94.03 | |
| PRK11701 | 258 | phnK phosphonate C-P lyase system protein PhnK; Pr | 94.03 | |
| PRK14267 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 94.03 | |
| cd03249 | 238 | ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) | 94.03 | |
| PRK15056 | 272 | manganese/iron transporter ATP-binding protein; Pr | 94.0 | |
| PRK14248 | 268 | phosphate ABC transporter ATP-binding protein; Pro | 93.99 | |
| TIGR03005 | 252 | ectoine_ehuA ectoine/hydroxyectoine ABC transporte | 93.97 | |
| PRK09493 | 240 | glnQ glutamine ABC transporter ATP-binding protein | 93.97 | |
| COG4172 | 534 | ABC-type uncharacterized transport system, duplica | 93.96 | |
| PRK13538 | 204 | cytochrome c biogenesis protein CcmA; Provisional | 93.96 | |
| PRK10851 | 353 | sulfate/thiosulfate transporter subunit; Provision | 93.96 | |
| PRK14274 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 93.96 | |
| COG4555 | 245 | NatA ABC-type Na+ transport system, ATPase compone | 93.95 | |
| PRK11247 | 257 | ssuB aliphatic sulfonates transport ATP-binding su | 93.93 | |
| PRK14239 | 252 | phosphate transporter ATP-binding protein; Provisi | 93.92 | |
| cd03217 | 200 | ABC_FeS_Assembly ABC-type transport system involve | 93.92 | |
| PRK10247 | 225 | putative ABC transporter ATP-binding protein YbbL; | 93.91 | |
| COG4987 | 573 | CydC ABC-type transport system involved in cytochr | 93.91 | |
| TIGR03740 | 223 | galliderm_ABC gallidermin-class lantibiotic protec | 93.91 | |
| TIGR01188 | 302 | drrA daunorubicin resistance ABC transporter ATP-b | 93.89 | |
| TIGR02323 | 253 | CP_lyasePhnK phosphonate C-P lyase system protein | 93.86 | |
| cd03252 | 237 | ABCC_Hemolysin The ABC-transporter hemolysin B is | 93.85 | |
| PRK11650 | 356 | ugpC glycerol-3-phosphate transporter ATP-binding | 93.84 | |
| PRK14262 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 93.84 | |
| PRK13632 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.83 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 93.83 | |
| cd03236 | 255 | ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o | 93.82 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 93.82 | |
| cd03290 | 218 | ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec | 93.82 | |
| TIGR02770 | 230 | nickel_nikD nickel import ATP-binding protein NikD | 93.82 | |
| TIGR03265 | 353 | PhnT2 putative 2-aminoethylphosphonate ABC transpo | 93.8 | |
| PRK14273 | 254 | phosphate ABC transporter ATP-binding protein; Pro | 93.79 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 93.79 | |
| PF13479 | 213 | AAA_24: AAA domain | 93.78 | |
| TIGR03411 | 242 | urea_trans_UrtD urea ABC transporter, ATP-binding | 93.78 | |
| PRK10253 | 265 | iron-enterobactin transporter ATP-binding protein; | 93.78 | |
| PRK11614 | 237 | livF leucine/isoleucine/valine transporter ATP-bin | 93.78 | |
| TIGR02324 | 224 | CP_lyasePhnL phosphonate C-P lyase system protein | 93.76 | |
| PRK14256 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 93.76 | |
| cd03248 | 226 | ABCC_TAP TAP, the Transporter Associated with Anti | 93.75 | |
| TIGR00972 | 247 | 3a0107s01c2 phosphate ABC transporter, ATP-binding | 93.71 | |
| PRK14241 | 258 | phosphate transporter ATP-binding protein; Provisi | 93.71 | |
| PRK15093 | 330 | antimicrobial peptide ABC transporter ATP-binding | 93.7 | |
| cd03267 | 236 | ABC_NatA_like Similar in sequence to NatA, this is | 93.7 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 93.7 | |
| cd03369 | 207 | ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty | 93.69 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 93.68 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 93.68 | |
| PRK13649 | 280 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.64 | |
| cd03244 | 221 | ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. | 93.62 | |
| TIGR01189 | 198 | ccmA heme ABC exporter, ATP-binding protein CcmA. | 93.62 | |
| CHL00131 | 252 | ycf16 sulfate ABC transporter protein; Validated | 93.61 | |
| PRK13639 | 275 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.61 | |
| PRK09544 | 251 | znuC high-affinity zinc transporter ATPase; Review | 93.6 | |
| PRK13638 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.6 | |
| TIGR02769 | 265 | nickel_nikE nickel import ATP-binding protein NikE | 93.6 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 93.59 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 93.59 | |
| cd03294 | 269 | ABC_Pro_Gly_Bertaine This family comprises the gly | 93.58 | |
| PRK14253 | 249 | phosphate ABC transporter ATP-binding protein; Pro | 93.58 | |
| PRK09984 | 262 | phosphonate/organophosphate ester transporter subu | 93.58 | |
| PRK13648 | 269 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.57 | |
| cd03213 | 194 | ABCG_EPDR ABCG transporters are involved in eye pi | 93.57 | |
| PRK11831 | 269 | putative ABC transporter ATP-binding protein YrbF; | 93.57 | |
| TIGR01288 | 303 | nodI ATP-binding ABC transporter family nodulation | 93.56 | |
| PRK14272 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 93.55 | |
| PRK11300 | 255 | livG leucine/isoleucine/valine transporter ATP-bin | 93.55 | |
| PRK13548 | 258 | hmuV hemin importer ATP-binding subunit; Provision | 93.54 | |
| COG0468 | 279 | RecA RecA/RadA recombinase [DNA replication, recom | 93.54 | |
| PRK10744 | 260 | pstB phosphate transporter ATP-binding protein; Pr | 93.53 | |
| cd03253 | 236 | ABCC_ATM1_transporter ATM1 is an ABC transporter t | 93.53 | |
| cd03264 | 211 | ABC_drug_resistance_like ABC-type multidrug transp | 93.53 | |
| PRK14237 | 267 | phosphate transporter ATP-binding protein; Provisi | 93.53 | |
| PRK14266 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 93.51 | |
| cd03237 | 246 | ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o | 93.51 | |
| PRK13645 | 289 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.51 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 93.5 | |
| PRK10418 | 254 | nikD nickel transporter ATP-binding protein NikD; | 93.49 | |
| PRK14251 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 93.48 | |
| PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 93.47 | |
| PRK14244 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 93.45 | |
| TIGR00968 | 237 | 3a0106s01 sulfate ABC transporter, ATP-binding pro | 93.45 | |
| PRK14245 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 93.44 | |
| PRK13647 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.43 | |
| PRK14268 | 258 | phosphate ABC transporter ATP-binding protein; Pro | 93.41 | |
| PRK14270 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 93.4 | |
| PRK14259 | 269 | phosphate ABC transporter ATP-binding protein; Pro | 93.4 | |
| PRK09452 | 375 | potA putrescine/spermidine ABC transporter ATPase | 93.39 | |
| PRK14265 | 274 | phosphate ABC transporter ATP-binding protein; Pro | 93.37 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 93.36 | |
| PRK14249 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 93.36 | |
| PRK14261 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 93.36 | |
| cd03232 | 192 | ABC_PDR_domain2 The pleiotropic drug resistance-li | 93.35 | |
| PRK13646 | 286 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.34 | |
| PRK09473 | 330 | oppD oligopeptide transporter ATP-binding componen | 93.34 | |
| PRK11308 | 327 | dppF dipeptide transporter ATP-binding subunit; Pr | 93.31 | |
| TIGR02982 | 220 | heterocyst_DevA ABC exporter ATP-binding subunit, | 93.31 | |
| PRK10619 | 257 | histidine/lysine/arginine/ornithine transporter su | 93.29 | |
| PRK13641 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.28 | |
| PRK13640 | 282 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.28 | |
| PRK14236 | 272 | phosphate transporter ATP-binding protein; Provisi | 93.27 | |
| cd03234 | 226 | ABCG_White The White subfamily represents ABC tran | 93.25 | |
| PRK14246 | 257 | phosphate ABC transporter ATP-binding protein; Pro | 93.24 | |
| PRK11607 | 377 | potG putrescine transporter ATP-binding subunit; P | 93.23 | |
| PRK13651 | 305 | cobalt transporter ATP-binding subunit; Provisiona | 93.22 | |
| COG4167 | 267 | SapF ABC-type antimicrobial peptide transport syst | 93.21 | |
| PRK14243 | 264 | phosphate transporter ATP-binding protein; Provisi | 93.21 | |
| PRK14260 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 93.2 | |
| TIGR02142 | 354 | modC_ABC molybdenum ABC transporter, ATP-binding p | 93.2 | |
| PRK14271 | 276 | phosphate ABC transporter ATP-binding protein; Pro | 93.19 | |
| cd03220 | 224 | ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo | 93.19 | |
| TIGR03873 | 256 | F420-0_ABC_ATP proposed F420-0 ABC transporter, AT | 93.19 | |
| PRK14254 | 285 | phosphate ABC transporter ATP-binding protein; Pro | 93.18 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 93.16 | |
| PRK11231 | 255 | fecE iron-dicitrate transporter ATP-binding subuni | 93.16 | |
| PRK13643 | 288 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.15 | |
| TIGR02868 | 529 | CydC thiol reductant ABC exporter, CydC subunit. T | 93.14 | |
| PRK14269 | 246 | phosphate ABC transporter ATP-binding protein; Pro | 93.14 | |
| PRK15079 | 331 | oligopeptide ABC transporter ATP-binding protein O | 93.13 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 93.11 | |
| PRK10419 | 268 | nikE nickel transporter ATP-binding protein NikE; | 93.11 | |
| TIGR02314 | 343 | ABC_MetN D-methionine ABC transporter, ATP-binding | 93.11 | |
| cd03299 | 235 | ABC_ModC_like Archeal protein closely related to M | 93.1 | |
| PRK13547 | 272 | hmuV hemin importer ATP-binding subunit; Provision | 93.09 | |
| PRK13637 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.08 | |
| PRK14238 | 271 | phosphate transporter ATP-binding protein; Provisi | 93.08 | |
| PRK13650 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.07 | |
| PRK14275 | 286 | phosphate ABC transporter ATP-binding protein; Pro | 93.06 | |
| PRK13546 | 264 | teichoic acids export protein ATP-binding subunit; | 93.05 | |
| PF03308 | 266 | ArgK: ArgK protein; InterPro: IPR005129 Bacterial | 93.04 | |
| PRK11000 | 369 | maltose/maltodextrin transporter ATP-binding prote | 93.04 | |
| PF06414 | 199 | Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e | 93.04 | |
| PRK11022 | 326 | dppD dipeptide transporter ATP-binding subunit; Pr | 93.02 | |
| COG1134 | 249 | TagH ABC-type polysaccharide/polyol phosphate tran | 93.01 | |
| PRK15112 | 267 | antimicrobial peptide ABC system ATP-binding prote | 92.99 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 92.96 | |
| PRK14264 | 305 | phosphate ABC transporter ATP-binding protein; Pro | 92.96 | |
| cd01125 | 239 | repA Hexameric Replicative Helicase RepA. RepA is | 92.93 | |
| COG3840 | 231 | ThiQ ABC-type thiamine transport system, ATPase co | 92.93 | |
| cd03300 | 232 | ABC_PotA_N PotA is an ABC-type transporter and the | 92.92 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 92.92 | |
| PRK09580 | 248 | sufC cysteine desulfurase ATPase component; Review | 92.9 | |
| PRK14235 | 267 | phosphate transporter ATP-binding protein; Provisi | 92.89 | |
| PRK03695 | 248 | vitamin B12-transporter ATPase; Provisional | 92.88 | |
| TIGR01277 | 213 | thiQ thiamine ABC transporter, ATP-binding protein | 92.88 | |
| TIGR03258 | 362 | PhnT 2-aminoethylphosphonate ABC transport system, | 92.86 | |
| PRK13644 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 92.84 | |
| PRK13634 | 290 | cbiO cobalt transporter ATP-binding subunit; Provi | 92.83 | |
| cd03297 | 214 | ABC_ModC_molybdenum_transporter ModC is an ABC-typ | 92.82 | |
| PRK14252 | 265 | phosphate ABC transporter ATP-binding protein; Pro | 92.82 | |
| PRK13635 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 92.79 | |
| COG4181 | 228 | Predicted ABC-type transport system involved in ly | 92.76 | |
| PRK13633 | 280 | cobalt transporter ATP-binding subunit; Provisiona | 92.75 | |
| PRK13652 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 92.73 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 92.72 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 92.7 | |
| PRK13537 | 306 | nodulation ABC transporter NodI; Provisional | 92.68 | |
| PRK13642 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 92.67 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 92.65 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 92.63 | |
| PRK00300 | 205 | gmk guanylate kinase; Provisional | 92.59 | |
| PRK14258 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 92.5 | |
| PRK13631 | 320 | cbiO cobalt transporter ATP-binding subunit; Provi | 92.5 | |
| PRK14257 | 329 | phosphate ABC transporter ATP-binding protein; Pro | 92.48 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 92.47 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 92.47 | |
| TIGR03522 | 301 | GldA_ABC_ATP gliding motility-associated ABC trans | 92.45 | |
| PRK14263 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 92.4 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 92.39 | |
| cd03282 | 204 | ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS | 92.33 | |
| cd03288 | 257 | ABCC_SUR2 The SUR domain 2. The sulfonylurea recep | 92.33 | |
| PRK11153 | 343 | metN DL-methionine transporter ATP-binding subunit | 92.32 | |
| cd03291 | 282 | ABCC_CFTR1 The CFTR subfamily domain 1. The cystic | 92.27 | |
| COG4559 | 259 | ABC-type hemin transport system, ATPase component | 92.24 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 92.2 | |
| PRK13636 | 283 | cbiO cobalt transporter ATP-binding subunit; Provi | 92.14 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 92.1 | |
| PRK13536 | 340 | nodulation factor exporter subunit NodI; Provision | 92.1 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 92.1 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 92.09 | |
| cd03270 | 226 | ABC_UvrA_I The excision repair protein UvrA domain | 92.03 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 92.03 | |
| PF01637 | 234 | Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 | 92.0 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 91.97 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 91.97 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 91.97 | |
| cd03289 | 275 | ABCC_CFTR2 The CFTR subfamily domain 2. The cystic | 91.96 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 91.95 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 91.93 | |
| COG4136 | 213 | ABC-type uncharacterized transport system, ATPase | 91.91 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 91.91 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 91.9 | |
| KOG0060|consensus | 659 | 91.89 | ||
| COG4586 | 325 | ABC-type uncharacterized transport system, ATPase | 91.86 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 91.77 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 91.73 | |
| TIGR03238 | 504 | dnd_assoc_3 dnd system-associated protein 3. cereu | 91.73 | |
| COG1122 | 235 | CbiO ABC-type cobalt transport system, ATPase comp | 91.68 | |
| PRK11176 | 582 | lipid transporter ATP-binding/permease protein; Pr | 91.67 | |
| COG0470 | 325 | HolB ATPase involved in DNA replication [DNA repli | 91.66 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 91.61 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 91.61 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 91.6 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 91.59 | |
| KOG0057|consensus | 591 | 91.56 | ||
| cd00984 | 242 | DnaB_C DnaB helicase C terminal domain. The hexame | 91.56 | |
| COG1127 | 263 | Ttg2A ABC-type transport system involved in resist | 91.55 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 91.55 | |
| cd03287 | 222 | ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS | 91.54 | |
| PRK09536 | 402 | btuD corrinoid ABC transporter ATPase; Reviewed | 91.54 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 91.53 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 91.51 | |
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 91.49 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 91.47 | |
| PRK09087 | 226 | hypothetical protein; Validated | 91.46 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 91.45 | |
| PRK09165 | 497 | replicative DNA helicase; Provisional | 91.44 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 91.38 | |
| PRK14531 | 183 | adenylate kinase; Provisional | 91.38 | |
| PRK11174 | 588 | cysteine/glutathione ABC transporter membrane/ATP- | 91.31 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 91.3 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 91.3 | |
| PRK06217 | 183 | hypothetical protein; Validated | 91.29 | |
| COG1118 | 345 | CysA ABC-type sulfate/molybdate transport systems, | 91.29 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 91.26 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 91.24 | |
| TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 91.21 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 91.21 | |
| COG4608 | 268 | AppF ABC-type oligopeptide transport system, ATPas | 91.2 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 91.2 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 91.17 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 91.16 | |
| KOG2028|consensus | 554 | 91.16 | ||
| COG0444 | 316 | DppD ABC-type dipeptide/oligopeptide/nickel transp | 91.15 | |
| TIGR01193 | 708 | bacteriocin_ABC ABC-type bacteriocin transporter. | 91.09 | |
| KOG0743|consensus | 457 | 91.07 | ||
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 91.07 | |
| PRK10790 | 592 | putative multidrug transporter membrane\ATP-bindin | 91.07 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 91.04 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 90.97 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 90.92 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 90.9 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 90.9 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 90.89 | |
| PRK10522 | 547 | multidrug transporter membrane component/ATP-bindi | 90.89 | |
| TIGR02857 | 529 | CydD thiol reductant ABC exporter, CydD subunit. U | 90.87 | |
| PRK13477 | 512 | bifunctional pantoate ligase/cytidylate kinase; Pr | 90.85 | |
| TIGR03797 | 686 | NHPM_micro_ABC2 NHPM bacteriocin system ABC transp | 90.84 | |
| PRK11160 | 574 | cysteine/glutathione ABC transporter membrane/ATP- | 90.82 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 90.8 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 90.8 | |
| TIGR01194 | 555 | cyc_pep_trnsptr cyclic peptide transporter. This m | 90.79 | |
| COG1131 | 293 | CcmA ABC-type multidrug transport system, ATPase c | 90.71 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 90.7 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 90.67 | |
| COG4107 | 258 | PhnK ABC-type phosphonate transport system, ATPase | 90.66 | |
| TIGR00455 | 184 | apsK adenylylsulfate kinase (apsK). Important resi | 90.62 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 90.61 | |
| PRK10789 | 569 | putative multidrug transporter membrane\ATP-bindin | 90.6 | |
| PF01583 | 156 | APS_kinase: Adenylylsulphate kinase; InterPro: IPR | 90.6 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 90.59 | |
| COG4988 | 559 | CydD ABC-type transport system involved in cytochr | 90.57 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 90.56 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 90.54 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 90.52 | |
| cd03279 | 213 | ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex | 90.43 | |
| cd03243 | 202 | ABC_MutS_homologs The MutS protein initiates DNA m | 90.42 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 90.42 | |
| TIGR03375 | 694 | type_I_sec_LssB type I secretion system ATPase, Ls | 90.38 | |
| PRK10982 | 491 | galactose/methyl galaxtoside transporter ATP-bindi | 90.34 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 90.34 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 90.31 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 90.3 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 90.3 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 90.29 | |
| TIGR03796 | 710 | NHPM_micro_ABC1 NHPM bacteriocin system ABC transp | 90.28 | |
| TIGR02204 | 576 | MsbA_rel ABC transporter, permease/ATP-binding pro | 90.25 | |
| COG1132 | 567 | MdlB ABC-type multidrug transport system, ATPase a | 90.23 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 90.21 | |
| TIGR01842 | 544 | type_I_sec_PrtD type I secretion system ABC transp | 90.2 | |
| KOG0056|consensus | 790 | 90.2 | ||
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 90.19 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 90.18 | |
| PF08477 | 119 | Miro: Miro-like protein; InterPro: IPR013684 Mitoc | 90.13 | |
| PRK09825 | 176 | idnK D-gluconate kinase; Provisional | 90.1 | |
| cd01428 | 194 | ADK Adenylate kinase (ADK) catalyzes the reversibl | 90.09 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 90.07 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 90.06 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 90.06 | |
| PRK03839 | 180 | putative kinase; Provisional | 90.04 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 90.01 | |
| PRK03846 | 198 | adenylylsulfate kinase; Provisional | 89.98 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 89.95 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 89.87 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 89.85 | |
| TIGR01192 | 585 | chvA glucan exporter ATP-binding protein. This mod | 89.85 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 89.8 |
| >KOG1352|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=3e-185 Score=1428.25 Aligned_cols=606 Identities=85% Similarity=1.332 Sum_probs=597.7
Q ss_pred cccCCcceeeEEEEEECceEEEEeCCCCcceeEEEEcCceeEEEEEEEeCCeEEEEEecCCCCCCCCCeEEEcCCcceee
Q psy13480 9 ADEDREGRFGFVYAVSGPVVTAEKMSGSAMYELVRVGYFELVGEIIRLEGDMATIQVYEETSGVTVGDPVLRTGKPLSVE 88 (615)
Q Consensus 9 ~~~~~~~~~G~I~~I~Gpvv~a~g~~~~~~~E~v~vg~~~l~GEVI~i~~d~a~iqvye~t~Gl~~G~~V~~tg~~lsv~ 88 (615)
.+.+.+..+|+|.+|+||||++++|.|+.|||+|+||+..|.||||+++||.|+|||||+|+|+.+||||.+||+||||+
T Consensus 13 ~~e~~es~~G~v~~VSGPVV~a~~M~G~aMYELVrVGh~~LvGEiIrlegD~aTIQVYEeTsG~tVgDpvlrTgkPLsvE 92 (618)
T KOG1352|consen 13 LDEEEESEYGRVYSVSGPVVVAENMAGCAMYELVRVGHDELVGEIIRLEGDMATIQVYEETSGLTVGDPVLRTGKPLSVE 92 (618)
T ss_pred ccchhhhccceEEeccCceEehhcccchHHHHHHHcchHhhhhheeEecCceeEEEEEeccCCcccCCchhhcCCcceEe
Confidence 34466789999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cCcccccccccccccccCCCccccccccccCCCCCCCCCccccccccccccccccccccCcceeeeeccceeeeeecCCC
Q psy13480 89 LGPGILGSIFDGIQRPLKDINELSQSIYIPKGVNIPALNRDVSWEFNPMNLKIGSHITGGDQYGLVHENTLVKHKMIMPP 168 (615)
Q Consensus 89 lGpgLLGrI~DgigrPLd~~~~~~~~~~i~~G~~~~~ld~~~~w~f~p~~~~~g~~v~~g~~~g~v~e~~~~~h~i~~pp 168 (615)
||||++|.|||||||||..+.+.+++.|||+|++.|+|||+.+|+|+|..+++||.|++||++|.|.||++++||||+||
T Consensus 93 LGPGimgsIfDGIQRPLk~I~~~s~siyiPkGv~~~aL~r~~~weF~p~k~~vg~hitGGDiyg~V~ENsli~hki~lpP 172 (618)
T KOG1352|consen 93 LGPGIMGSIFDGIQRPLKDISELSQSIYIPKGVNTPALDREIKWEFTPGKLRVGDHITGGDIYGSVFENSLIKHKILLPP 172 (618)
T ss_pred eCcchhhhhhhhhhhhHHHHHHhcCcEeccCCCCccccCccceeecccceeeecceeecCceEEEeeccchhhceeecCC
Confidence 99999999999999999999999999999999999999999999999988999999999999999999999999999999
Q ss_pred CCCcceeEecCCCCccccceEEEEeecCcceeeeeecccccCCCCCcccCCCCCCccccceeeeccccccccCceeeccC
Q psy13480 169 KAKGTVTYIAPAGNYKVDEVVLETEFDGEKSKYTMVQVWPVRQPRPVTEKLPANYPLLTGQRVLDSLFPCVLGGTTAIPG 248 (615)
Q Consensus 169 ~~~g~v~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~q~wPvr~~rp~~~r~~~~~pl~TG~rviD~l~Pi~kGq~~~I~g 248 (615)
..+|+|+|||++|+|+++|+|+|+|.+|++++++|+|.||||.|||+.++++.+.||+|||||+|+||||.+||+.+|||
T Consensus 173 r~~Gtvt~iAp~G~Y~~~d~vlE~Ef~g~k~~~tmlq~WPVR~pRPv~ekl~an~PLltGQRvLDalfPcVqGGTtaIPG 252 (618)
T KOG1352|consen 173 RARGTVTYIAPAGNYTLDDVVLELEFDGEKTKFTMLQTWPVRQPRPVTEKLPANHPLLTGQRVLDALFPCVQGGTTAIPG 252 (618)
T ss_pred ccCceEEEEecCCccccccEEEEEeecCceeeEEEEEecccCCCcchhhccCCCCcccccchHHHhhcchhcCCccccCc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCCcchhhHHhhhcCCCCEEEEEeecCcchHHHHHHHhcccccccccCccccCcceEEEEEeCCCCCHHHHHHHHHHH
Q psy13480 249 AFGCGKTVISQALSKYSNSDVIVYVGCGERGNEMAEVLRDFPELTIEVDGVTESIMKRTTLVANTSNMPVAAREASIYTG 328 (615)
Q Consensus 249 ~~G~GKt~l~~~la~~~~adviV~~~iGERg~Ev~e~~~~f~~l~~~~~g~~~~~m~rtvlvanTsn~p~~~R~~s~~tg 328 (615)
.||||||++.|+|+|++++|+|||++||||||||.|++.+||+|....+|+.+++|+||.|||||||||+++|++|+|||
T Consensus 253 AFGCGKTVISQsLSKYSNSD~iiYVGCGERGNEMsEVL~dFPeLt~ev~G~~esiMKRT~LVANTSNMPVAAREASIYTG 332 (618)
T KOG1352|consen 253 AFGCGKTVISQSLSKYSNSDAIIYVGCGERGNEMSEVLMDFPELTMEVDGKTESIMKRTALVANTSNMPVAAREASIYTG 332 (618)
T ss_pred ccccchHHHHHHHhhccCCCeEEEEcccccchhHHHHHHhChhhEEecCCcchhhhhhhhhhhcCCCCchhhhhhhhhhc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hhHHHHHHhCCCcEEEEeeCchHHHHHHHHHHhhcCCCCCCCCCCCchhhhHHHHHHhhccccccCCCCCCCceEEEEee
Q psy13480 329 ITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNPDREGSVSIVGAV 408 (615)
Q Consensus 329 ~tiAEyfrd~G~~Vll~~Ds~tR~AeAlREIs~~lgE~P~~eGYP~~l~s~La~~~ERAG~~~~~~~~~~~GSIT~i~~V 408 (615)
+|+|||||||||||.+|+||+|||||||||||+||+|||+..|||+||.++||+||||||+++|||+|++.||+|++++|
T Consensus 333 ITlsEYfRDmG~nVsMmADStSRWAEALREISGRLaEMPADsGyPAYLgArLAsFYERAG~vkcLGsP~ReGsVsIVgAV 412 (618)
T KOG1352|consen 333 ITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGSPDREGSVSIVGAV 412 (618)
T ss_pred ccHHHHHHhcCcceeeeecchhHHHHHHHHhhhhhhcCcCcCCCcHHHHHHHHHHHHhcCceeecCCCCcCceeEEEEee
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cCCCCCCCCchhhhhhcccceEEEecHHHHhCCCCCCCccCccccchhcchhhhhhccCcchHHHHHHHHHHHHhHHHHH
Q psy13480 409 SPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISYSKYMRALDDFYDKNHPEFVPLRTKVKEILQEEEDLS 488 (615)
Q Consensus 409 s~~ggD~s~PV~~~t~~i~dg~i~Ldr~La~~g~yPAId~l~S~Sr~~~~~~~~~~~~~~~~~~~~~~~~~~L~~~~el~ 488 (615)
|||||||+||||.+|++|+++||.||++||+|.|||+|||+.|||+|+..+.+||++++|+|..++.+++++||++++|.
T Consensus 413 SPpGGDFsDPVTsATLgIvQVFWGLDKKLAQRKHFPSiNwliSYSkY~~aL~~~Ye~~~peF~~lRtk~keilq~eedl~ 492 (618)
T KOG1352|consen 413 SPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISYSKYMRALDPFYEKNYPEFVVLRTKAKEILQEEEDLS 492 (618)
T ss_pred cCCCCCcCCcchhhhhheeeehhcccHHHHhhccCCccchhhhHHHHHHHHHHHHHhcCCCccchHHHHHHHHhhhhhHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHhcCCCCcHHhHHHHHHHHHHHHHccCCCCCCCCCccCCHHHHHHHHHHHHHHHHHHHHHHHccccchhhhhHHHH
Q psy13480 489 EIVQLVGKASLAESDKITLEVAKLLKDDFLQQNSYSPYDRFCPFYKTVGMLRNMIAFYDMSRHAVESTAQSENKITWSVI 568 (615)
Q Consensus 489 ~i~~~~g~~~l~~~d~~il~~~~~i~~~fL~Q~~~~~~d~~~~~~kq~~~L~~I~~fyd~a~~ai~~g~~~~~~i~~~~i 568 (615)
+|+|++|+.+|++.|+.+|+++++++++|||||.|++||.||||.|++.||++++.|||.|+.|++.++..+++|+|..|
T Consensus 493 eivQLVGK~aL~etdKitLevaklik~DfLqQN~ys~YD~~CPfyKt~~Mlrn~i~fyd~a~~ave~~a~~~~kitw~~i 572 (618)
T KOG1352|consen 493 EIVQLVGKSALAETDKITLEVAKLIKDDFLQQNGYSPYDRFCPFYKTVGMLRNIIAFYDLARQAVENTAQSGNKITWSKI 572 (618)
T ss_pred HHHHHhhhhhhhhcchhhHHHHHHHHHHHHhhcCCCchhhcCchHHHHHHHHHHHHHHHHHHHHHHhhcccCCccchHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999888899999999
Q ss_pred HhhhhHHHHHHhcCCCCCCCCchhHHHHHHHHHHHHHHHHHHHhhcC
Q psy13480 569 RDSMSNILYQLSSMKFKDPVKDGEAKTRADFDQLYEDIQQAFRNLED 615 (615)
Q Consensus 569 ~~~~~~~~~~i~~~k~~~~~~~~e~~~~~~~~~l~~~i~~~f~~l~~ 615 (615)
++++.+++++|..|||.+| +++|.++.+.|+++.++|...|++|+|
T Consensus 573 r~~~gdi~y~lssmKF~dp-~~ge~~i~~~~~~L~~~~~~~Fr~led 618 (618)
T KOG1352|consen 573 RESTGDIFYQLSSMKFKDP-KDGEKEIKEDFEKLHEDIQQAFRELED 618 (618)
T ss_pred HHhhhhhhhhhhhhhccCc-cchhHHHHHHHHHHHHHHHHHHHhhcC
Confidence 9999999999999999988 889999999999999999999999986
|
|
| >TIGR01042 V-ATPase_V1_A V-type (H+)-ATPase V1, A subunit | Back alignment and domain information |
|---|
| >COG1155 NtpA Archaeal/vacuolar-type H+-ATPase subunit A [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR01043 ATP_syn_A_arch ATP synthase archaeal, A subunit | Back alignment and domain information |
|---|
| >PRK04192 V-type ATP synthase subunit A; Provisional | Back alignment and domain information |
|---|
| >PRK14698 V-type ATP synthase subunit A; Provisional | Back alignment and domain information |
|---|
| >cd01134 V_A-ATPase_A V/A-type ATP synthase catalytic subunit A | Back alignment and domain information |
|---|
| >PRK04196 V-type ATP synthase subunit B; Provisional | Back alignment and domain information |
|---|
| >TIGR01041 ATP_syn_B_arch ATP synthase archaeal, B subunit | Back alignment and domain information |
|---|
| >PRK09280 F0F1 ATP synthase subunit beta; Validated | Back alignment and domain information |
|---|
| >COG1157 FliI Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR00962 atpA proton translocating ATP synthase, F1 alpha subunit | Back alignment and domain information |
|---|
| >PRK09281 F0F1 ATP synthase subunit alpha; Validated | Back alignment and domain information |
|---|
| >TIGR03324 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit alpha | Back alignment and domain information |
|---|
| >PRK06936 type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK13343 F0F1 ATP synthase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PRK12597 F0F1 ATP synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >TIGR01039 atpD ATP synthase, F1 beta subunit | Back alignment and domain information |
|---|
| >PRK08972 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >CHL00060 atpB ATP synthase CF1 beta subunit | Back alignment and domain information |
|---|
| >CHL00059 atpA ATP synthase CF1 alpha subunit | Back alignment and domain information |
|---|
| >TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta | Back alignment and domain information |
|---|
| >TIGR01040 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit | Back alignment and domain information |
|---|
| >PRK08927 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK09099 type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK06820 type III secretion system ATPase; Validated | Back alignment and domain information |
|---|
| >PRK05688 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK07165 F0F1 ATP synthase subunit alpha; Validated | Back alignment and domain information |
|---|
| >TIGR03496 FliI_clade1 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >PRK07594 type III secretion system ATPase SsaN; Validated | Back alignment and domain information |
|---|
| >PRK02118 V-type ATP synthase subunit B; Provisional | Back alignment and domain information |
|---|
| >PRK08472 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >TIGR03498 FliI_clade3 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >TIGR03497 FliI_clade2 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >PRK08149 ATP synthase SpaL; Validated | Back alignment and domain information |
|---|
| >PRK05922 type III secretion system ATPase; Validated | Back alignment and domain information |
|---|
| >TIGR02546 III_secr_ATP type III secretion apparatus H+-transporting two-sector ATPase | Back alignment and domain information |
|---|
| >PRK07960 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PTZ00185 ATPase alpha subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01026 fliI_yscN ATPase FliI/YscN family | Back alignment and domain information |
|---|
| >PRK07196 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK06002 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK07721 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK06315 type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK06793 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >COG0056 AtpA F0F1-type ATP synthase, alpha subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B | Back alignment and domain information |
|---|
| >cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain | Back alignment and domain information |
|---|
| >cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain | Back alignment and domain information |
|---|
| >cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein | Back alignment and domain information |
|---|
| >COG0055 AtpD F0F1-type ATP synthase, beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG1156 NtpB Archaeal/vacuolar-type H+-ATPase subunit B [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >KOG1351|consensus | Back alignment and domain information |
|---|
| >KOG1350|consensus | Back alignment and domain information |
|---|
| >PRK12608 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PRK09376 rho transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PRK12678 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >TIGR00767 rho transcription termination factor Rho | Back alignment and domain information |
|---|
| >cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase | Back alignment and domain information |
|---|
| >KOG1353|consensus | Back alignment and domain information |
|---|
| >COG1158 Rho Transcription termination factor [Transcription] | Back alignment and domain information |
|---|
| >COG1155 NtpA Archaeal/vacuolar-type H+-ATPase subunit A [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF00306 ATP-synt_ab_C: ATP synthase alpha/beta chain, C terminal domain; InterPro: IPR000793 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >PF02874 ATP-synt_ab_N: ATP synthase alpha/beta family, beta-barrel domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR004100 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B | Back alignment and domain information |
|---|
| >TIGR02236 recomb_radA DNA repair and recombination protein RadA | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03187 meiotic recombination protein DMC1 homolog; Provisional | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >PRK04301 radA DNA repair and recombination protein RadA; Validated | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >PTZ00035 Rad51 protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >PLN03186 DNA repair protein RAD51 homolog; Provisional | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >TIGR02239 recomb_RAD51 DNA repair protein RAD51 | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >PRK09519 recA DNA recombination protein RecA; Reviewed | Back alignment and domain information |
|---|
| >COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
| >PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >COG2874 FlaH Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >TIGR01166 cbiO cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
|---|
| >PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated | Back alignment and domain information |
|---|
| >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment | Back alignment and domain information |
|---|
| >TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters | Back alignment and domain information |
|---|
| >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids | Back alignment and domain information |
|---|
| >cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively | Back alignment and domain information |
|---|
| >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin | Back alignment and domain information |
|---|
| >cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup | Back alignment and domain information |
|---|
| >cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
|---|
| >PRK13540 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >PRK11124 artP arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis | Back alignment and domain information |
|---|
| >cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids | Back alignment and domain information |
|---|
| >cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP | Back alignment and domain information |
|---|
| >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters | Back alignment and domain information |
|---|
| >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient | Back alignment and domain information |
|---|
| >PRK13539 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment | Back alignment and domain information |
|---|
| >cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively | Back alignment and domain information |
|---|
| >PRK14255 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK14247 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK11144 modC molybdate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >PRK14240 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake | Back alignment and domain information |
|---|
| >PRK13541 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
|---|
| >TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D | Back alignment and domain information |
|---|
| >PRK10908 cell division protein FtsE; Provisional | Back alignment and domain information |
|---|
| >PF13521 AAA_28: AAA domain; PDB: 1LW7_A | Back alignment and domain information |
|---|
| >PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
|---|
| >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK11248 tauB taurine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01978 sufC FeS assembly ATPase SufC | Back alignment and domain information |
|---|
| >PRK14242 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional | Back alignment and domain information |
|---|
| >cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins | Back alignment and domain information |
|---|
| >cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter | Back alignment and domain information |
|---|
| >TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK13543 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type | Back alignment and domain information |
|---|
| >PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
|---|
| >PRK14250 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional | Back alignment and domain information |
|---|
| >PRK14267 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 | Back alignment and domain information |
|---|
| >PRK15056 manganese/iron transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14248 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13538 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK10851 sulfate/thiosulfate transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14274 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14239 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component | Back alignment and domain information |
|---|
| >PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK | Back alignment and domain information |
|---|
| >cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E | Back alignment and domain information |
|---|
| >PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14262 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >cd03290 ABCC_SUR1_N The SUR domain 1 | Back alignment and domain information |
|---|
| >TIGR02770 nickel_nikD nickel import ATP-binding protein NikD | Back alignment and domain information |
|---|
| >TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14273 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >PF13479 AAA_24: AAA domain | Back alignment and domain information |
|---|
| >TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD | Back alignment and domain information |
|---|
| >PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL | Back alignment and domain information |
|---|
| >PRK14256 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules | Back alignment and domain information |
|---|
| >TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14241 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C | Back alignment and domain information |
|---|
| >TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA | Back alignment and domain information |
|---|
| >CHL00131 ycf16 sulfate ABC transporter protein; Validated | Back alignment and domain information |
|---|
| >PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02769 nickel_nikE nickel import ATP-binding protein NikE | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea | Back alignment and domain information |
|---|
| >PRK14253 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) | Back alignment and domain information |
|---|
| >PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional | Back alignment and domain information |
|---|
| >TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI | Back alignment and domain information |
|---|
| >PRK14272 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13548 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK10744 pstB phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria | Back alignment and domain information |
|---|
| >cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >PRK14237 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14266 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor | Back alignment and domain information |
|---|
| >PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional | Back alignment and domain information |
|---|
| >PRK14251 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
|---|
| >PRK14244 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14245 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14268 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14270 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14259 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14265 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >PRK14249 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14261 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family | Back alignment and domain information |
|---|
| >PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14236 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors | Back alignment and domain information |
|---|
| >PRK14246 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11607 potG putrescine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13651 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK14243 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14260 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14271 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export | Back alignment and domain information |
|---|
| >TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14254 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02868 CydC thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >PRK14269 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional | Back alignment and domain information |
|---|
| >TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03299 ABC_ModC_like Archeal protein closely related to ModC | Back alignment and domain information |
|---|
| >PRK13547 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14238 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14275 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13546 teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components | Back alignment and domain information |
|---|
| >PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] | Back alignment and domain information |
|---|
| >PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >PRK14264 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd01125 repA Hexameric Replicative Helicase RepA | Back alignment and domain information |
|---|
| >COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09580 sufC cysteine desulfurase ATPase component; Reviewed | Back alignment and domain information |
|---|
| >PRK14235 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK03695 vitamin B12-transporter ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT | Back alignment and domain information |
|---|
| >PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB | Back alignment and domain information |
|---|
| >PRK14252 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PRK13633 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >PRK13537 nodulation ABC transporter NodI; Provisional | Back alignment and domain information |
|---|
| >PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >PRK00300 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14258 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14257 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA | Back alignment and domain information |
|---|
| >PRK14263 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes | Back alignment and domain information |
|---|
| >cd03288 ABCC_SUR2 The SUR domain 2 | Back alignment and domain information |
|---|
| >PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 | Back alignment and domain information |
|---|
| >COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13536 nodulation factor exporter subunit NodI; Provisional | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >KOG0060|consensus | Back alignment and domain information |
|---|
| >COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >TIGR03238 dnd_assoc_3 dnd system-associated protein 3 | Back alignment and domain information |
|---|
| >COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11176 lipid transporter ATP-binding/permease protein; Provisional | Back alignment and domain information |
|---|
| >COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG0057|consensus | Back alignment and domain information |
|---|
| >cd00984 DnaB_C DnaB helicase C terminal domain | Back alignment and domain information |
|---|
| >COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09165 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14531 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG2028|consensus | Back alignment and domain information |
|---|
| >COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter | Back alignment and domain information |
|---|
| >KOG0743|consensus | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >TIGR02857 CydD thiol reductant ABC exporter, CydD subunit | Back alignment and domain information |
|---|
| >PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >TIGR01194 cyc_pep_trnsptr cyclic peptide transporter | Back alignment and domain information |
|---|
| >COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00455 apsK adenylylsulfate kinase (apsK) | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends | Back alignment and domain information |
|---|
| >cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family | Back alignment and domain information |
|---|
| >PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein | Back alignment and domain information |
|---|
| >COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family | Back alignment and domain information |
|---|
| >KOG0056|consensus | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases | Back alignment and domain information |
|---|
| >PRK09825 idnK D-gluconate kinase; Provisional | Back alignment and domain information |
|---|
| >cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >PRK03846 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >TIGR01192 chvA glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 615 | ||||
| 3m4y_A | 588 | Structural Characterization Of The Subunit A Mutant | 1e-170 | ||
| 3se0_A | 588 | Structural Characterization Of The Subunit A Mutant | 1e-170 | ||
| 1vdz_A | 588 | Crystal Structure Of A-Type Atpase Catalytic Subuni | 1e-170 | ||
| 3sdz_A | 588 | Structural Characterization Of The Subunit A Mutant | 1e-169 | ||
| 3qjy_A | 588 | Crystal Structure Of P-Loop G234a Mutant Of Subunit | 1e-169 | ||
| 3qia_A | 588 | Crystal Structure Of P-Loop G237a Mutant Of Subunit | 1e-169 | ||
| 3ikj_A | 588 | Structural Characterization For The Nucleotide Bind | 1e-169 | ||
| 3i4l_A | 588 | Structural Characterization For The Nucleotide Bind | 1e-169 | ||
| 3qg1_A | 588 | Crystal Structure Of P-Loop G239a Mutant Of Subunit | 1e-168 | ||
| 3nd9_A | 588 | Structural Characterization For The Nucleotide Bind | 1e-168 | ||
| 3nd8_A | 588 | Structural Characterization For The Nucleotide Bind | 1e-168 | ||
| 3mfy_A | 588 | Structural Characterization Of The Subunit A Mutant | 1e-168 | ||
| 3a5c_A | 578 | Inter-Subunit Interaction And Quaternary Rearrangem | 1e-160 | ||
| 3gqb_A | 578 | Crystal Structure Of The A3b3 Complex From V-atpase | 1e-157 | ||
| 3vr6_A | 600 | Crystal Structure Of Amp-pnp Bound Enterococcus Hir | 1e-157 | ||
| 3vr2_A | 600 | Crystal Structure Of Nucleotide-free A3b3 Complex F | 1e-148 | ||
| 1sky_E | 473 | Crystal Structure Of The Nucleotide Free Alpha3beta | 3e-27 | ||
| 2qe7_D | 462 | Crystal Structure Of The F1-Atpase From The Thermoa | 5e-27 | ||
| 2obl_A | 347 | Structural And Biochemical Analysis Of A Prototypic | 8e-27 | ||
| 4b2q_D | 470 | Model Of The Yeast F1fo-Atp Synthase Dimer Based On | 2e-26 | ||
| 4b2q_E | 473 | Model Of The Yeast F1fo-Atp Synthase Dimer Based On | 2e-26 | ||
| 3fks_D | 484 | Yeast F1 Atpase In The Absence Of Bound Nucleotides | 2e-26 | ||
| 2hld_D | 478 | Crystal Structure Of Yeast Mitochondrial F1-Atpase | 2e-26 | ||
| 3oeh_D | 484 | Structure Of Four Mutant Forms Of Yeast F1 Atpase: | 3e-26 | ||
| 2xok_D | 511 | Refined Structure Of Yeast F1c10 Atpase Complex To | 3e-26 | ||
| 1nbm_E | 480 | The Structure Of Bovine F1-Atpase Covalently Inhibi | 7e-25 | ||
| 2xnd_D | 467 | Crystal Structure Of Bovine F1-C8 Sub-Complex Of At | 1e-24 | ||
| 1mab_B | 479 | Rat Liver F1-Atpase Length = 479 | 1e-24 | ||
| 4asu_D | 480 | F1-Atpase In Which All Three Catalytic Sites Contai | 1e-24 | ||
| 1nbm_D | 480 | The Structure Of Bovine F1-Atpase Covalently Inhibi | 1e-24 | ||
| 1cow_D | 482 | Bovine Mitochondrial F1-Atpase Complexed With Aurov | 1e-24 | ||
| 2w6e_D | 528 | Low Resolution Structures Of Bovine Mitochondrial F | 2e-24 | ||
| 2dpy_A | 438 | Crystal Structure Of The Flagellar Type Iii Atpase | 9e-24 | ||
| 3oaa_D | 459 | Structure Of The E.Coli F1-Atp Synthase Inhibited B | 2e-23 | ||
| 1fx0_B | 498 | Crystal Structure Of The Chloroplast F1-Atpase From | 4e-21 | ||
| 3ssa_A | 460 | Crystal Structure Of Subunit B Mutant N157t Of The | 9e-20 | ||
| 2c61_A | 469 | Crystal Structure Of The Non-Catalytic B Subunit Of | 3e-19 | ||
| 2rkw_A | 469 | Intermediate Position Of Atp On Its Trail To The Bi | 3e-19 | ||
| 3tiv_A | 460 | Crystal Structure Of Subunit B Mutant N157a Of The | 4e-19 | ||
| 3tgw_A | 460 | Crystal Structure Of Subunit B Mutant H156a Of The | 4e-19 | ||
| 3vr2_D | 465 | Crystal Structure Of Nucleotide-free A3b3 Complex F | 4e-16 | ||
| 3vr6_D | 465 | Crystal Structure Of Amp-pnp Bound Enterococcus Hir | 4e-16 | ||
| 1fx0_A | 507 | Crystal Structure Of The Chloroplast F1-Atpase From | 2e-15 | ||
| 3gqb_B | 464 | Crystal Structure Of The A3b3 Complex From V-atpase | 3e-15 | ||
| 3a5c_D | 478 | Inter-Subunit Interaction And Quaternary Rearrangem | 5e-15 | ||
| 3oaa_A | 513 | Structure Of The E.Coli F1-Atp Synthase Inhibited B | 1e-12 | ||
| 4b2q_A | 485 | Model Of The Yeast F1fo-Atp Synthase Dimer Based On | 1e-11 | ||
| 4b2q_B | 486 | Model Of The Yeast F1fo-Atp Synthase Dimer Based On | 1e-11 | ||
| 2hld_A | 510 | Crystal Structure Of Yeast Mitochondrial F1-Atpase | 1e-11 | ||
| 3ofn_A | 510 | Structure Of Four Mutant Forms Of Yeast F1 Atpase: | 1e-11 | ||
| 2xok_A | 545 | Refined Structure Of Yeast F1c10 Atpase Complex To | 2e-11 | ||
| 3oee_A | 510 | Structure Of Four Mutant Forms Of Yeast F1 Atpase: | 2e-11 | ||
| 1sky_B | 502 | Crystal Structure Of The Nucleotide Free Alpha3beta | 3e-11 | ||
| 2xnd_A | 492 | Crystal Structure Of Bovine F1-C8 Sub-Complex Of At | 1e-10 | ||
| 1cow_A | 510 | Bovine Mitochondrial F1-Atpase Complexed With Aurov | 1e-10 | ||
| 1bmf_A | 510 | Bovine Mitochondrial F1-Atpase Length = 510 | 1e-10 | ||
| 2jiz_A | 510 | The Structure Of F1-Atpase Inhibited By Resveratrol | 1e-10 | ||
| 1ohh_B | 487 | Bovine Mitochondrial F1-Atpase Complexed With The I | 1e-10 | ||
| 1mab_A | 510 | Rat Liver F1-Atpase Length = 510 | 1e-10 | ||
| 2w6e_A | 553 | Low Resolution Structures Of Bovine Mitochondrial F | 1e-10 | ||
| 2f43_A | 510 | Rat Liver F1-atpase Length = 510 | 2e-10 | ||
| 2qe7_A | 502 | Crystal Structure Of The F1-Atpase From The Thermoa | 3e-10 | ||
| 2r9v_A | 515 | Crystal Structure Of Atp Synthase Subunit Alpha (Tm | 3e-09 |
| >pdb|3M4Y|A Chain A, Structural Characterization Of The Subunit A Mutant P235a Of The A-Atp Synthase Length = 588 | Back alignment and structure |
|
| >pdb|3SE0|A Chain A, Structural Characterization Of The Subunit A Mutant F508w Of The A-Atp Synthase From Pyrococcus Horikoshii Length = 588 | Back alignment and structure |
| >pdb|1VDZ|A Chain A, Crystal Structure Of A-Type Atpase Catalytic Subunit A From Pyrococcus Horikoshii Ot3 Length = 588 | Back alignment and structure |
| >pdb|3SDZ|A Chain A, Structural Characterization Of The Subunit A Mutant F427w Of The A-Atp Synthase From Pyrococcus Horikoshii Length = 588 | Back alignment and structure |
| >pdb|3QJY|A Chain A, Crystal Structure Of P-Loop G234a Mutant Of Subunit A Of The A1ao Atp Synthase Length = 588 | Back alignment and structure |
| >pdb|3QIA|A Chain A, Crystal Structure Of P-Loop G237a Mutant Of Subunit A Of The A1ao Atp Synthase Length = 588 | Back alignment and structure |
| >pdb|3IKJ|A Chain A, Structural Characterization For The Nucleotide Binding Ability Of Subunit A Mutant S238a Of The A1ao Atp Synthase Length = 588 | Back alignment and structure |
| >pdb|3I4L|A Chain A, Structural Characterization For The Nucleotide Binding Ability Of Subunit A With Amp-Pnp Of The A1ao Atp Synthase Length = 588 | Back alignment and structure |
| >pdb|3QG1|A Chain A, Crystal Structure Of P-Loop G239a Mutant Of Subunit A Of The A1ao Atp Synthase Length = 588 | Back alignment and structure |
| >pdb|3ND9|A Chain A, Structural Characterization For The Nucleotide Binding Ability Of Subunit A Of The A1ao Atp Synthase Length = 588 | Back alignment and structure |
| >pdb|3ND8|A Chain A, Structural Characterization For The Nucleotide Binding Ability Of Subunit A Of The A1ao Atp Synthase Length = 588 | Back alignment and structure |
| >pdb|3MFY|A Chain A, Structural Characterization Of The Subunit A Mutant F236a Of The A-Atp Synthase From Pyrococcus Horikoshii Length = 588 | Back alignment and structure |
| >pdb|3A5C|A Chain A, Inter-Subunit Interaction And Quaternary Rearrangement Defined By The Central Stalk Of Prokaryotic V1-Atpase Length = 578 | Back alignment and structure |
| >pdb|3GQB|A Chain A, Crystal Structure Of The A3b3 Complex From V-atpase Length = 578 | Back alignment and structure |
| >pdb|3VR6|A Chain A, Crystal Structure Of Amp-pnp Bound Enterococcus Hirae V1-atpase [bv1] Length = 600 | Back alignment and structure |
| >pdb|3VR2|A Chain A, Crystal Structure Of Nucleotide-free A3b3 Complex From Enterococcus Hirae V-atpase [ea3b3] Length = 600 | Back alignment and structure |
| >pdb|1SKY|E Chain E, Crystal Structure Of The Nucleotide Free Alpha3beta3 Sub-Complex Of F1-Atpase From The Thermophilic Bacillus Ps3 Length = 473 | Back alignment and structure |
| >pdb|2QE7|D Chain D, Crystal Structure Of The F1-Atpase From The Thermoalkaliphilic Bacterium Bacillus Sp. Ta2.A1 Length = 462 | Back alignment and structure |
| >pdb|2OBL|A Chain A, Structural And Biochemical Analysis Of A Prototypical Atpase From The Type Iii Secretion System Of Pathogenic Bacteria Length = 347 | Back alignment and structure |
| >pdb|4B2Q|D Chain D, Model Of The Yeast F1fo-Atp Synthase Dimer Based On Subtomogram Average Length = 470 | Back alignment and structure |
| >pdb|4B2Q|E Chain E, Model Of The Yeast F1fo-Atp Synthase Dimer Based On Subtomogram Average Length = 473 | Back alignment and structure |
| >pdb|3FKS|D Chain D, Yeast F1 Atpase In The Absence Of Bound Nucleotides Length = 484 | Back alignment and structure |
| >pdb|2HLD|D Chain D, Crystal Structure Of Yeast Mitochondrial F1-Atpase Length = 478 | Back alignment and structure |
| >pdb|3OEH|D Chain D, Structure Of Four Mutant Forms Of Yeast F1 Atpase: Beta-V279f Length = 484 | Back alignment and structure |
| >pdb|2XOK|D Chain D, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A Resolution Length = 511 | Back alignment and structure |
| >pdb|1NBM|E Chain E, The Structure Of Bovine F1-Atpase Covalently Inhibited With 4-Chloro-7-Nitrobenzofurazan Length = 480 | Back alignment and structure |
| >pdb|2XND|D Chain D, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp Synthase Length = 467 | Back alignment and structure |
| >pdb|1MAB|B Chain B, Rat Liver F1-Atpase Length = 479 | Back alignment and structure |
| >pdb|4ASU|D Chain D, F1-Atpase In Which All Three Catalytic Sites Contain Bound Nucleotide, With Magnesium Ion Released In The Empty Site Length = 480 | Back alignment and structure |
| >pdb|1NBM|D Chain D, The Structure Of Bovine F1-Atpase Covalently Inhibited With 4-Chloro-7-Nitrobenzofurazan Length = 480 | Back alignment and structure |
| >pdb|1COW|D Chain D, Bovine Mitochondrial F1-Atpase Complexed With Aurovertin B Length = 482 | Back alignment and structure |
| >pdb|2W6E|D Chain D, Low Resolution Structures Of Bovine Mitochondrial F1-Atpase During Controlled Dehydration: Hydration State 1. Length = 528 | Back alignment and structure |
| >pdb|2DPY|A Chain A, Crystal Structure Of The Flagellar Type Iii Atpase Flii Length = 438 | Back alignment and structure |
| >pdb|3OAA|D Chain D, Structure Of The E.Coli F1-Atp Synthase Inhibited By Subunit Epsilon Length = 459 | Back alignment and structure |
| >pdb|1FX0|B Chain B, Crystal Structure Of The Chloroplast F1-Atpase From Spinach Length = 498 | Back alignment and structure |
| >pdb|3SSA|A Chain A, Crystal Structure Of Subunit B Mutant N157t Of The A1ao Atp Synthase Length = 460 | Back alignment and structure |
| >pdb|2C61|A Chain A, Crystal Structure Of The Non-Catalytic B Subunit Of A-Type Atpase From M. Mazei Go1 Length = 469 | Back alignment and structure |
| >pdb|2RKW|A Chain A, Intermediate Position Of Atp On Its Trail To The Binding Pocket Inside The Subunit B Mutant R416w Of The Energy Converter A1ao Atp Synthase Length = 469 | Back alignment and structure |
| >pdb|3TIV|A Chain A, Crystal Structure Of Subunit B Mutant N157a Of The A1ao Atp Synthase Length = 460 | Back alignment and structure |
| >pdb|3TGW|A Chain A, Crystal Structure Of Subunit B Mutant H156a Of The A1ao Atp Synthase Length = 460 | Back alignment and structure |
| >pdb|3VR2|D Chain D, Crystal Structure Of Nucleotide-free A3b3 Complex From Enterococcus Hirae V-atpase [ea3b3] Length = 465 | Back alignment and structure |
| >pdb|3VR6|D Chain D, Crystal Structure Of Amp-pnp Bound Enterococcus Hirae V1-atpase [bv1] Length = 465 | Back alignment and structure |
| >pdb|1FX0|A Chain A, Crystal Structure Of The Chloroplast F1-Atpase From Spinach Length = 507 | Back alignment and structure |
| >pdb|3GQB|B Chain B, Crystal Structure Of The A3b3 Complex From V-atpase Length = 464 | Back alignment and structure |
| >pdb|3A5C|D Chain D, Inter-Subunit Interaction And Quaternary Rearrangement Defined By The Central Stalk Of Prokaryotic V1-Atpase Length = 478 | Back alignment and structure |
| >pdb|3OAA|A Chain A, Structure Of The E.Coli F1-Atp Synthase Inhibited By Subunit Epsilon Length = 513 | Back alignment and structure |
| >pdb|4B2Q|A Chain A, Model Of The Yeast F1fo-Atp Synthase Dimer Based On Subtomogram Average Length = 485 | Back alignment and structure |
| >pdb|4B2Q|B Chain B, Model Of The Yeast F1fo-Atp Synthase Dimer Based On Subtomogram Average Length = 486 | Back alignment and structure |
| >pdb|2HLD|A Chain A, Crystal Structure Of Yeast Mitochondrial F1-Atpase Length = 510 | Back alignment and structure |
| >pdb|3OFN|A Chain A, Structure Of Four Mutant Forms Of Yeast F1 Atpase: Alpha-N67i Length = 510 | Back alignment and structure |
| >pdb|2XOK|A Chain A, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A Resolution Length = 545 | Back alignment and structure |
| >pdb|3OEE|A Chain A, Structure Of Four Mutant Forms Of Yeast F1 Atpase: Alpha-F405s Length = 510 | Back alignment and structure |
| >pdb|1SKY|B Chain B, Crystal Structure Of The Nucleotide Free Alpha3beta3 Sub-Complex Of F1-Atpase From The Thermophilic Bacillus Ps3 Length = 502 | Back alignment and structure |
| >pdb|2XND|A Chain A, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp Synthase Length = 492 | Back alignment and structure |
| >pdb|1COW|A Chain A, Bovine Mitochondrial F1-Atpase Complexed With Aurovertin B Length = 510 | Back alignment and structure |
| >pdb|1BMF|A Chain A, Bovine Mitochondrial F1-Atpase Length = 510 | Back alignment and structure |
| >pdb|2JIZ|A Chain A, The Structure Of F1-Atpase Inhibited By Resveratrol. Length = 510 | Back alignment and structure |
| >pdb|1OHH|B Chain B, Bovine Mitochondrial F1-Atpase Complexed With The Inhibitor Protein If1 Length = 487 | Back alignment and structure |
| >pdb|1MAB|A Chain A, Rat Liver F1-Atpase Length = 510 | Back alignment and structure |
| >pdb|2W6E|A Chain A, Low Resolution Structures Of Bovine Mitochondrial F1-Atpase During Controlled Dehydration: Hydration State 1. Length = 553 | Back alignment and structure |
| >pdb|2F43|A Chain A, Rat Liver F1-atpase Length = 510 | Back alignment and structure |
| >pdb|2QE7|A Chain A, Crystal Structure Of The F1-Atpase From The Thermoalkaliphilic Bacterium Bacillus Sp. Ta2.A1 Length = 502 | Back alignment and structure |
| >pdb|2R9V|A Chain A, Crystal Structure Of Atp Synthase Subunit Alpha (Tm1612) From Thermotoga Maritima At 2.10 A Resolution Length = 515 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A Length = 588 | Back alignment and structure |
|---|
Score = 892 bits (2307), Expect = 0.0
Identities = 308/596 (51%), Positives = 415/596 (69%), Gaps = 18/596 (3%)
Query: 18 GFVYAVSGPVVTAEKMSGSAMYELVRVGYFELVGEIIRLEGDMATIQVYEETSGVTVGDP 77
G + V+GP+V A+ M G+ MYE+VRVG L+GEIIRLEGD A IQVYEET+GV G+P
Sbjct: 5 GRIIRVTGPLVVADGMKGAKMYEVVRVGELGLIGEIIRLEGDKAVIQVYEETAGVRPGEP 64
Query: 78 VLRTGKPLSVELGPGILGSIFDGIQRPLKDINELSQSIYIPKGVNIPALNRDVSWEFNPM 137
V+ TG LSVELGP +L SI+DGIQRPL+ I E + +I +GV PAL RD W F P
Sbjct: 65 VVGTGASLSVELGPRLLTSIYDGIQRPLEVIREKTGD-FIARGVTAPALPRDKKWHFIP- 122
Query: 138 NLKIGSHITGGDQYGLVHENTLVKHKMIMPPKAKGTVTYIAPAGNYKVDEVVLETEF-DG 196
K+G + GGD G V E +++ HK+++PP +G + IA G+Y ++EV+ + + G
Sbjct: 123 KAKVGDKVVGGDIIGEVPETSIIVHKIMVPPGIEGEIVEIAEEGDYTIEEVIAKVKTPSG 182
Query: 197 EKSKYTMVQVWPVRQPRPVTEKLPANYPLLTGQRVLDSLFPCVLGGTTAIPGAFGCGKTV 256
E + M Q WPVR RP EKLP PL+TGQRV+D+ FP GGT AIPG G GKTV
Sbjct: 183 EIKELKMYQRWPVRVKRPYKEKLPPEVPLITGQRVIDTFFPQAKGGTAAIPGPAGSGKTV 242
Query: 257 ISQALSKYSNSDVIVYVGCGERGNEMAEVLRDFPELTIEVDGVTESIMKRTTLVANTSNM 316
L+K+S++ V++Y+GCGERGNEM +VL +FP+L G + +M+RT L+ANTSNM
Sbjct: 243 TQHQLAKWSDAQVVIYIGCGERGNEMTDVLEEFPKLKDPKTG--KPLMERTVLIANTSNM 300
Query: 317 PVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYL 376
PVAAREASIYTGIT++EYFRDMGY+V++MADSTSRWAEALREISGRL EMP + GYPAYL
Sbjct: 301 PVAAREASIYTGITIAEYFRDMGYDVALMADSTSRWAEALREISGRLEEMPGEEGYPAYL 360
Query: 377 GARLASFYERAGRVKCLGNPDREGSVSIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKK 436
++LA FYERAGRV LG+ R GSVS++GAVSPPGGDFS+PV TL +V+VFW LD
Sbjct: 361 ASKLAEFYERAGRVVTLGSDYRVGSVSVIGAVSPPGGDFSEPVVQNTLRVVKVFWALDAD 420
Query: 437 LAQRKHFPSINWLISYSKYMRALDDFYDKN-HPEFVPLRTKVKEILQEEEDLSEIVQLVG 495
LA+R+HFP+INWL SYS Y+ A+ D++ KN PE+ +R K +LQ+E +L EIV++VG
Sbjct: 421 LARRRHFPAINWLTSYSLYVDAVKDWWHKNIDPEWKAMRDKAMALLQKESELQEIVRIVG 480
Query: 496 KASLAESDKITLEVAKLLKDDFLQQNSYSPYDRFCPFYKTVGMLRNMIAFYDMSRHAVES 555
+L E ++ L VA++L++D+LQQ+++ D +CP K V M+R ++ FYD + A+
Sbjct: 481 PDALPERERAILLVARMLREDYLQQDAFDEVDTYCPPEKQVTMMRVLLNFYDKTMEAINR 540
Query: 556 TAQSENKITWSVIRDSMSNILYQLSSMKFKDPVKDGEAKTRADFDQLYEDIQQAFR 611
E +I +R+ ++ MKF+ V +K R+ D+ E ++ F+
Sbjct: 541 GVPLE-EIAKLPVRE-------EIGRMKFERDV----SKIRSLIDKTNEQFEELFK 584
|
| >3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C Length = 578 | Back alignment and structure |
|---|
| >2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Length = 469 | Back alignment and structure |
|---|
| >2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Length = 469 | Back alignment and structure |
|---|
| >3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Length = 464 | Back alignment and structure |
|---|
| >3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Length = 464 | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Length = 347 | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Length = 438 | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Length = 438 | Back alignment and structure |
|---|
| >1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Length = 473 | Back alignment and structure |
|---|
| >1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Length = 498 | Back alignment and structure |
|---|
| >1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Length = 498 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Length = 482 | Back alignment and structure |
|---|
| >1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* Length = 507 | Back alignment and structure |
|---|
| >2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B Length = 502 | Back alignment and structure |
|---|
| >2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} Length = 515 | Back alignment and structure |
|---|
| >2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... Length = 510 | Back alignment and structure |
|---|
| >3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A Length = 513 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 615 | |||
| 3vr4_A | 600 | V-type sodium ATPase catalytic subunit A; V-ATPase | 100.0 | |
| 3mfy_A | 588 | V-type ATP synthase alpha chain; A-type ATP syntha | 100.0 | |
| 3gqb_A | 578 | V-type ATP synthase alpha chain; A3B3, V-ATPase, A | 100.0 | |
| 3vr4_D | 465 | V-type sodium ATPase subunit D; V-ATPase, rotary m | 100.0 | |
| 3oaa_A | 513 | ATP synthase subunit alpha; rossmann fold, hydrola | 100.0 | |
| 2c61_A | 469 | A-type ATP synthase non-catalytic subunit B; hydro | 100.0 | |
| 2r9v_A | 515 | ATP synthase subunit alpha; TM1612, structural gen | 100.0 | |
| 3gqb_B | 464 | V-type ATP synthase beta chain; A3B3, V-ATPase, AT | 100.0 | |
| 2ck3_A | 510 | ATP synthase subunit alpha\, mitochondrial; hydrol | 100.0 | |
| 2qe7_A | 502 | ATP synthase subunit alpha; blockage of ATP hydrol | 100.0 | |
| 1fx0_A | 507 | ATP synthase alpha chain; latent ATPase, thermal s | 100.0 | |
| 2ck3_D | 482 | ATP synthase subunit beta\, mitochondrial; hydrola | 100.0 | |
| 1fx0_B | 498 | ATP synthase beta chain; latent ATPase, thermal st | 100.0 | |
| 1sky_E | 473 | F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp | 100.0 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 100.0 | |
| 3l0o_A | 427 | Transcription termination factor RHO; helicase, RH | 100.0 | |
| 3ice_A | 422 | Transcription termination factor RHO; transcriptio | 100.0 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 100.0 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 97.26 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 97.25 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 97.18 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 97.15 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 97.1 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 97.02 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 96.97 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 96.89 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 96.77 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 96.75 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 96.67 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 96.41 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 96.38 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 96.37 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 96.37 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 96.05 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 95.97 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 95.92 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 95.28 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 95.17 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 95.15 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 95.03 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 95.01 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 94.9 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 94.85 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 94.79 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 94.71 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 94.65 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 94.58 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 94.57 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 94.56 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 94.54 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 94.53 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 94.52 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 94.5 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 94.49 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 94.47 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 94.46 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 94.45 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 94.45 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 94.44 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 94.39 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 94.34 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 94.33 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 94.32 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 94.31 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 94.31 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 94.31 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 94.31 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 94.22 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 94.21 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 94.19 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 94.19 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 94.18 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 94.17 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 94.15 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 94.15 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 94.13 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 94.11 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 94.1 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 94.09 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 94.07 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 94.07 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 94.07 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 94.06 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 94.04 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 94.04 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 94.04 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 94.03 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 94.01 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 93.97 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 93.96 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 93.94 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 93.94 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 93.92 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 93.83 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 93.82 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 93.78 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 93.76 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 93.67 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 93.64 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 93.61 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 93.55 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 93.53 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 93.46 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 93.4 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 93.36 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 93.36 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 93.32 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 93.26 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 93.24 | |
| 1c9k_A | 180 | COBU, adenosylcobinamide kinase; alpha/beta struct | 93.19 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 93.09 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 93.05 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 92.93 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 92.91 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 92.84 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 92.81 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 92.79 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 92.77 | |
| 2vp4_A | 230 | Deoxynucleoside kinase; ATP-binding, DNA synthesis | 92.71 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 92.64 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 92.63 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 92.57 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 92.52 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 92.51 | |
| 3bs4_A | 260 | Uncharacterized protein PH0321; structural genomic | 92.46 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 92.43 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 92.39 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 92.34 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 92.31 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 92.3 | |
| 1t9h_A | 307 | YLOQ, probable GTPase ENGC; N-terminal beta-barrel | 92.25 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 92.24 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 92.16 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 92.15 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 92.12 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 92.08 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 92.05 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 92.04 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 91.88 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 91.87 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 91.87 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 91.84 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 91.81 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 91.79 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 91.72 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 91.69 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 91.66 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 91.59 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 91.58 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 91.56 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 91.5 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 91.48 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 91.44 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 91.4 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 91.39 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 91.37 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 91.35 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 91.35 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 91.33 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 91.26 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 91.22 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 91.21 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 91.16 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 91.15 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 91.13 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 91.12 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 91.1 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 91.04 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 91.03 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 91.02 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 91.01 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 90.99 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 90.89 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 90.83 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 90.8 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 90.71 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 90.7 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 90.69 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 90.69 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 90.61 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 90.56 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 90.54 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 90.53 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 90.48 | |
| 1q57_A | 503 | DNA primase/helicase; dntpase, DNA replication, tr | 90.46 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 90.42 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 90.33 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 90.32 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 90.29 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 90.18 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 90.18 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 90.15 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 90.1 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 90.1 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 90.05 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 90.03 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 90.0 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 89.97 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 89.95 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 89.91 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 89.82 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 89.78 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 89.76 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 89.72 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 89.71 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 89.64 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 89.63 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 89.6 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 89.53 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 89.52 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 89.51 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 89.51 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 89.38 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 89.36 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 89.35 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 89.34 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 89.25 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 89.21 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 89.08 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 89.07 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 89.06 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 89.02 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 88.97 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 88.9 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 88.79 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 88.74 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 88.71 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 88.68 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 88.67 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 88.62 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 88.61 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 88.53 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 88.49 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 88.42 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 88.32 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 88.31 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 88.28 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 88.22 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 88.22 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 88.19 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 88.17 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 88.15 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 88.15 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 88.13 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 88.1 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 88.02 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 87.96 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 87.82 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 87.79 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 87.76 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 87.75 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 87.74 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 87.73 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 87.59 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 87.58 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 87.47 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 87.47 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 87.45 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 87.43 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 87.38 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 87.35 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 87.33 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 87.11 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 87.03 | |
| 2gj8_A | 172 | MNME, tRNA modification GTPase TRME; G-domain dime | 87.02 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 86.97 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 86.87 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 86.85 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 86.83 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 86.66 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 86.59 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 86.52 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 86.51 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 86.39 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 86.18 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 86.14 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 86.13 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 85.99 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 85.87 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 85.83 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 85.8 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 85.8 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 85.78 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 85.71 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 85.65 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 85.59 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 85.57 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 85.49 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 85.39 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 85.38 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 85.37 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 85.37 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 85.34 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 85.34 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 85.3 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 85.2 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 85.19 | |
| 3euj_A | 483 | Chromosome partition protein MUKB, linker; MUKB, M | 84.99 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 84.96 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 84.91 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 84.89 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 84.87 | |
| 2wji_A | 165 | Ferrous iron transport protein B homolog; membrane | 84.85 | |
| 2zej_A | 184 | Dardarin, leucine-rich repeat kinase 2; parkinson' | 84.7 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 84.48 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 84.43 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 84.43 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 84.2 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 84.04 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 84.03 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 83.87 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 83.78 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 83.72 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 83.46 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 83.41 | |
| 2wjg_A | 188 | FEOB, ferrous iron transport protein B homolog; me | 83.31 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 83.05 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 83.05 | |
| 1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 82.94 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 82.86 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 82.78 | |
| 1a7j_A | 290 | Phosphoribulokinase; transferase, calvin cycle; 2. | 82.59 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 82.4 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 82.29 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 82.26 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 82.23 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 82.21 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 82.15 | |
| 2nzj_A | 175 | GTP-binding protein REM 1; GDP/GTP binding, GTP hy | 82.13 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 82.04 | |
| 3sr0_A | 206 | Adenylate kinase; phosphoryl transfer analogue, AL | 82.02 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 81.93 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 81.77 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 81.76 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 81.63 | |
| 3q85_A | 169 | GTP-binding protein REM 2; G-domain, CAV2 beta, si | 81.49 | |
| 2erx_A | 172 | GTP-binding protein DI-RAS2; GTP hydrolysis, trans | 81.46 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 81.43 | |
| 1ni3_A | 392 | YCHF GTPase, YCHF GTP-binding protein; structural | 81.38 | |
| 1z08_A | 170 | RAS-related protein RAB-21; RAB GTPase, vesicular | 81.34 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 81.28 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 81.12 | |
| 1ek0_A | 170 | Protein (GTP-binding protein YPT51); vesicular tra | 81.11 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 81.06 | |
| 3gmt_A | 230 | Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle | 80.92 | |
| 1c1y_A | 167 | RAS-related protein RAP-1A; GTP-binding proteins, | 80.92 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 80.88 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 80.82 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 80.73 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 80.67 | |
| 1ega_A | 301 | Protein (GTP-binding protein ERA); GTPase, RNA-bin | 80.65 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 80.64 | |
| 1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 80.6 | |
| 3gee_A | 476 | MNME, tRNA modification GTPase MNME; G protein, cy | 80.5 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 80.47 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 80.43 | |
| 3bc1_A | 195 | RAS-related protein RAB-27A; RAB27, GTPase, RAB, s | 80.4 | |
| 3q72_A | 166 | GTP-binding protein RAD; G-domain, CAV2 beta, sign | 80.4 | |
| 1wms_A | 177 | RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p | 80.29 | |
| 1g16_A | 170 | RAS-related protein SEC4; G protein RAB, signaling | 80.21 | |
| 1r2q_A | 170 | RAS-related protein RAB-5A; GTPase, GNP, atomic re | 80.17 | |
| 2h92_A | 219 | Cytidylate kinase; rossmann fold, transferase; HET | 80.12 | |
| 1r8s_A | 164 | ADP-ribosylation factor 1; protein transport/excha | 80.02 |
| >3vr4_A V-type sodium ATPase catalytic subunit A; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_A* 3vr2_A* 3vr5_A 3vr6_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=2.6e-157 Score=1297.34 Aligned_cols=582 Identities=49% Similarity=0.870 Sum_probs=559.5
Q ss_pred eeEEEEEECceEEEEeCCCCcceeEEEEcCceeEEEEEEEeCCeEEEEEecCCCCCCCCCeEEEcCCcceeecCcccccc
Q psy13480 17 FGFVYAVSGPVVTAEKMSGSAMYELVRVGYFELVGEIIRLEGDMATIQVYEETSGVTVGDPVLRTGKPLSVELGPGILGS 96 (615)
Q Consensus 17 ~G~I~~I~Gpvv~a~g~~~~~~~E~v~vg~~~l~GEVI~i~~d~a~iqvye~t~Gl~~G~~V~~tg~~lsv~lGpgLLGr 96 (615)
.|+|.+|+||+|+++|+.+++|||+|+|+++++.||||++++|.+++||||+|+||++|++|++||+|++|+||||||||
T Consensus 10 ~G~V~~V~G~vv~v~g~~~~~~gE~v~v~~~~l~gEVi~~~~d~a~i~v~e~t~Gl~~G~~V~~tG~~lsV~vG~~lLGr 89 (600)
T 3vr4_A 10 IGKIIKVSGPLVMAENMSEASIQDMCLVGDLGVIGEIIEMRQDVASIQVYEETSGIGPGEPVRSTGEALSVELGPGIISQ 89 (600)
T ss_dssp CEEEEEEETTEEEEESCTTSCTTCEEEETTTTEEEEEEEEETTEEEEEESSCCTTCCTTCEEEECSSSSEEEESTTCTTC
T ss_pred ceEEEEEECcEEEEEcCCCCccCCEEEECCCcEEEEEEEEcCCcEEEEEccCCCCCCCCCEEEECCCCCEEEeCHHHHhh
Confidence 59999999999999999899999999998778999999999999999999999999999999999999999999999999
Q ss_pred cccccccccCCCccccccccccCCCCCCCCCccccccccccccccccccccCcceeeeeccceeeeeecCCCCCCcceeE
Q psy13480 97 IFDGIQRPLKDINELSQSIYIPKGVNIPALNRDVSWEFNPMNLKIGSHITGGDQYGLVHENTLVKHKMIMPPKAKGTVTY 176 (615)
Q Consensus 97 I~DgigrPLd~~~~~~~~~~i~~G~~~~~ld~~~~w~f~p~~~~~g~~v~~g~~~g~v~e~~~~~h~i~~pp~~~g~v~~ 176 (615)
||||+|||||++.+..++.|+++|+.++|++++++|+|+| .+|+||.|++||++|+|+|+.+++|+||+||+++|+|+|
T Consensus 90 V~DglGrPlD~~~~~~g~~~~~~g~~~~~l~~~~~w~f~p-~~~~Gd~v~~g~i~g~v~e~~~i~h~im~pp~~~g~v~~ 168 (600)
T 3vr4_A 90 MFDGIQRPLDTFMEVTQSNFLGRGVQLPALDHEKQWWFEA-TIEEGTEVSAGDIIGYVDETKIIQHKIMVPNGIKGTVQK 168 (600)
T ss_dssp EECTTCCBHHHHHHHHCSSBCCTTCCCCSSCSSCCEEEEE-CSCTTCEECTTCEEEEEECSSSCEEEEECCTTCCEEEEE
T ss_pred hhCcCCCcccccccccCccccccCCcCCCCCcccccccCc-ccccCCEecCCceEEEEecCCceeeeeecCCCCCceEEE
Confidence 9999999999998777768999999999999999999999 799999999999999999999999999999999999999
Q ss_pred ecCCCCccccceEEEEeecCcceeeeeecccccCCCCCcccCCCCCCccccceeeeccccccccCceeeccCCCCCCcch
Q psy13480 177 IAPAGNYKVDEVVLETEFDGEKSKYTMVQVWPVRQPRPVTEKLPANYPLLTGQRVLDSLFPCVLGGTTAIPGAFGCGKTV 256 (615)
Q Consensus 177 ~~~~g~~~~~~~~~~~~~~~~~~~~~~~q~wPvr~~rp~~~r~~~~~pl~TG~rviD~l~Pi~kGq~~~I~g~~G~GKt~ 256 (615)
| ++|+|+++|+|+++++.++.++++|+|+||+|.|+|+.+|+++++||.||||+||+|+||+||||++||||+|+|||+
T Consensus 169 i-~~g~~~v~~~v~~i~~~~g~~~i~~~~~wpv~~~~p~~~R~~~~epl~TGirvID~l~PigrGqr~~Ifgg~g~GKT~ 247 (600)
T 3vr4_A 169 I-ESGSFTIDDPICVIETEQGLKELTMMQKWPVRRGRPIKQKLNPDVPMITGQRVIDTFFPVTKGGAAAVPGPFGAGKTV 247 (600)
T ss_dssp E-CCEEECTTSCCEEEEETTEEEEECSCEEEETTSCCCCSEEECCCSBCCCCCHHHHHHSCCBTTCEEEEECCTTSCHHH
T ss_pred e-cCCcceeceeEEEEeccCCcccccccccccccCCCchhhccCCCceecccchhhhccCCccCCCEEeeecCCCccHHH
Confidence 9 899999999999999743338999999999999999999999999999999999999999999999999999999999
Q ss_pred hhHHhhhcCCCCEEEEEeecCcchHHHHHHHhcccccccccCccccCcceEEEEEeCCCCCHHHHHHHHHHHhhHHHHHH
Q psy13480 257 ISQALSKYSNSDVIVYVGCGERGNEMAEVLRDFPELTIEVDGVTESIMKRTTLVANTSNMPVAAREASIYTGITLSEYFR 336 (615)
Q Consensus 257 l~~~la~~~~adviV~~~iGERg~Ev~e~~~~f~~l~~~~~g~~~~~m~rtvlvanTsn~p~~~R~~s~~tg~tiAEyfr 336 (615)
|+++|++|+++|+|||++||||+|||+||+++|++|+||.+| .++|+||+||+|||||||++|++++|+|+|+|||||
T Consensus 248 L~~~ia~~~~~~v~V~~~iGER~~Ev~e~~~~~~el~d~~~G--~~~m~rtvvV~~tsd~p~~~R~~~~~~altiAEyfr 325 (600)
T 3vr4_A 248 VQHQIAKWSDVDLVVYVGCGERGNEMTDVVNEFPELIDPNTG--ESLMERTVLIANTSNMPVAAREASIYTGITIAEYFR 325 (600)
T ss_dssp HHHHHHHHSSCSEEEEEEEEECHHHHHHHHHHTTTCBCTTTC--SBGGGGEEEEEEETTSCHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHhccCCCEEEEEEecccHHHHHHHHHHHHhhcccccc--cccccceEEEEECCCCCHHHHHHHHHHHHHHHHHHH
Confidence 999999999999999999999999999999999999999998 689999999999999999999999999999999999
Q ss_pred hCCCcEEEEeeCchHHHHHHHHHHhhcCCCCCCCCCCCchhhhHHHHHHhhccccccCCCCCCCceEEEEeecCCCCCCC
Q psy13480 337 DMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNPDREGSVSIVGAVSPPGGDFS 416 (615)
Q Consensus 337 d~G~~Vll~~Ds~tR~AeAlREIs~~lgE~P~~eGYP~~l~s~La~~~ERAG~~~~~~~~~~~GSIT~i~~Vs~~ggD~s 416 (615)
|+|+|||||+||+||||+|+||||+++||||+++|||+||+++|++||||||+++|+++++++||||+|++|++|||||+
T Consensus 326 d~G~dVLl~~Ds~tR~A~A~rEiS~~lge~P~~~GYp~~l~s~L~~l~ERAg~~~~~~~~~~~GSIT~i~~v~~~gdD~t 405 (600)
T 3vr4_A 326 DMGYDVAIMADSTSRWAEALREMSGRLEEMPGDEGYPAYLGSRLAEYYERSGRVIALGSDQREGSITAISAVSPSGGDIS 405 (600)
T ss_dssp TTTCEEEEEEECHHHHHHHHHHHHHHTTCCBCGGGCBTTHHHHHHHHHTTSEEEECSSTTCCEEEEEEEEEECCSSSCTT
T ss_pred HcCCCEEEEecchHHHHHHHHHHHhccCCCCccccCCchhhhHHHHHHHhhccccccCCCCCCcceEEEEEEECCCCCCC
Confidence 99999999999999999999999999999999999999999999999999999998887778999999999999999999
Q ss_pred CchhhhhhcccceEEEecHHHHhCCCCCCCccCccccchhcchhhhhhcc-CcchHHHHHHHHHHHHhHHHHHHHHHHhc
Q psy13480 417 DPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISYSKYMRALDDFYDKN-HPEFVPLRTKVKEILQEEEDLSEIVQLVG 495 (615)
Q Consensus 417 ~PV~~~t~~i~dg~i~Ldr~La~~g~yPAId~l~S~Sr~~~~~~~~~~~~-~~~~~~~~~~~~~~L~~~~el~~i~~~~g 495 (615)
|||+++|++|+||||+|||+||++||||||||+.|+||+++.+.+||.+. .++|.+++++++++|++|+|+++|++++|
T Consensus 406 dPi~~~t~~i~dg~ivLsr~La~~giyPAId~l~S~SR~~~~l~~~~~~~~~~~h~~~a~~~~~~la~~~el~~ii~i~G 485 (600)
T 3vr4_A 406 EPVTQNTLRVVKVFWGLDSSLAQKRHFPSINWIQSYSLYSTEVGRYMDQILQQDWSDMVTEGMRILQEEEQLNEIVRLVG 485 (600)
T ss_dssp SHHHHHHHTTCCEECCBCHHHHTTTCSSCBCTTTCEETTHHHHHHHHHHHHTSCHHHHHHHHHHHHHHHHHHHHHHHHTC
T ss_pred CcchhhhhhhccEEEEEhhhHHhCCCCCccCcccchhhhcccccccccccCCHHHHHHHHHHHHHHHHHHHHHHHHhccC
Confidence 99999999999999999999999999999999999999999999999886 79999999999999999999999999999
Q ss_pred CCCCcHHhHHHHHHHHHHHHHccCCCCCCCCCccCCHHHHHHHHHHHHHHHHHHHHHHHccccchhhhhHHHHHhhhhHH
Q psy13480 496 KASLAESDKITLEVAKLLKDDFLQQNSYSPYDRFCPFYKTVGMLRNMIAFYDMSRHAVESTAQSENKITWSVIRDSMSNI 575 (615)
Q Consensus 496 ~~~l~~~d~~il~~~~~i~~~fL~Q~~~~~~d~~~~~~kq~~~L~~I~~fyd~a~~ai~~g~~~~~~i~~~~i~~~~~~~ 575 (615)
.++|+++|++++++|+++++.||+|++|+++|.|||++||+.||+.|+.||+.|++++++|+++ +.|++.+.++
T Consensus 486 ~d~Ls~~dk~~l~~a~~i~e~fL~Q~~f~~~d~~~~~~kq~~~l~~i~~~~~~~~~~~~~~~~~------~~i~~~~~~~ 559 (600)
T 3vr4_A 486 IDSLSDNDRLTLEVAKSIREDYLQQNAFDDVDTFTSREKQFNMLKVILTFGKEARKALSLGAYF------NEIMEGTVAV 559 (600)
T ss_dssp GGGSCHHHHHHHHHHHHHHHHTTCCCTTSTTTTCCCHHHHHHHHHHHHHHHHHHHHHHTTTCCH------HHHHHHCHHH
T ss_pred CccCCHHHHHHHHHHHHHHHHhCCCCCcCCccccCCHHHHHHHHHHHHHHHHHHHHHHHcCCCH------HHHHHHhHHH
Confidence 9999999999999999999899999999999999999999999999999999999999999887 5777765689
Q ss_pred HHHHhcCCCCCCCCchhHHHHHHHHHHHHHHHHHHHhhc
Q psy13480 576 LYQLSSMKFKDPVKDGEAKTRADFDQLYEDIQQAFRNLE 614 (615)
Q Consensus 576 ~~~i~~~k~~~~~~~~e~~~~~~~~~l~~~i~~~f~~l~ 614 (615)
+++|.+|||. + + ++ .+.|+++.++|++.|++|.
T Consensus 560 ~~~~~~~k~~-~--~--~~-~~~~~~~~~~~~~~~~~~~ 592 (600)
T 3vr4_A 560 RERISRSKYI-P--E--EE-LAKISSINEEIKETIQLIV 592 (600)
T ss_dssp HHHHHTGGGS-C--G--GG-THHHHTHHHHHHHHHHHHH
T ss_pred HHHHHHhcCC-C--c--ch-HHHHHHHHHHHHHHHHHHH
Confidence 9999999996 2 2 22 3778999999999999874
|
| >3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A | Back alignment and structure |
|---|
| >3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C | Back alignment and structure |
|---|
| >3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* | Back alignment and structure |
|---|
| >3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A | Back alignment and structure |
|---|
| >2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* | Back alignment and structure |
|---|
| >2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* | Back alignment and structure |
|---|
| >2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... | Back alignment and structure |
|---|
| >2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B | Back alignment and structure |
|---|
| >1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* | Back alignment and structure |
|---|
| >2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... | Back alignment and structure |
|---|
| >1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* | Back alignment and structure |
|---|
| >1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >3bs4_A Uncharacterized protein PH0321; structural genomics, unknown function, PSI-2, protein struct initiative; 1.60A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* | Back alignment and structure |
|---|
| >2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* | Back alignment and structure |
|---|
| >1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* | Back alignment and structure |
|---|
| >2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} | Back alignment and structure |
|---|
| >1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* | Back alignment and structure |
|---|
| >1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* | Back alignment and structure |
|---|
| >3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* | Back alignment and structure |
|---|
| >3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* | Back alignment and structure |
|---|
| >1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* | Back alignment and structure |
|---|
| >1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A | Back alignment and structure |
|---|
| >1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* | Back alignment and structure |
|---|
| >2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 615 | ||||
| d2jdid3 | 276 | c.37.1.11 (D:82-357) Central domain of beta subuni | 1e-79 | |
| d2jdia3 | 285 | c.37.1.11 (A:95-379) Central domain of alpha subun | 6e-78 | |
| d1fx0a3 | 276 | c.37.1.11 (A:97-372) Central domain of alpha subun | 1e-65 | |
| d1xpua3 | 289 | c.37.1.11 (A:129-417) Transcription termination fa | 9e-51 | |
| d1fx0b1 | 108 | a.69.1.1 (B:378-485) F1 ATP synthase beta subunit, | 3e-06 | |
| d1skye1 | 114 | a.69.1.1 (E:357-470) F1 ATP synthase beta subunit, | 7e-05 |
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 276 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: RecA protein-like (ATPase-domain) domain: Central domain of beta subunit of F1 ATP synthase species: Rat (Rattus norvegicus) [TaxId: 10116]
Score = 251 bits (642), Expect = 1e-79
Identities = 70/263 (26%), Positives = 115/263 (43%), Gaps = 15/263 (5%)
Query: 197 EKSKYTMVQVWPVRQPRP-VTEKLPANYPLLTGQRVLDSLFPCVLGGTTAIPGAFGCGKT 255
E+ Q + P E L+TG +V+D L P GG + G G GKT
Sbjct: 23 ERGPIKTKQFAAIHAEAPEFVEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKT 82
Query: 256 VISQAL---SKYSNSDVIVYVGCGERGNEMAEVLRDFPELTIEVDGVTESIMKRTTLVAN 312
V+ L ++ V+ G GER E ++ + E + + + LV
Sbjct: 83 VLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVIN---LKDATSKVALVYG 139
Query: 313 TSNMPVAAREASIYTGITLSEYFRDM-GYNVSMMADSTSRWAEALREISGRLAEMPADSG 371
N P AR TG+T++EYFRD G +V + D+ R+ +A E+S L +P+ G
Sbjct: 140 QMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVG 199
Query: 372 YPAYLGARLASFYERAGRVKCLGNPDREGSVSIVGAVSPPGGDFSDPVTSATLGIVQVFW 431
Y L + + ER ++GS++ V A+ P D +DP + T +
Sbjct: 200 YQPTLATDMGTMQERITTT-------KKGSITSVQAIYVPADDLTDPAPATTFAHLDATT 252
Query: 432 GLDKKLAQRKHFPSINWLISYSK 454
L + +A+ +P+++ L S S+
Sbjct: 253 VLSRAIAELGIYPAVDPLDSTSR 275
|
| >d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Length = 285 | Back information, alignment and structure |
|---|
| >d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Length = 276 | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Length = 289 | Back information, alignment and structure |
|---|
| >d1fx0b1 a.69.1.1 (B:378-485) F1 ATP synthase beta subunit, domain 3 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Length = 108 | Back information, alignment and structure |
|---|
| >d1skye1 a.69.1.1 (E:357-470) F1 ATP synthase beta subunit, domain 3 {Bacillus sp., strain ps3 [TaxId: 1409]} Length = 114 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 615 | |||
| d2jdia3 | 285 | Central domain of alpha subunit of F1 ATP synthase | 100.0 | |
| d2jdid3 | 276 | Central domain of beta subunit of F1 ATP synthase | 100.0 | |
| d1fx0a3 | 276 | Central domain of alpha subunit of F1 ATP synthase | 100.0 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 100.0 | |
| d1skye1 | 114 | F1 ATP synthase beta subunit, domain 3 {Bacillus s | 99.24 | |
| d1fx0b1 | 108 | F1 ATP synthase beta subunit, domain 3 {Spinach (S | 99.21 | |
| d2jdid1 | 118 | F1 ATP synthase beta subunit, domain 3 {Rat (Rattu | 99.17 | |
| d1skyb2 | 75 | F1 ATP synthase alpha subunit, domain 1 {Bacillus | 98.62 | |
| d2jdia2 | 71 | F1 ATP synthase alpha subunit, domain 1 {Cow (Bos | 98.57 | |
| d2jdia1 | 131 | F1 ATP synthase alpha subunit, domain 3 {Cow (Bos | 98.54 | |
| d1fx0a1 | 129 | F1 ATP synthase alpha subunit, domain 3 {Spinach ( | 98.51 | |
| d1fx0a2 | 72 | F1 ATP synthase alpha subunit, domain 1 {Spinach ( | 98.46 | |
| d1skyb1 | 131 | F1 ATP synthase alpha subunit, domain 3 {Bacillus | 98.35 | |
| d2jdid2 | 72 | F1 ATP synthase beta subunit, domain 1 {Rat (Rattu | 98.14 | |
| d1fx0b2 | 79 | F1 ATP synthase beta subunit, domain 1 {Spinach (S | 98.05 | |
| d1skye2 | 82 | F1 ATP synthase beta subunit, domain 1 {Bacillus s | 98.0 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 97.08 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 96.86 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 96.85 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 96.69 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 96.6 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 96.59 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 96.26 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 95.91 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 95.52 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 95.43 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 95.42 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 95.37 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 95.26 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 95.26 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 95.24 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 95.19 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 94.96 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 94.91 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 94.91 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 94.89 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 94.73 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 94.71 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 94.66 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 94.6 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 94.56 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 94.54 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 94.54 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 94.48 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 94.42 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 94.39 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 94.31 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 94.31 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 94.27 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 94.16 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 94.11 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 94.08 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 94.05 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 93.9 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 93.86 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 93.84 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 93.76 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 93.67 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 93.63 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 93.57 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 93.44 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 93.32 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 93.29 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 93.28 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 93.24 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 93.14 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 92.96 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 92.92 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 92.74 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 92.59 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 92.4 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 92.39 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 92.35 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 92.34 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 92.31 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 92.3 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 92.07 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 91.93 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 91.81 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 91.81 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 91.72 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 91.29 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 91.26 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 91.1 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 91.08 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 90.91 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 90.87 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 90.83 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 90.78 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 90.68 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 90.43 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 90.37 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 90.35 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 90.34 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 90.2 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 90.14 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 90.02 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 90.0 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 89.81 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 89.73 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 89.65 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 89.12 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 88.94 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 88.75 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 88.57 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 88.36 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 88.26 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 87.99 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 87.85 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 87.32 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 87.28 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 87.13 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 86.6 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 86.57 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 86.49 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 86.26 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 86.17 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 86.14 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 86.08 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 85.73 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 85.61 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 85.05 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 84.9 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 84.87 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 84.73 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 84.69 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 84.46 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 83.98 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 83.9 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 83.78 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 83.76 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 83.74 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 83.73 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 83.72 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 83.67 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 83.63 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 83.54 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 83.44 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 83.22 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 83.13 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 83.1 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 83.04 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 82.95 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 82.93 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 82.74 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 82.74 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 82.67 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 82.52 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 82.5 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 82.48 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 82.44 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 82.42 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 82.4 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 82.38 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 82.22 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 81.98 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 81.87 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 81.87 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 81.83 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 81.68 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 81.55 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 81.47 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 81.43 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 81.4 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 81.18 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 81.04 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 80.97 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 80.96 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 80.92 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 80.9 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 80.79 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 80.76 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 80.6 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 80.53 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 80.51 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 80.37 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 80.27 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 80.22 |
| >d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: RecA protein-like (ATPase-domain) domain: Central domain of alpha subunit of F1 ATP synthase species: Cow (Bos taurus) [TaxId: 9913]
Probab=100.00 E-value=6.8e-84 Score=663.66 Aligned_cols=243 Identities=25% Similarity=0.324 Sum_probs=225.5
Q ss_pred ccccCCCCC-cccCCCCCCccccceeeeccccccccCceeeccCCCCCCcchhhHHhhhcC----------CCCEEEEEe
Q psy13480 206 VWPVRQPRP-VTEKLPANYPLLTGQRVLDSLFPCVLGGTTAIPGAFGCGKTVISQALSKYS----------NSDVIVYVG 274 (615)
Q Consensus 206 ~wPvr~~rp-~~~r~~~~~pl~TG~rviD~l~Pi~kGq~~~I~g~~G~GKt~l~~~la~~~----------~adviV~~~ 274 (615)
+||++.+.| +.+|.++++||.||+|+||+|+||++|||++|||++|+|||+|+++++++. +..+|||++
T Consensus 32 ~~~i~~~~p~~~~R~~i~e~l~TGIraID~l~pig~GQr~~If~~~g~GKt~ll~~~~~~~~~~~~~~~~~~~~~~v~~~ 111 (285)
T d2jdia3 32 RRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIYVA 111 (285)
T ss_dssp EEESSCCCCCSTTBCCCCSBCCCSCHHHHHHSCCBTTCBCEEEESTTSSHHHHHHHHHHHTHHHHTSSCTTTCCEEEEEE
T ss_pred cccccCCCcCchhccCCCcccccCceEEecccCccCCCEEEeecCCCCChHHHHHHHHHhHHhhccccccccceEEEEee
Confidence 456655444 778899999999999999999999999999999999999999999886541 233799999
Q ss_pred ecCcchHHHHHHHhcccccccccCccccCcceEEEEEeCCCCCHHHHHHHHHHHhhHHHHHHhCCCcEEEEeeCchHHHH
Q psy13480 275 CGERGNEMAEVLRDFPELTIEVDGVTESIMKRTTLVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAE 354 (615)
Q Consensus 275 iGERg~Ev~e~~~~f~~l~~~~~g~~~~~m~rtvlvanTsn~p~~~R~~s~~tg~tiAEyfrd~G~~Vll~~Ds~tR~Ae 354 (615)
||||++|+.||++++.+ .++|+|||+|+||||+|+.+|+.++|+|+|+||||||+|+||||++||+||||+
T Consensus 112 IGer~~E~~e~~~~~~~---------~~~~~~tvvv~~ts~~~~~~r~~~~~~a~tiAEyfrd~G~~VLll~Dsltr~A~ 182 (285)
T d2jdia3 112 IGQKRSTVAQLVKRLTD---------ADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAV 182 (285)
T ss_dssp ESCCHHHHHHHHHHHHH---------TTCGGGEEEEEECTTSCHHHHHHHHHHHHHHHHHHHHTTCEEEEEEETHHHHHH
T ss_pred eCccHHHHHHHHHHhcc---------cccccceEEEEECCCCCHHHHHHHHHHHHHHHHHHHHcCCcEEEEEcChHHHHH
Confidence 99999999999999853 678999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHhhcCCCCCCCCCCCchhhhHHHHHHhhccccccCCCCCCCceEEEEeecCCCCCCCCchhhhhhcccceEEEec
Q psy13480 355 ALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNPDREGSVSIVGAVSPPGGDFSDPVTSATLGIVQVFWGLD 434 (615)
Q Consensus 355 AlREIs~~lgE~P~~eGYP~~l~s~La~~~ERAG~~~~~~~~~~~GSIT~i~~Vs~~ggD~s~PV~~~t~~i~dg~i~Ld 434 (615)
|+||||+++||+|+++|||+|+|+.|++||||||+++. ..++||||+|++|++|+||++|||+|++++|+||||+||
T Consensus 183 A~rEis~~~ge~p~~~gyp~~~~~~~~~l~ERag~~~~---~~~~GSiT~i~~v~~~~dD~tdpI~~~~~~i~dg~ivLs 259 (285)
T d2jdia3 183 AYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMND---AFGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLE 259 (285)
T ss_dssp HHHHHHHHTTCCCCGGGCCTTHHHHHHHHHTTCCBBCG---GGTCCEEEEEEEEECSTTCTTSHHHHHHHHHSSEEEEBC
T ss_pred HHHHHHHhcCCCCCcCCcCchHHHHHHHHHHHHhcccC---CCCCeeEEEEEEEEecCCCCCCchhHHHHhhcCcEEEEc
Confidence 99999999999999999999999999999999999752 235899999999999999999999999999999999999
Q ss_pred HHHHhCCCCCCCccCccccchhcchh
Q psy13480 435 KKLAQRKHFPSINWLISYSKYMRALD 460 (615)
Q Consensus 435 r~La~~g~yPAId~l~S~Sr~~~~~~ 460 (615)
|+||++||||||||+.|+||+|+.++
T Consensus 260 r~la~~g~yPAID~l~S~SR~~~~~q 285 (285)
T d2jdia3 260 TELFYKGIRPAINVGLSVSRVGSAAQ 285 (285)
T ss_dssp HHHHHHTCSSCBCTTTCEESSGGGGS
T ss_pred HHHHhcCCCCCcCCcccccccCcccC
Confidence 99999999999999999999998763
|
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1skye1 a.69.1.1 (E:357-470) F1 ATP synthase beta subunit, domain 3 {Bacillus sp., strain ps3 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1fx0b1 a.69.1.1 (B:378-485) F1 ATP synthase beta subunit, domain 3 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d2jdid1 a.69.1.1 (D:358-475) F1 ATP synthase beta subunit, domain 3 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1skyb2 b.49.1.1 (B:21-95) F1 ATP synthase alpha subunit, domain 1 {Bacillus sp., strain ps3 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d2jdia2 b.49.1.1 (A:24-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2jdia1 a.69.1.1 (A:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1fx0a1 a.69.1.1 (A:373-501) F1 ATP synthase alpha subunit, domain 3 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1fx0a2 b.49.1.1 (A:25-96) F1 ATP synthase alpha subunit, domain 1 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1skyb1 a.69.1.1 (B:372-502) F1 ATP synthase alpha subunit, domain 3 {Bacillus sp., strain ps3 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d2jdid2 b.49.1.1 (D:10-81) F1 ATP synthase beta subunit, domain 1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fx0b2 b.49.1.1 (B:19-97) F1 ATP synthase beta subunit, domain 1 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1skye2 b.49.1.1 (E:1-82) F1 ATP synthase beta subunit, domain 1 {Bacillus sp., strain ps3 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|