Psyllid ID: psy13543


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180----
MCPKYILDARAVDYVWWKHLMYGGGGGGGGDAPEKHKLIIVGAGAIAENRQKNGRNLSKSGQNTAKRSNHLNQTFCVASLSHLRTGEAQADNHGPKVTIPEPTRCLHSSWGTNPHFRGSYSCRSLTTERLNTSAADLGAPVSNGQGKPVLLFAGEATSEHQYSTVNGAVETGWREADRILTLKD
cccccccccccccEEEEcccccccccccccccccccEEEEEccccEEHHcccccccEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEccccccccccccccccccccccccccHHHHcccccccccccEEEEEcccccccccccHHHHHHHHHHHHHHHHHccc
ccccEEEEHHHHHHHHHHHHHcccccccccccccccEEEEEcHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHcccccccccccccHEEEEcccccccccccEEEEEEccccccccHHHccccccccccccEEEEEcccccccccccHHHHHHcHHHHHHHHHHHcc
MCPKYILDARAVDYVWWKHlmyggggggggdapekHKLIIVGAGAIaenrqkngrnlsksgqntakrsnhLNQTFCVASLshlrtgeaqadnhgpkvtipeptrclhsswgtnphfrgsyscrsltterlntsaadlgapvsngqgkpvllfageatsehqysTVNGAVETGWREADRILTLKD
MCPKYILDARAVDYVWWKHLMYGGGGGGGGDAPEKHKLIIVGAGaiaenrqkngrnLSKSgqntakrsnhLNQTFCVASLSHLRTGeaqadnhgpkvtipEPTRCLHSSWGTNPHFRGSYSCRSLTTERLNTSAAdlgapvsngqGKPVLLFAGEATSEhqystvngavetgwreadriltlkd
MCPKYILDARAVDYVWWKHLMYggggggggDAPEKHKLIIVGAGAIAENRQKNGRNLSKSGQNTAKRSNHLNQTFCVASLSHLRTGEAQADNHGPKVTIPEPTRCLHSSWGTNPHFRGSYSCRSLTTERLNTSAADLGAPVSNGQGKPVLLFAGEATSEHQYSTVNGAVETGWREADRILTLKD
*************************************LIIVGAG*****************************TFCVASLS**********************RCLHSSWGTNPHFRGSYSCRSL**********************PVLLFAGEAT**HQYSTVNGAVETGWREA********
**PKYILDARAVDYVWWKHLMY************KHKLIIVGAGAIAENRQKNGRNLSKSGQNTAKRSNHLNQTFCVASLSHLRTGEAQADNHGPKVTIPEPTRCLHSSWGTNPHFRGSYSCRSLTTERLNTSAADLGAPVSNGQGKPVLLFAGEATSEHQYSTVNGAVETGWREADRILTLKD
MCPKYILDARAVDYVWWKHLMYGGGGGGGGDAPEKHKLIIVGAGAIAENRQKNGRNLSKSGQNTAKRSNHLNQTFCVASLSHLRTGEAQADNHGPKVTIPEPTRCLHSSWGTNPHFRGSYSCRSLTTERLNTSAADLGAPVSNGQGKPVLLFAGEATSEHQYSTVNGAVETGWREADRILTLKD
MCPKYILDARAVDYVWWKHLMYGGGGGGGGDAPEKHKLIIVGAGAIAENRQKN*****KSGQNTAKRSNHLNQTFCVASLSHLRTGEAQADNHGPKVTIPEPTRCLHSSWGTNPHFRGSYSCRSLTTERLNTSAADLGAPVSNGQGKPVLLFAGEATSEHQYSTVNGAVETGWREADRILTLKD
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCPKYILDARAVDYVWWKHLMYGGGGGGGGDAPEKHKLIIVGAGAIAENRQKNGRNLSKSGQNTAKRSNHLNQTFCVASLSHLRTGEAQADNHGPKVTIPEPTRCLHSSWGTNPHFRGSYSCRSLTTERLNTSAADLGAPVSNGQGKPVLLFAGEATSEHQYSTVNGAVETGWREADRILTLKD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query184 2.2.26 [Sep-21-2011]
Q9NWM0555 Spermine oxidase OS=Homo no N/A 0.429 0.142 0.417 6e-10
Q99K82555 Spermine oxidase OS=Mus m no N/A 0.429 0.142 0.417 7e-10
Q865R1512 Peroxisomal N(1)-acetyl-s no N/A 0.456 0.164 0.431 9e-10
Q6QHF9649 Peroxisomal N(1)-acetyl-s no N/A 0.445 0.126 0.441 3e-09
Q8C0L6504 Peroxisomal N(1)-acetyl-s no N/A 0.451 0.164 0.404 2e-07
Q9LID0 746 Lysine-specific histone d no N/A 0.423 0.104 0.391 3e-07
Q9SU79533 Probable polyamine oxidas no N/A 0.505 0.174 0.336 5e-07
Q6YYZ1 763 Lysine-specific histone d no N/A 0.440 0.106 0.370 2e-06
P18487504 Protein anon-37Cs OS=Dros no N/A 0.407 0.148 0.388 1e-05
P31225489 Corticosteroid-binding pr N/A N/A 0.418 0.157 0.367 2e-05
>sp|Q9NWM0|SMOX_HUMAN Spermine oxidase OS=Homo sapiens GN=SMOX PE=1 SV=1 Back     alignment and function desciption
 Score = 63.9 bits (154), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 38/91 (41%), Positives = 57/91 (62%), Gaps = 12/91 (13%)

Query: 99  IPEPTRCLHSSWGTNPHFRGSYSCRSLTTERLNTSAAD---LGAPV---SNGQGKPV-LL 151
           IP+P R L S+WG+NP+FRGSYS       ++ +S AD   L  P+    + +  P+ +L
Sbjct: 461 IPKPRRILRSAWGSNPYFRGSYS-----YTQVGSSGADVEKLAKPLPYTESSKTAPMQVL 515

Query: 152 FAGEATSEHQYSTVNGAVETGWREADRILTL 182
           F+GEAT    YST +GA+ +G REA R++ +
Sbjct: 516 FSGEATHRKYYSTTHGALLSGQREAARLIEM 546




Flavoenzyme which catalyzes the oxidation of spermine to spermidine. Can also use N(1)-acetylspermine and spermidine as substrates, with different affinity depending on the isoform (isozyme) and on the experimental conditions. Plays an important role in the regulation of polyamine intracellular concentration and has the potential to act as a determinant of cellular sensitivity to the antitumor polyamine analogs. May contribute to beta-alanine production via aldehyde dehydrogenase conversion of 3-amino-propanal.
Homo sapiens (taxid: 9606)
EC: 1EC: .EC: 5EC: .EC: 3EC: .EC: 1EC: 6
>sp|Q99K82|SMOX_MOUSE Spermine oxidase OS=Mus musculus GN=Smox PE=1 SV=1 Back     alignment and function description
>sp|Q865R1|PAOX_BOVIN Peroxisomal N(1)-acetyl-spermine/spermidine oxidase OS=Bos taurus GN=PAOX PE=1 SV=3 Back     alignment and function description
>sp|Q6QHF9|PAOX_HUMAN Peroxisomal N(1)-acetyl-spermine/spermidine oxidase OS=Homo sapiens GN=PAOX PE=1 SV=3 Back     alignment and function description
>sp|Q8C0L6|PAOX_MOUSE Peroxisomal N(1)-acetyl-spermine/spermidine oxidase OS=Mus musculus GN=Paox PE=1 SV=3 Back     alignment and function description
>sp|Q9LID0|LDL2_ARATH Lysine-specific histone demethylase 1 homolog 2 OS=Arabidopsis thaliana GN=LDL2 PE=2 SV=1 Back     alignment and function description
>sp|Q9SU79|PAO5_ARATH Probable polyamine oxidase 5 OS=Arabidopsis thaliana GN=PAO5 PE=2 SV=1 Back     alignment and function description
>sp|Q6YYZ1|LDL2_ORYSJ Lysine-specific histone demethylase 1 homolog 2 OS=Oryza sativa subsp. japonica GN=Os08g0143400 PE=2 SV=1 Back     alignment and function description
>sp|P18487|A37C_DROME Protein anon-37Cs OS=Drosophila melanogaster GN=anon-37Cs PE=2 SV=3 Back     alignment and function description
>sp|P31225|CBP1_CANAL Corticosteroid-binding protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CBP1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query184
110456536123 unknown [Diaphorina citri] 0.467 0.699 0.689 2e-26
158287397 486 AGAP011207-PA [Anopheles gambiae str. PE 0.630 0.238 0.451 2e-24
157120556 472 amine oxidase [Aedes aegypti] gi|1088749 0.451 0.175 0.638 4e-24
312373967 1048 hypothetical protein AND_16683 [Anophele 0.472 0.083 0.597 4e-23
170045018 791 peroxisomal N1-acetyl-spermine/spermidin 0.625 0.145 0.440 6e-23
170065849 947 spermine oxidase [Culex quinquefasciatus 0.625 0.121 0.440 7e-23
170044729 464 amine oxidase [Culex quinquefasciatus] g 0.467 0.185 0.558 8e-23
157123150 478 amine oxidase [Aedes aegypti] gi|1088745 0.467 0.179 0.616 2e-22
383858523 979 PREDICTED: peroxisomal N(1)-acetyl-sperm 0.407 0.076 0.621 8e-22
307214267 474 Peroxisomal N(1)-acetyl-spermine/spermid 0.494 0.191 0.554 5e-21
>gi|110456536|gb|ABG74721.1| unknown [Diaphorina citri] Back     alignment and taxonomy information
 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 60/87 (68%), Positives = 69/87 (79%), Gaps = 1/87 (1%)

Query: 98  TIPEPTRCLHSSWGTNPHFRGSYSCRSLTTERLNTSAADLGAPVSNGQGKPVLLFAGEAT 157
            IPEP R + S W  NPHFRGSYS RS+TT+RLNTSAADL APV N +G+PVLLFAGEAT
Sbjct: 3   IIPEPIRIVRSVWSINPHFRGSYSSRSVTTDRLNTSAADLAAPVINREGRPVLLFAGEAT 62

Query: 158 SEHQYSTVNGAVETGWRE-ADRILTLK 183
           S H Y TVNGAVE+G RE A+ I+ L+
Sbjct: 63  SPHHYGTVNGAVESGARETANAIVYLR 89




Source: Diaphorina citri

Species: Diaphorina citri

Genus: Diaphorina

Family: Psyllidae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|158287397|ref|XP_309435.4| AGAP011207-PA [Anopheles gambiae str. PEST] gi|157019631|gb|EAA05268.4| AGAP011207-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|157120556|ref|XP_001653662.1| amine oxidase [Aedes aegypti] gi|108874902|gb|EAT39127.1| AAEL009050-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|312373967|gb|EFR21628.1| hypothetical protein AND_16683 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|170045018|ref|XP_001850121.1| peroxisomal N1-acetyl-spermine/spermidine oxidase [Culex quinquefasciatus] gi|167868073|gb|EDS31456.1| peroxisomal N1-acetyl-spermine/spermidine oxidase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|170065849|ref|XP_001868046.1| spermine oxidase [Culex quinquefasciatus] gi|167862588|gb|EDS25971.1| spermine oxidase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|170044729|ref|XP_001849989.1| amine oxidase [Culex quinquefasciatus] gi|167867764|gb|EDS31147.1| amine oxidase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|157123150|ref|XP_001660032.1| amine oxidase [Aedes aegypti] gi|108874525|gb|EAT38750.1| AAEL009396-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|383858523|ref|XP_003704750.1| PREDICTED: peroxisomal N(1)-acetyl-spermine/spermidine oxidase-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307214267|gb|EFN89363.1| Peroxisomal N(1)-acetyl-spermine/spermidine oxidase [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query184
FB|FBgn0036750479 CG6034 [Drosophila melanogaste 0.456 0.175 0.476 1.8e-19
FB|FBgn0033584509 CG7737 [Drosophila melanogaste 0.179 0.064 0.696 3.5e-19
FB|FBgn0036749486 CG7460 [Drosophila melanogaste 0.423 0.160 0.576 5.9e-19
FB|FBgn0035943480 CG5653 [Drosophila melanogaste 0.445 0.170 0.524 6.9e-17
UNIPROTKB|H9GWF4137 PAOX "Uncharacterized protein" 0.456 0.613 0.420 3.9e-12
ZFIN|ZDB-GENE-031201-3539 smox "spermine oxidase" [Danio 0.456 0.155 0.430 1.4e-11
UNIPROTKB|F1MG47512 PAOX "Peroxisomal N(1)-acetyl- 0.456 0.164 0.431 4.4e-11
UNIPROTKB|Q865R1512 PAOX "Peroxisomal N(1)-acetyl- 0.456 0.164 0.431 4.4e-11
UNIPROTKB|D4A776546 D4A776 "Uncharacterized protei 0.456 0.153 0.395 8.1e-11
UNIPROTKB|D4A3P5545 RGD1564480 "Protein RGD1564480 0.456 0.154 0.395 1e-10
FB|FBgn0036750 CG6034 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 221 (82.9 bits), Expect = 1.8e-19, Sum P(2) = 1.8e-19
 Identities = 40/84 (47%), Positives = 58/84 (69%)

Query:    96 KVTIPEPTRCLHSSWGTNPHFRGSYSCRSLTTERLNTSAADLGAPVSNGQGKPVLLFAGE 155
             K ++P P   L S W +NP+FRGSYS  S   + L T   DL +P+ +  G+P + FAGE
Sbjct:   386 KFSVPYPKNFLRSQWQSNPNFRGSYSYYSTYADELRTGRTDLASPLVDVTGRPRIQFAGE 445

Query:   156 ATSEHQYSTVNGAVETGWREADRI 179
             A+S + +STV+GA+E+GWREA+R+
Sbjct:   446 ASSRNHFSTVHGAIESGWREAERL 469


GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
FB|FBgn0033584 CG7737 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0036749 CG7460 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0035943 CG5653 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|H9GWF4 PAOX "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-031201-3 smox "spermine oxidase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MG47 PAOX "Peroxisomal N(1)-acetyl-spermine/spermidine oxidase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q865R1 PAOX "Peroxisomal N(1)-acetyl-spermine/spermidine oxidase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|D4A776 D4A776 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D4A3P5 RGD1564480 "Protein RGD1564480" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
pfam01593444 pfam01593, Amino_oxidase, Flavin containing amine 4e-14
PLN02568539 PLN02568, PLN02568, polyamine oxidase 9e-13
PLN02268435 PLN02268, PLN02268, probable polyamine oxidase 2e-10
PLN02976 1713 PLN02976, PLN02976, amine oxidase 4e-10
PLN02529 738 PLN02529, PLN02529, lysine-specific histone demeth 2e-09
PLN02676487 PLN02676, PLN02676, polyamine oxidase 7e-07
PLN02328 808 PLN02328, PLN02328, lysine-specific histone demeth 6e-06
PLN03000 881 PLN03000, PLN03000, amine oxidase 1e-05
>gnl|CDD|216593 pfam01593, Amino_oxidase, Flavin containing amine oxidoreductase Back     alignment and domain information
 Score = 69.1 bits (169), Expect = 4e-14
 Identities = 35/87 (40%), Positives = 41/87 (47%), Gaps = 9/87 (10%)

Query: 95  PKVTIPEPTRCLHSSWGTNPHFRGSYS-CRSLTTERLNTSAADLGAPVSNGQGKPVLLFA 153
               +P+P   L S W T+P+ RGSYS        R       L  PV  G     L FA
Sbjct: 366 GPEDVPDPVNFLVSDWHTDPYARGSYSYPPVGDDSRY---RPALRTPVGPG-----LFFA 417

Query: 154 GEATSEHQYSTVNGAVETGWREADRIL 180
           GE TS     TV GAVE+G R A R+L
Sbjct: 418 GEHTSGGYPGTVEGAVESGLRAARRVL 444


This family consists of various amine oxidases, including maze polyamine oxidase (PAO) and various flavin containing monoamine oxidases (MAO). The aligned region includes the flavin binding site of these enzymes. The family also contains phytoene dehydrogenases and related enzymes. In vertebrates MAO plays an important role regulating the intracellular levels of amines via there oxidation; these include various neurotransmitters, neurotoxins and trace amines. In lower eukaryotes such as aspergillus and in bacteria the main role of amine oxidases is to provide a source of ammonium. PAOs in plants, bacteria and protozoa oxidase spermidine and spermine to an aminobutyral, diaminopropane and hydrogen peroxide and are involved in the catabolism of polyamines. Other members of this family include tryptophan 2-monooxygenase, putrescine oxidase, corticosteroid binding proteins and antibacterial glycoproteins. Length = 444

>gnl|CDD|215308 PLN02568, PLN02568, polyamine oxidase Back     alignment and domain information
>gnl|CDD|177909 PLN02268, PLN02268, probable polyamine oxidase Back     alignment and domain information
>gnl|CDD|215527 PLN02976, PLN02976, amine oxidase Back     alignment and domain information
>gnl|CDD|178144 PLN02529, PLN02529, lysine-specific histone demethylase 1 Back     alignment and domain information
>gnl|CDD|215362 PLN02676, PLN02676, polyamine oxidase Back     alignment and domain information
>gnl|CDD|215187 PLN02328, PLN02328, lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>gnl|CDD|178578 PLN03000, PLN03000, amine oxidase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 184
PLN02676487 polyamine oxidase 99.9
PLN02268435 probable polyamine oxidase 99.89
PLN03000 881 amine oxidase 99.88
PLN02976 1713 amine oxidase 99.87
PLN02568539 polyamine oxidase 99.87
PLN02529 738 lysine-specific histone demethylase 1 99.84
COG1231450 Monoamine oxidase [Amino acid transport and metabo 99.84
PLN02328 808 lysine-specific histone demethylase 1 homolog 99.82
KOG0685|consensus498 99.76
KOG0029|consensus501 99.76
PF01593450 Amino_oxidase: Flavin containing amine oxidoreduct 99.55
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 99.35
TIGR03467419 HpnE squalene-associated FAD-dependent desaturase. 99.07
PLN02612567 phytoene desaturase 99.03
PRK07233434 hypothetical protein; Provisional 98.66
PRK12416463 protoporphyrinogen oxidase; Provisional 98.39
PRK11883451 protoporphyrinogen oxidase; Reviewed 98.36
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 98.2
PLN02576496 protoporphyrinogen oxidase 98.2
PLN02487569 zeta-carotene desaturase 98.07
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 97.67
PRK07208479 hypothetical protein; Provisional 97.24
COG3349485 Uncharacterized conserved protein [Function unknow 95.54
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 95.38
TIGR02730493 carot_isom carotene isomerase. Members of this fam 93.03
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 87.61
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 85.74
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 81.79
>PLN02676 polyamine oxidase Back     alignment and domain information
Probab=99.90  E-value=1.2e-23  Score=192.70  Aligned_cols=106  Identities=28%  Similarity=0.425  Sum_probs=94.8

Q ss_pred             hhcccccCChhhhhccchHHHHHHHHHHHhhcCCcccccCCCCCCCCCCCeeeccccCCCCCCCCCCCCCCCCCcccccc
Q psy13543         53 NGRNLSKSGQNTAKRSNHLNQTFCVASLSHLRTGEAQADNHGPKVTIPEPTRCLHSSWGTNPHFRGSYSCRSLTTERLNT  132 (184)
Q Consensus        53 ~a~~l~~~~~~~~~~~~~~~~~~vl~~L~~lFG~~~a~~~~~~~~~~p~p~~~~~~~W~~Dp~s~Gsys~~~~g~~~~~~  132 (184)
                      .++.+..+++++       +++.++++|+++||+.           +++|+.+..++|.+|||++|+|++++||+.+.  
T Consensus       369 ~a~~~~~~s~e~-------~~~~vl~~L~~~~g~~-----------~~~p~~~~~~~W~~dp~s~Gsys~~~pG~~~~--  428 (487)
T PLN02676        369 ESRRIEQQPDSE-------TKAEIMEVLRKMFGPN-----------IPEATDILVPRWWSNRFFKGSYSNWPIGVSRY--  428 (487)
T ss_pred             HHHHHHhCCHHH-------HHHHHHHHHHHHhCCC-----------CCCcceEEecccCCCCCCCcccCCCCCCCChh--
Confidence            356677777766       8999999999999853           45699999999999999999999999998764  


Q ss_pred             chHhhcCccCCCCCCCeEEEccccccCcCCccHHHHHHHHHHHHHHHHHhcC
Q psy13543        133 SAADLGAPVSNGQGKPVLLFAGEATSEHQYSTVNGAVETGWREADRILTLKD  184 (184)
Q Consensus       133 ~~~~L~~P~~~~~~~~rl~FAGE~Ts~~~~G~veGA~~SG~raA~~Il~~l~  184 (184)
                      ..+.|++|++      |||||||||+..|+||||||++||+|||++|++.|.
T Consensus       429 ~~~~L~~P~g------ri~FAGe~ts~~~~g~~eGA~~SG~RaA~~I~~~l~  474 (487)
T PLN02676        429 EFDQIRAPVG------RVYFTGEHTSEKYNGYVHGAYLAGIDTANDLLECIK  474 (487)
T ss_pred             HHHHHhCCCC------ceEEeccccccccccchHHHHHHHHHHHHHHHHHhc
Confidence            7789999997      999999999999999999999999999999998763



>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>KOG0685|consensus Back     alignment and domain information
>KOG0029|consensus Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>TIGR03467 HpnE squalene-associated FAD-dependent desaturase Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
2x0l_A734 Crystal Structure Of A Neuro-Specific Splicing Vari 4e-06
2v1d_A730 Structural Basis Of Lsd1-Corest Selectivity In Hist 4e-06
2iw5_A666 Structural Basis For Corest-dependent Demethylation 4e-06
2h94_A664 Crystal Structure And Mechanism Of Human Lysine-Spe 4e-06
2hko_A664 Crystal Structure Of Lsd1 Length = 664 4e-06
2xaf_A852 Crystal Structure Of Lsd1-Corest In Complex With Pa 4e-06
2ejr_A662 Lsd1-Tranylcypromine Complex Length = 662 4e-06
2dw4_A660 Crystal Structure Of Human Lsd1 At 2.3 A Resolution 4e-06
4fwe_A796 Native Structure Of Lsd2 /aof1/kdm1b In Spacegroup 3e-05
4gur_A776 Crystal Structure Of Lsd2-npac With H3 In Space Gro 3e-05
4gu1_A784 Crystal Structure Of Lsd2 Length = 784 3e-05
>pdb|2X0L|A Chain A, Crystal Structure Of A Neuro-Specific Splicing Variant Of Human Histone Lysine Demethylase Lsd1 Length = 734 Back     alignment and structure

Iteration: 1

Score = 47.8 bits (112), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 32/90 (35%), Positives = 45/90 (50%), Gaps = 13/90 (14%) Query: 99 IPEPTRCLHSSWGTNPHFRGSYSCRS---------LTTERLNTSAADLGAPVSNGQGKPV 149 +P+P + S W +P RGSYS + L + + + GAP Q P Sbjct: 622 VPQPKETVVSRWRADPWARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAP----QPIPR 677 Query: 150 LLFAGEATSEHQYSTVNGAVETGWREADRI 179 L FAGE T + +TV+GA+ +G REA RI Sbjct: 678 LFFAGEHTIRNYPATVHGALLSGLREAGRI 707
>pdb|2V1D|A Chain A, Structural Basis Of Lsd1-Corest Selectivity In Histone H3 Recognition Length = 730 Back     alignment and structure
>pdb|2IW5|A Chain A, Structural Basis For Corest-dependent Demethylation Of Nucleosomes By The Human Lsd1 Histone Demethylase Length = 666 Back     alignment and structure
>pdb|2H94|A Chain A, Crystal Structure And Mechanism Of Human Lysine-Specific Demethylase-1 Length = 664 Back     alignment and structure
>pdb|2HKO|A Chain A, Crystal Structure Of Lsd1 Length = 664 Back     alignment and structure
>pdb|2XAF|A Chain A, Crystal Structure Of Lsd1-Corest In Complex With Para-Bromo- (+)-Cis-2-Phenylcyclopropyl-1-Amine Length = 852 Back     alignment and structure
>pdb|2EJR|A Chain A, Lsd1-Tranylcypromine Complex Length = 662 Back     alignment and structure
>pdb|2DW4|A Chain A, Crystal Structure Of Human Lsd1 At 2.3 A Resolution Length = 660 Back     alignment and structure
>pdb|4FWE|A Chain A, Native Structure Of Lsd2 /aof1/kdm1b In Spacegroup Of C2221 At 2.13a Length = 796 Back     alignment and structure
>pdb|4GUR|A Chain A, Crystal Structure Of Lsd2-npac With H3 In Space Group P21 Length = 776 Back     alignment and structure
>pdb|4GU1|A Chain A, Crystal Structure Of Lsd2 Length = 784 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 3e-23
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 5e-23
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 1e-21
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 4e-21
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 7e-21
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 1e-19
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 6e-18
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 4e-16
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 7e-13
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 2e-10
2e1m_C181 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 1e-09
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Length = 852 Back     alignment and structure
 Score = 95.4 bits (236), Expect = 3e-23
 Identities = 28/88 (31%), Positives = 42/88 (47%), Gaps = 5/88 (5%)

Query: 98  TIPEPTRCLHSSWGTNPHFRGSYSCRSLTT-----ERLNTSAADLGAPVSNGQGKPVLLF 152
            +P+P   + S W  +P  RGSYS  +  +     + +        +     Q  P L F
Sbjct: 739 AVPQPKETVVSRWRADPWARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFF 798

Query: 153 AGEATSEHQYSTVNGAVETGWREADRIL 180
           AGE T  +  +TV+GA+ +G REA RI 
Sbjct: 799 AGEHTIRNYPATVHGALLSGLREAGRIA 826


>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Length = 662 Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Length = 453 Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Length = 472 Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Length = 516 Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Length = 520 Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Length = 495 Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Length = 431 Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Length = 489 Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Length = 498 Back     alignment and structure
>2e1m_C L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Length = 181 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query184
2e1m_C181 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 99.89
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 99.83
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 99.82
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 99.82
4gut_A776 Lysine-specific histone demethylase 1B; histone de 99.81
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 99.76
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 99.73
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 99.73
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 99.72
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 99.71
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 99.7
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 99.52
3ayj_A721 Pro-enzyme of L-phenylalanine oxidase; amino acid 99.24
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 98.76
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 98.57
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 98.55
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 98.5
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 98.48
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.04
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 97.43
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 97.28
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 97.18
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 97.15
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 97.13
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 96.56
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 96.12
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 93.03
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 89.44
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 84.47
>2e1m_C L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
Probab=99.89  E-value=1.9e-23  Score=167.72  Aligned_cols=104  Identities=18%  Similarity=0.172  Sum_probs=90.4

Q ss_pred             hhcccccCChhhhhccchHHHHHHHHHHHhhcCCcccccCCCCCCCCCCCeee--ccccCCCCCCCCCCCCCCCCCcccc
Q psy13543         53 NGRNLSKSGQNTAKRSNHLNQTFCVASLSHLRTGEAQADNHGPKVTIPEPTRC--LHSSWGTNPHFRGSYSCRSLTTERL  130 (184)
Q Consensus        53 ~a~~l~~~~~~~~~~~~~~~~~~vl~~L~~lFG~~~a~~~~~~~~~~p~p~~~--~~~~W~~Dp~s~Gsys~~~~g~~~~  130 (184)
                      .++.+..+++++       +++.++++|+++||+.+ .          .++.+  +.++|.+|||++|+|++++||++..
T Consensus        47 ~A~~~~~l~~~e-------~~~~~l~~L~~~~g~~~-~----------~~~~~~~~~~~W~~dp~~~Ga~s~~~pg~~~~  108 (181)
T 2e1m_C           47 DAARWDSFDDAE-------RYGYALENLQSVHGRRI-E----------VFYTGAGQTQSWLRDPYACGEAAVYTPHQMTA  108 (181)
T ss_dssp             HHHHHTTSCTTT-------THHHHHHHHHHHHCGGG-G----------GTEEEEEEEEESSSCTTTSSSEECCCTTHHHH
T ss_pred             HHHHHHcCCHHH-------HHHHHHHHHHHHhCCCc-H----------hhccCcceecccCCCCCCCCcccCcCCCchHH
Confidence            456677777666       89999999999998752 2          24477  9999999999999999999998864


Q ss_pred             ccchHhhcCccCCCCCCCeEEEccccccCcCCccHHHHHHHHHHHHHHHHHhc
Q psy13543        131 NTSAADLGAPVSNGQGKPVLLFAGEATSEHQYSTVNGAVETGWREADRILTLK  183 (184)
Q Consensus       131 ~~~~~~L~~P~~~~~~~~rl~FAGE~Ts~~~~G~veGA~~SG~raA~~Il~~l  183 (184)
                        .++.|++|++      |||||||||+. ++||||||++||+|||++|+..+
T Consensus       109 --~~~~l~~p~g------rl~FAGe~ts~-~~g~~eGAl~SG~raA~~i~~~l  152 (181)
T 2e1m_C          109 --FHLDVVRPEG------PVYFAGEHVSL-KHAWIEGAVETAVRAAIAVNEAP  152 (181)
T ss_dssp             --HHHHHHSCBT------TEEECSGGGTT-STTSHHHHHHHHHHHHHHHHTCC
T ss_pred             --HHHHHhCCCC------cEEEEEHHHcC-CccCHHHHHHHHHHHHHHHHHHh
Confidence              6789999987      89999999996 99999999999999999999765



>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 184
d2dw4a2449 c.3.1.2 (A:274-654,A:764-831) Lysine-specific hist 1e-11
d2dw4a3109 d.16.1.5 (A:655-763) Lysine-specific histone demet 2e-05
d1b5qa2112 d.16.1.5 (A:294-405) Polyamine oxidase {Maize (Zea 3e-05
d2v5za2112 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (H 1e-04
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 449 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Lysine-specific histone demethylase 1, LSD1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 59.9 bits (143), Expect = 1e-11
 Identities = 21/74 (28%), Positives = 30/74 (40%), Gaps = 1/74 (1%)

Query: 108 SSWGTNPHFRGSY-SCRSLTTERLNTSAADLGAPVSNGQGKPVLLFAGEATSEHQYSTVN 166
             W T+   R           + +        +     Q  P L FAGE T  +  +TV+
Sbjct: 371 PEWKTSAVQRMVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVH 430

Query: 167 GAVETGWREADRIL 180
           GA+ +G REA RI 
Sbjct: 431 GALLSGLREAGRIA 444


>d2dw4a3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1b5qa2 d.16.1.5 (A:294-405) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 112 Back     information, alignment and structure
>d2v5za2 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query184
d2v5za2112 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 99.34
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 99.33
d2dw4a3109 Lysine-specific histone demethylase 1, LSD1 {Human 99.3
d1b5qa2112 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 99.14
d2iida2113 L-aminoacid oxidase {Malayan pit viper (Calloselas 99.06
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 98.25
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 97.91
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 97.61
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 96.08
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 85.98
>d2v5za2 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: FAD-linked reductases, C-terminal domain
superfamily: FAD-linked reductases, C-terminal domain
family: L-aminoacid/polyamine oxidase
domain: Monoamine oxidase B
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.34  E-value=1.5e-13  Score=98.14  Aligned_cols=87  Identities=15%  Similarity=0.207  Sum_probs=65.0

Q ss_pred             cchhhhhhcccCCCCCCCC-----------CCCCC--ceeeeeehhhhhhHHhhhhcccccCChhhhhccchHHHHHHHH
Q psy13543         12 VDYVWWKHLMYGGGGGGGG-----------DAPEK--HKLIIVGAGAIAENRQKNGRNLSKSGQNTAKRSNHLNQTFCVA   78 (184)
Q Consensus        12 ~~~~~~~~~~~~~~~~~~g-----------~~~~~--~~~~~~~~g~~a~~~~~~a~~l~~~~~~~~~~~~~~~~~~vl~   78 (184)
                      .+.+||++.++.|.+..+.           ..+..  +.|..+..|       +.|..+..+++++       +++.+|+
T Consensus        12 f~~~FW~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~vL~~~~~G-------~~a~~~~~ls~~e-------~~~~~l~   77 (112)
T d2v5za2          12 YKEPFWRKKDYCGTMIIDGEEAPVAYTLDDTKPEGNYAAIMGFILA-------HKARKLARLTKEE-------RLKKLCE   77 (112)
T ss_dssp             CSSCGGGGGTEEEEEEECSTTCSCSEEEECCCTTSCSCEEEEEEET-------HHHHHHTTSCHHH-------HHHHHHH
T ss_pred             cCCCCCCCCCceeeEEecCCCCcEEEEccCcCccCCCcEEEEEeCc-------HHHHHHHhCCHHH-------HHHHHHH
Confidence            4789999999988766542           12222  222222233       3467778888777       9999999


Q ss_pred             HHHhhcCCcccccCCCCCCCCCCCeeeccccCCCCCCCCCCCCC
Q psy13543         79 SLSHLRTGEAQADNHGPKVTIPEPTRCLHSSWGTNPHFRGSYSC  122 (184)
Q Consensus        79 ~L~~lFG~~~a~~~~~~~~~~p~p~~~~~~~W~~Dp~s~Gsys~  122 (184)
                      +|+++||+.          .+++|+.+++++|.+|||++|+||.
T Consensus        78 ~L~~~~g~~----------~~~~~~~~~~~~W~~dp~~~GsYs~  111 (112)
T d2v5za2          78 LYAKVLGSL----------EALEPVHYEEKNWCEEQYSGGCYTT  111 (112)
T ss_dssp             HHHHHHTCG----------GGGCCSEEEEEEGGGCTTTCSSSCB
T ss_pred             HHHHHhCcc----------ccCCccEEEEcccCCCCccCccccc
Confidence            999999964          3457999999999999999999985



>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dw4a3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b5qa2 d.16.1.5 (A:294-405) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2iida2 d.16.1.5 (A:320-432) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure