Psyllid ID: psy13674


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-----
MSQIMMQKKMSQIVDENNNNLSQMSLVQQQPSQGRASSQQSVHQARSSSQQSTGSVRTAAVEEEDEEDGEEFFQDVDILQNYNINVADIKKLKSVGLCTIKGVQMTTRRKMSQIKGFSEAKVDKIKEACMKICDNSFLTAAQVVEKRKQVFKITTGSTELDKILGGGIESMAITEAFGEFRTGKTQLSHTLSITAQLPDETRGYTGGKVIYVDSENTLYPLLNIIAIASLVTLVGSRLPMSFHITREDLIVFFPLNADPKKPVGGNIMAHASTTRISLRKGRGETRIAKIYDSPDMPEAEAMFAITNGGIADAKD
ccHHHHHHHHHHHcccccccccccHHcccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHccccHHHHHHHHHcccccHHHHHHccHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHHccEEEEcccHHHHHHHcccccccEEEEEEEccccccHHHHHHHHHHHHcccccccccccEEEEEEcccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHccccccccccccccccccccccccEEEEEEccccccEEEEEEccccccccEEEEEEEccccccccc
ccHHHHcccHHHcccccccccccccccEcccccccccHHHHHcccccHHHHHHHHHHHHHHHHHccHccccccccHHHHHHccccHHHHHHHHHccccEEEEEEEccHHHHHHcccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHEEEccccHHHHHHHccccccccEHHHHccccccccEEEEEEEEEEEcccccccccccEEEEEEccccccHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccHcccccccccHHHHHHHHHHHHHHHHccccccEEEEEEcccccccccEEEEEcccccccccc
MSQIMMQKKMSQIVDENNNNLSQMSLVqqqpsqgrassqqSVHQARsssqqstgsvrtaaveeedeedgeeffqdVDILQNYNINVADIKKLKSVGLCTIKGVQMTTRRKMSQIKGFSEAKVDKIKEACMKICDNSFLTAAQVVEKRKQVFKITTGSTELDKILGGGIESMAITEAfgefrtgktqlshtlsitaqlpdetrgytggkviyvdsentlyPLLNIIAIASLVTLvgsrlpmsfhitredlivffplnadpkkpvggnimahaSTTRISLrkgrgetriakiydspdmpeAEAMFAITnggiadakd
MSQIMMQKKMSQIVDENNNNLSQMSLVQQQPSQGRASSQQSVHQarsssqqstgsvRTAAVEEEDEEDGEEFFQDVDILQNYNINvadikklksvglctikgvqmttrrkmsqikgfseakvDKIKEACMKICDNSFLTAAQVVEKRKqvfkittgsteldkilgGGIESMAITEAFGEFRTGKTQLSHTLSitaqlpdetrgyTGGKVIYVDSENTLYPLLNIIAIASLVTLVGSRLPMSFHITREDLIVFFPLNADPKKpvggnimahasttrislrkgrgetriakiydspdmpeAEAMFAITNGGIADAKD
msqimmqkkmsqiVDENNNNLSQMSLVQQQPSQGRASSQQSVHQARSSSQQSTGSVRTAAVeeedeedgeeFFQDVDILQNYNINVADIKKLKSVGLCTIKGVQMTTRRKMSQIKGFSEAKVDKIKEACMKICDNSFLTAAQVVEKRKQVFKITTGSTELDKILGGGIESMAITEAFGEFRTGKTQLSHTLSITAQLPDETRGYTGGKVIYVDSENTLYPLLNIIAIASLVTLVGSRLPMSFHITREDLIVFFPLNADPKKPVGGNIMAHASTTRISLRKGRGETRIAKIYDSPDMPEAEAMFAITNGGIADAKD
***********************************************************************FFQDVDILQNYNINVADIKKLKSVGLCTIKGVQMTTRRKMSQIKGFSEAKVDKIKEACMKICDNSFLTAAQVVEKRKQVFKITTGSTELDKILGGGIESMAITEAFGEFRTGKTQLSHTLSITAQLPDETRGYTGGKVIYVDSENTLYPLLNIIAIASLVTLVGSRLPMSFHITREDLIVFFPLNADPK*PVGGNIMA**********************************************
*************************************************************************QDVDILQNYNINVADIKKLKSVGLCTIKGVQMTTRRKMSQIKGFSEAKVDKIKEACMKICDNSFLTAAQVVEKRKQVFKITTGSTELDKILGGGIESMAITEAFGEFRTGKTQLSHTLSITAQLPDETRGYTGGKVIYVDSENTLYPLLNIIAIASLVTLVGSRLPMSFHITREDLIVFFPLNADPKKPVGGNIMAHASTTRISLRKGRGETRIAKIYDSPDMPEAEAMFAITNGGIA****
***********QIVDENNNNLSQMS*********************************************EFFQDVDILQNYNINVADIKKLKSVGLCTIKGVQMTTRRKMSQIKGFSEAKVDKIKEACMKICDNSFLTAAQVVEKRKQVFKITTGSTELDKILGGGIESMAITEAFGEFRTGKTQLSHTLSITAQLPDETRGYTGGKVIYVDSENTLYPLLNIIAIASLVTLVGSRLPMSFHITREDLIVFFPLNADPKKPVGGNIMAHASTTRISLRKGRGETRIAKIYDSPDMPEAEAMFAITNGGIADAKD
*********************************************************************EEFFQDVDILQNYNINVADIKKLKSVGLCTIKGVQMTTRRKMSQIKGFSEAKVDKIKEACMKICDNSFLTAAQVVEKRKQVFKITTGSTELDKILGGGIESMAITEAFGEFRTGKTQLSHTLSITAQLPDETRGYTGGKVIYVDSENTLYPLLNIIAIASLVTLVGSRLPMSFHITREDLIVFFPLNADPKKPVGGNIMAHASTTRISLRKGRGETRIAKIYDSPDMPEAEAMFAITNGGI*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSQIMMQKKMSQIVDENNNNLSQMSLVQQQPSQGRASSQQSVHQARSSSQQSTGSVRTAAVEEEDEEDGEEFFQDVDILQNYNINVADIKKLKSVGLCTIKGVQMTTRRKMSQIKGFSEAKVDKIKEACMKICDNSFLTAAQVVEKRKQVFKITTGSTELDKILGGGIESMAITEAFGEFRTGKTQLSHTLSITAQLPDETRGYTGGKVIYVDSENTLYPLLNIIAIASLVTLVGSRLPMSFHITREDLIVFFPLNADPKKPVGGNIMAHASTTRISLRKGRGETRIAKIYDSPDMPEAEAMFAITNGGIADAKD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query315 2.2.26 [Sep-21-2011]
Q61880340 Meiotic recombination pro yes N/A 0.504 0.467 0.679 1e-58
Q14565340 Meiotic recombination pro yes N/A 0.488 0.452 0.700 3e-58
O42634332 Meiotic recombination pro yes N/A 0.780 0.740 0.405 4e-56
P50265324 Meiotic recombination pro N/A N/A 0.457 0.444 0.572 1e-39
P25453334 Meiotic recombination pro yes N/A 0.457 0.431 0.551 9e-38
Q96449345 Meiotic recombination pro yes N/A 0.469 0.428 0.510 2e-37
P94102342 DNA repair protein RAD51 yes N/A 0.520 0.479 0.485 4e-37
P37384349 Meiotic recombination pro N/A N/A 0.466 0.421 0.506 6e-37
Q39009344 Meiotic recombination pro no N/A 0.457 0.418 0.531 2e-36
Q9XED7340 DNA repair protein RAD51 N/A N/A 0.542 0.502 0.471 3e-35
>sp|Q61880|DMC1_MOUSE Meiotic recombination protein DMC1/LIM15 homolog OS=Mus musculus GN=Dmc1 PE=1 SV=1 Back     alignment and function desciption
 Score =  226 bits (577), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 110/162 (67%), Positives = 132/162 (81%), Gaps = 3/162 (1%)

Query: 61  VEEED--EEDGEEFFQDVDILQNYNINVADIKKLKSVGLCTIKGVQMTTRRKMSQIKGFS 118
           V+EE   ++D E  FQD+D+LQ + IN+ADIKKLKSVG+CTIKG+QMTTRR +  +KG S
Sbjct: 7   VQEESGFQDDEESLFQDIDLLQKHGINMADIKKLKSVGICTIKGIQMTTRRALCNVKGLS 66

Query: 119 EAKVDKIKEACMKICDNSFLTAAQVVEKRKQVFKITTGSTELDKILGGGIESMAITEAFG 178
           EAKV+KIKEA  K+ +  FLTA Q  E+RK VF ITTGS E DK+LGGGIESMAITEAFG
Sbjct: 67  EAKVEKIKEAANKLIEPGFLTAFQYSERRKMVFHITTGSQEFDKLLGGGIESMAITEAFG 126

Query: 179 EFRTGKTQLSHTLSITAQLPDETRGYTGGKVIYVDSENTLYP 220
           EFRTGKTQLSHTL +TAQLP  T GY+GGK+I++D+ENT  P
Sbjct: 127 EFRTGKTQLSHTLCVTAQLPG-TGGYSGGKIIFIDTENTFRP 167




May participate in meiotic recombination, specifically in homologous strand assimilation, which is required for the resolution of meiotic double-strand breaks.
Mus musculus (taxid: 10090)
>sp|Q14565|DMC1_HUMAN Meiotic recombination protein DMC1/LIM15 homolog OS=Homo sapiens GN=DMC1 PE=1 SV=2 Back     alignment and function description
>sp|O42634|DMC1_SCHPO Meiotic recombination protein dmc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dmc1 PE=1 SV=2 Back     alignment and function description
>sp|P50265|DLH1_CANAX Meiotic recombination protein DLH1 OS=Candida albicans GN=DLH1 PE=3 SV=1 Back     alignment and function description
>sp|P25453|DMC1_YEAST Meiotic recombination protein DMC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DMC1 PE=1 SV=1 Back     alignment and function description
>sp|Q96449|DMC1_SOYBN Meiotic recombination protein DMC1 homolog OS=Glycine max PE=2 SV=1 Back     alignment and function description
>sp|P94102|RAD51_ARATH DNA repair protein RAD51 homolog 1 OS=Arabidopsis thaliana GN=RAD51 PE=1 SV=1 Back     alignment and function description
>sp|P37384|DMC1_LILLO Meiotic recombination protein DMC1 homolog OS=Lilium longiflorum GN=LIM15 PE=2 SV=1 Back     alignment and function description
>sp|Q39009|DMC1_ARATH Meiotic recombination protein DMC1 homolog OS=Arabidopsis thaliana GN=LIM15 PE=1 SV=2 Back     alignment and function description
>sp|Q9XED7|R51A2_MAIZE DNA repair protein RAD51 homolog B OS=Zea mays GN=RAD51B PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query315
335287564285 PREDICTED: meiotic recombination protein 0.777 0.859 0.569 6e-74
194387328285 unnamed protein product [Homo sapiens] 0.777 0.859 0.566 9e-74
26345652285 unnamed protein product [Mus musculus] 0.793 0.877 0.552 3e-73
148672697294 disrupted meiotic cDNA 1 homolog, isofor 0.793 0.850 0.552 4e-73
198436503282 PREDICTED: similar to Dmc1 homolog [Cion 0.768 0.858 0.510 3e-65
431905180298 Meiotic recombination protein DMC1/LIM15 0.723 0.765 0.517 1e-64
242004733341 conserved hypothetical protein [Pediculu 0.504 0.466 0.708 2e-59
63852080339 RecA homolog DMC1 [Anguilla japonica] gi 0.488 0.454 0.703 5e-59
449265652346 Meiotic recombination protein DMC1/LIM15 0.504 0.459 0.697 2e-58
363727814342 PREDICTED: meiotic recombination protein 0.504 0.464 0.697 4e-58
>gi|335287564|ref|XP_003355384.1| PREDICTED: meiotic recombination protein DMC1/LIM15 homolog isoform 2 [Sus scrofa] Back     alignment and taxonomy information
 Score =  283 bits (724), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 159/279 (56%), Positives = 184/279 (65%), Gaps = 34/279 (12%)

Query: 64  EDEEDGEEFFQDVDILQNYNINVADIKKLKSVGLCTIKGVQMTTRRKMSQIKGFSEAKVD 123
           +DEE  E  FQD+D+LQ + INVADIKKLKSVG+CTIKG+QMTTRR +  +KG SEAKVD
Sbjct: 14  QDEE--ESLFQDIDLLQKHGINVADIKKLKSVGICTIKGIQMTTRRALCNVKGLSEAKVD 71

Query: 124 KIKEACMKICDNSFLTAAQVVEKRKQVFKITTGSTELDKILGGGIESMAITEAFGEFRTG 183
           KIKEA  K+ +  FLTA +  EKRK VF ITTGS E DK+LGGGIESMAITEAFGEFRTG
Sbjct: 72  KIKEAANKLIEPGFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTG 131

Query: 184 KTQLSHTLSITAQLPDETRGYTGGKVIYVDSENTLYPLLNIIAIASLVTL---------- 233
           KTQLSHTL    Q+  E   Y   K      E  ++ LL I +I +L  +          
Sbjct: 132 KTQLSHTLCGEHQM--ELLDYVAAK---FHEEAGIFKLLIIDSIMALFRVDFSGRGELAE 186

Query: 234 ----VGSRLPMSFHITREDLIVFFPLN-------------ADPKKPVGGNIMAHASTTRI 276
               +   L     I+ E  +  F  N             ADPKKPVGG+I+AHASTTRI
Sbjct: 187 RQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPVGGHILAHASTTRI 246

Query: 277 SLRKGRGETRIAKIYDSPDMPEAEAMFAITNGGIADAKD 315
           SLRKGRGE RIAKIYDSP+MPE EA FAIT GGI DAK+
Sbjct: 247 SLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAKE 285




Source: Sus scrofa

Species: Sus scrofa

Genus: Sus

Family: Suidae

Order:

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota

>gi|194387328|dbj|BAG60028.1| unnamed protein product [Homo sapiens] Back     alignment and taxonomy information
>gi|26345652|dbj|BAC36477.1| unnamed protein product [Mus musculus] Back     alignment and taxonomy information
>gi|148672697|gb|EDL04644.1| disrupted meiotic cDNA 1 homolog, isoform CRA_b [Mus musculus] Back     alignment and taxonomy information
>gi|198436503|ref|XP_002123810.1| PREDICTED: similar to Dmc1 homolog [Ciona intestinalis] Back     alignment and taxonomy information
>gi|431905180|gb|ELK10227.1| Meiotic recombination protein DMC1/LIM15 like protein [Pteropus alecto] Back     alignment and taxonomy information
>gi|242004733|ref|XP_002423233.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212506212|gb|EEB10495.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|63852080|dbj|BAD98459.1| RecA homolog DMC1 [Anguilla japonica] gi|90403222|dbj|BAE92010.1| Dmc1 [Anguilla japonica] Back     alignment and taxonomy information
>gi|449265652|gb|EMC76815.1| Meiotic recombination protein DMC1/LIM15 like protein, partial [Columba livia] Back     alignment and taxonomy information
>gi|363727814|ref|XP_425477.3| PREDICTED: meiotic recombination protein DMC1/LIM15 homolog [Gallus gallus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query315
UNIPROTKB|Q50LF7339 eDmc1 "RecA homolog DMC1" [Ang 0.469 0.436 0.718 4.6e-80
UNIPROTKB|F1NI95346 DMC1 "Uncharacterized protein" 0.469 0.427 0.724 8.4e-79
UNIPROTKB|Q9DGC3342 Dmc1 "DMC1" [Cynops pyrrhogast 0.469 0.432 0.718 8.4e-79
UNIPROTKB|F1SKQ1340 DMC1 "Uncharacterized protein" 0.466 0.432 0.716 5.9e-78
UNIPROTKB|E2RK50340 DMC1 "Uncharacterized protein" 0.466 0.432 0.716 9.5e-78
UNIPROTKB|Q9GRA3331 CnDmc1 "DMC1 homologue CnDMC1" 0.469 0.447 0.697 1.2e-77
UNIPROTKB|Q14565340 DMC1 "Meiotic recombination pr 0.466 0.432 0.716 1.2e-77
MGI|MGI:105393340 Dmc1 "DMC1 dosage suppressor o 0.466 0.432 0.709 1.2e-77
RGD|1307611340 Dmc1 "DMC1 dosage suppressor o 0.466 0.432 0.709 1.2e-77
ZFIN|ZDB-GENE-060331-93342 dmc1 "DMC1 dosage suppressor o 0.469 0.432 0.718 5.2e-77
UNIPROTKB|Q50LF7 eDmc1 "RecA homolog DMC1" [Anguilla japonica (taxid:7937)] Back     alignment and assigned GO terms
 Score = 564 (203.6 bits), Expect = 4.6e-80, Sum P(2) = 4.6e-80
 Identities = 107/149 (71%), Positives = 126/149 (84%)

Query:    72 FFQDVDILQNYNINVADIKKLKSVGLCTIKGVQMTTRRKMSQIKGFSEAKVDKIKEACMK 131
             FFQD+D+LQ + IN+ADIKKLKS+G+CT+KG+QMTTRR +  +KG SEAKVDKIKEA  K
Sbjct:    19 FFQDIDLLQKHGINMADIKKLKSIGICTVKGIQMTTRRALCNVKGLSEAKVDKIKEAAGK 78

Query:   132 ICDNSFLTAAQVVEKRKQVFKITTGSTELDKILGGGIESMAITEAFGEFRTGKTQLSHTL 191
             +  N FLTA +  E+RKQVF ITTGS E DK++GGGIESMAITEAFGEFRTGKTQLSHTL
Sbjct:    79 LLSNGFLTAFEYSERRKQVFHITTGSLEFDKLIGGGIESMAITEAFGEFRTGKTQLSHTL 138

Query:   192 SITAQLPDETRGYTGGKVIYVDSENTLYP 220
              +TAQLP E  GYTGGKVI++D+ENT  P
Sbjct:   139 CVTAQLPGED-GYTGGKVIFIDTENTFRP 166


GO:0000150 "recombinase activity" evidence=ISS
GO:0003690 "double-stranded DNA binding" evidence=ISS
GO:0003697 "single-stranded DNA binding" evidence=ISS
GO:0005524 "ATP binding" evidence=ISS
GO:0006200 "ATP catabolic process" evidence=ISS
GO:0016887 "ATPase activity" evidence=ISS
UNIPROTKB|F1NI95 DMC1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9DGC3 Dmc1 "DMC1" [Cynops pyrrhogaster (taxid:8330)] Back     alignment and assigned GO terms
UNIPROTKB|F1SKQ1 DMC1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2RK50 DMC1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9GRA3 CnDmc1 "DMC1 homologue CnDMC1" [Hydra vulgaris (taxid:6087)] Back     alignment and assigned GO terms
UNIPROTKB|Q14565 DMC1 "Meiotic recombination protein DMC1/LIM15 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:105393 Dmc1 "DMC1 dosage suppressor of mck1 homolog, meiosis-specific homologous recombination" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1307611 Dmc1 "DMC1 dosage suppressor of mck1 homolog, meiosis-specific homologous recombination (yeast)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060331-93 dmc1 "DMC1 dosage suppressor of mck1 homolog, meiosis-specific homologous recombination (yeast)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O42634DMC1_SCHPONo assigned EC number0.40540.78090.7409yesN/A
Q14565DMC1_HUMANNo assigned EC number0.70060.48880.4529yesN/A
Q61880DMC1_MOUSENo assigned EC number0.67900.50470.4676yesN/A
Q96449DMC1_SOYBNNo assigned EC number0.51000.46980.4289yesN/A
P25453DMC1_YEASTNo assigned EC number0.55170.45710.4311yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query315
PTZ00035337 PTZ00035, PTZ00035, Rad51 protein; Provisional 8e-74
TIGR02238313 TIGR02238, recomb_DMC1, meiotic recombinase Dmc1 8e-71
PLN03187344 PLN03187, PLN03187, meiotic recombination protein 1e-56
PLN03186342 PLN03186, PLN03186, DNA repair protein RAD51 homol 2e-55
TIGR02239316 TIGR02239, recomb_RAD51, DNA repair protein RAD51 8e-52
PRK04301317 PRK04301, radA, DNA repair and recombination prote 2e-39
pfam08423261 pfam08423, Rad51, Rad51 3e-39
TIGR02236310 TIGR02236, recomb_radA, DNA repair and recombinati 2e-37
pfam08423261 pfam08423, Rad51, Rad51 4e-33
TIGR02239316 TIGR02239, recomb_RAD51, DNA repair protein RAD51 1e-30
PTZ00035337 PTZ00035, PTZ00035, Rad51 protein; Provisional 4e-30
cd01123235 cd01123, Rad51_DMC1_radA, Rad51_DMC1_radA,B 2e-28
TIGR02238313 TIGR02238, recomb_DMC1, meiotic recombinase Dmc1 4e-27
cd01123235 cd01123, Rad51_DMC1_radA, Rad51_DMC1_radA,B 4e-26
cd01393226 cd01393, recA_like, RecA is a bacterial enzyme whi 6e-26
PLN03186342 PLN03186, PLN03186, DNA repair protein RAD51 homol 2e-24
COG0468279 COG0468, RecA, RecA/RadA recombinase [DNA replicat 3e-24
PLN03187344 PLN03187, PLN03187, meiotic recombination protein 3e-23
PRK04301317 PRK04301, radA, DNA repair and recombination prote 2e-22
TIGR02236310 TIGR02236, recomb_radA, DNA repair and recombinati 3e-19
cd01393226 cd01393, recA_like, RecA is a bacterial enzyme whi 2e-16
COG0468279 COG0468, RecA, RecA/RadA recombinase [DNA replicat 7e-13
PRK09361225 PRK09361, radB, DNA repair and recombination prote 8e-11
cd01394218 cd01394, radB, RadB 3e-08
TIGR02237209 TIGR02237, recomb_radB, DNA repair and recombinati 2e-07
PRK09361225 PRK09361, radB, DNA repair and recombination prote 8e-06
cd01394218 cd01394, radB, RadB 4e-05
COG2874235 COG2874, FlaH, Predicted ATPases involved in bioge 7e-04
cd00983 325 cd00983, recA, RecA is a bacterial enzyme which ha 0.002
pfam00154 322 pfam00154, RecA, recA bacterial DNA recombination 0.004
>gnl|CDD|185407 PTZ00035, PTZ00035, Rad51 protein; Provisional Back     alignment and domain information
 Score =  230 bits (588), Expect = 8e-74
 Identities = 88/161 (54%), Positives = 117/161 (72%), Gaps = 1/161 (0%)

Query: 60  AVEEEDEEDGEEFFQDVDILQNYNINVADIKKLKSVGLCTIKGVQMTTRRKMSQIKGFSE 119
             +EE+EE+  E FQ+++ LQ+  IN ADIKKLK  G+CT++ V   T++ +  IKG SE
Sbjct: 7   EQQEEEEEEEAEGFQEIEKLQSAGINAADIKKLKEAGICTVESVAYATKKDLCNIKGISE 66

Query: 120 AKVDKIKEACMKICDNSFLTAAQVVEKRKQVFKITTGSTELDKILGGGIESMAITEAFGE 179
           AKV+KIKEA  K+    F++A + +E RK + +ITTGST+LDK+LGGGIE+ +ITE FGE
Sbjct: 67  AKVEKIKEAASKLVPMGFISATEYLEARKNIIRITTGSTQLDKLLGGGIETGSITELFGE 126

Query: 180 FRTGKTQLSHTLSITAQLPDETRGYTGGKVIYVDSENTLYP 220
           FRTGKTQL HTL +T QLP E  G   GKV+Y+D+E T  P
Sbjct: 127 FRTGKTQLCHTLCVTCQLPIEQGG-GEGKVLYIDTEGTFRP 166


Length = 337

>gnl|CDD|131292 TIGR02238, recomb_DMC1, meiotic recombinase Dmc1 Back     alignment and domain information
>gnl|CDD|215620 PLN03187, PLN03187, meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>gnl|CDD|178728 PLN03186, PLN03186, DNA repair protein RAD51 homolog; Provisional Back     alignment and domain information
>gnl|CDD|233794 TIGR02239, recomb_RAD51, DNA repair protein RAD51 Back     alignment and domain information
>gnl|CDD|235273 PRK04301, radA, DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>gnl|CDD|117002 pfam08423, Rad51, Rad51 Back     alignment and domain information
>gnl|CDD|131290 TIGR02236, recomb_radA, DNA repair and recombination protein RadA Back     alignment and domain information
>gnl|CDD|117002 pfam08423, Rad51, Rad51 Back     alignment and domain information
>gnl|CDD|233794 TIGR02239, recomb_RAD51, DNA repair protein RAD51 Back     alignment and domain information
>gnl|CDD|185407 PTZ00035, PTZ00035, Rad51 protein; Provisional Back     alignment and domain information
>gnl|CDD|238543 cd01123, Rad51_DMC1_radA, Rad51_DMC1_radA,B Back     alignment and domain information
>gnl|CDD|131292 TIGR02238, recomb_DMC1, meiotic recombinase Dmc1 Back     alignment and domain information
>gnl|CDD|238543 cd01123, Rad51_DMC1_radA, Rad51_DMC1_radA,B Back     alignment and domain information
>gnl|CDD|238687 cd01393, recA_like, RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>gnl|CDD|178728 PLN03186, PLN03186, DNA repair protein RAD51 homolog; Provisional Back     alignment and domain information
>gnl|CDD|223544 COG0468, RecA, RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|215620 PLN03187, PLN03187, meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>gnl|CDD|235273 PRK04301, radA, DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>gnl|CDD|131290 TIGR02236, recomb_radA, DNA repair and recombination protein RadA Back     alignment and domain information
>gnl|CDD|238687 cd01393, recA_like, RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>gnl|CDD|223544 COG0468, RecA, RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|236482 PRK09361, radB, DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>gnl|CDD|238688 cd01394, radB, RadB Back     alignment and domain information
>gnl|CDD|233793 TIGR02237, recomb_radB, DNA repair and recombination protein RadB Back     alignment and domain information
>gnl|CDD|236482 PRK09361, radB, DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>gnl|CDD|238688 cd01394, radB, RadB Back     alignment and domain information
>gnl|CDD|225429 COG2874, FlaH, Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|238483 cd00983, recA, RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>gnl|CDD|215755 pfam00154, RecA, recA bacterial DNA recombination protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 315
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 100.0
KOG1434|consensus335 100.0
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 100.0
PTZ00035337 Rad51 protein; Provisional 100.0
PLN03186342 DNA repair protein RAD51 homolog; Provisional 100.0
TIGR02239316 recomb_RAD51 DNA repair protein RAD51. This eukary 100.0
PF08423256 Rad51: Rad51; InterPro: IPR013632 This domain is f 100.0
TIGR02236310 recomb_radA DNA repair and recombination protein R 100.0
PRK04301317 radA DNA repair and recombination protein RadA; Va 100.0
KOG1564|consensus351 100.0
KOG1433|consensus326 100.0
COG0468279 RecA RecA/RadA recombinase [DNA replication, recom 100.0
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 100.0
cd01393226 recA_like RecA is a bacterial enzyme which has rol 99.96
PRK09361225 radB DNA repair and recombination protein RadB; Pr 99.95
cd01394218 radB RadB. The archaeal protein radB shares simila 99.95
TIGR02237209 recomb_radB DNA repair and recombination protein R 99.93
PRK09519 790 recA DNA recombination protein RecA; Reviewed 99.92
cd00983325 recA RecA is a bacterial enzyme which has roles in 99.91
PRK09354349 recA recombinase A; Provisional 99.91
TIGR02012321 tigrfam_recA protein RecA. This model describes or 99.9
PRK11823 446 DNA repair protein RadA; Provisional 99.84
cd01121 372 Sms Sms (bacterial radA) DNA repair protein. This 99.84
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 99.84
TIGR00416 454 sms DNA repair protein RadA. The gene protuct code 99.82
PF00154322 RecA: recA bacterial DNA recombination protein; In 99.8
PRK04328249 hypothetical protein; Provisional 99.8
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 99.79
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 99.79
COG1066 456 Sms Predicted ATP-dependent serine protease [Postt 99.76
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 99.72
PRK06067234 flagellar accessory protein FlaH; Validated 99.72
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 99.72
PRK09302509 circadian clock protein KaiC; Reviewed 99.71
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 99.68
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 99.66
PRK09302 509 circadian clock protein KaiC; Reviewed 99.63
PRK08533230 flagellar accessory protein FlaH; Reviewed 99.54
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 99.53
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 99.39
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 99.37
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 99.36
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 99.33
TIGR00665434 DnaB replicative DNA helicase. This model describe 99.32
PRK08760476 replicative DNA helicase; Provisional 99.31
PRK07004460 replicative DNA helicase; Provisional 99.26
PHA02542473 41 41 helicase; Provisional 99.26
PRK05748448 replicative DNA helicase; Provisional 99.25
PRK06321472 replicative DNA helicase; Provisional 99.24
PRK05595444 replicative DNA helicase; Provisional 99.23
PRK08506472 replicative DNA helicase; Provisional 99.22
PRK09165497 replicative DNA helicase; Provisional 99.2
PRK05636505 replicative DNA helicase; Provisional 99.19
PRK08006471 replicative DNA helicase; Provisional 99.18
PRK08840464 replicative DNA helicase; Provisional 99.16
PRK06904472 replicative DNA helicase; Validated 99.16
COG2874235 FlaH Predicted ATPases involved in biogenesis of a 99.1
PRK06749428 replicative DNA helicase; Provisional 99.1
PRK05973237 replicative DNA helicase; Provisional 99.05
COG0305435 DnaB Replicative DNA helicase [DNA replication, re 99.02
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 99.01
PRK07773 886 replicative DNA helicase; Validated 98.9
cd01124187 KaiC KaiC is a circadian clock protein primarily f 98.84
KOG2859|consensus 293 98.76
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 98.72
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 98.39
PF1452060 HHH_5: Helix-hairpin-helix domain; PDB: 3AUO_B 3AU 98.06
COG3598402 RepA RecA-family ATPase [DNA replication, recombin 98.05
TIGR0195450 nusA_Cterm_rpt transcription termination factor Nu 97.83
PF0311866 RNA_pol_A_CTD: Bacterial RNA polymerase, alpha cha 97.66
PRK10867 433 signal recognition particle protein; Provisional 97.41
smart00382148 AAA ATPases associated with a variety of cellular 97.37
PRK00771 437 signal recognition particle protein Srp54; Provisi 97.28
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 97.16
PRK10416318 signal recognition particle-docking protein FtsY; 97.14
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 97.03
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 96.9
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 96.89
COG1126240 GlnQ ABC-type polar amino acid transport system, A 96.88
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 96.81
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 96.72
PF00931 287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 96.69
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 96.68
PRK05439311 pantothenate kinase; Provisional 96.66
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 96.63
PRK0775895 hypothetical protein; Provisional 96.62
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 96.6
PRK14974336 cell division protein FtsY; Provisional 96.56
TIGR00064272 ftsY signal recognition particle-docking protein F 96.54
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 96.5
TIGR00959 428 ffh signal recognition particle protein. This mode 96.48
cd01133274 F1-ATPase_beta F1 ATP synthase beta subunit, nucle 96.47
KOG0733|consensus 802 96.44
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 96.44
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 96.42
PRK04296190 thymidine kinase; Provisional 96.41
PRK12766232 50S ribosomal protein L32e; Provisional 96.38
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 96.37
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 96.35
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 96.32
cd03115173 SRP The signal recognition particle (SRP) mediates 96.25
PRK00889175 adenylylsulfate kinase; Provisional 96.24
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 96.21
PF00004132 AAA: ATPase family associated with various cellula 96.2
KOG0744|consensus 423 96.16
COG4107258 PhnK ABC-type phosphonate transport system, ATPase 96.16
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 96.1
PF13173128 AAA_14: AAA domain 96.09
PRK09099 441 type III secretion system ATPase; Provisional 96.07
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 96.07
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 96.06
KOG0734|consensus 752 96.06
PF13479213 AAA_24: AAA domain 96.06
cd01132274 F1_ATPase_alpha F1 ATP synthase alpha, central dom 96.06
PRK09280 463 F0F1 ATP synthase subunit beta; Validated 95.99
PF07088 484 GvpD: GvpD gas vesicle protein; InterPro: IPR00978 95.97
TIGR03305 449 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit 95.96
PRK08903227 DnaA regulatory inactivator Hda; Validated 95.95
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 95.95
PRK08927 442 fliI flagellum-specific ATP synthase; Validated 95.94
PRK05688 451 fliI flagellum-specific ATP synthase; Validated 95.92
PRK06936 439 type III secretion system ATPase; Provisional 95.92
PRK05541176 adenylylsulfate kinase; Provisional 95.86
PRK09183259 transposase/IS protein; Provisional 95.84
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 95.84
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 95.83
PRK08972 444 fliI flagellum-specific ATP synthase; Validated 95.82
TIGR01039 461 atpD ATP synthase, F1 beta subunit. The sequences 95.81
PRK07960 455 fliI flagellum-specific ATP synthase; Validated 95.8
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 95.8
PRK08233182 hypothetical protein; Provisional 95.78
COG1127263 Ttg2A ABC-type transport system involved in resist 95.77
PRK06893229 DNA replication initiation factor; Validated 95.76
PF1324576 AAA_19: Part of AAA domain 95.68
PHA00729226 NTP-binding motif containing protein 95.65
COG1484254 DnaC DNA replication protein [DNA replication, rec 95.56
PTZ00202 550 tuzin; Provisional 95.54
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 95.54
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 95.51
PRK05642234 DNA replication initiation factor; Validated 95.51
COG1117253 PstB ABC-type phosphate transport system, ATPase c 95.5
TIGR01041 458 ATP_syn_B_arch ATP synthase archaeal, B subunit. A 95.45
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 95.44
PRK12597 461 F0F1 ATP synthase subunit beta; Provisional 95.42
COG3638258 ABC-type phosphate/phosphonate transport system, A 95.39
PRK05182310 DNA-directed RNA polymerase subunit alpha; Provisi 95.38
PRK08472 434 fliI flagellum-specific ATP synthase; Validated 95.34
COG3842 352 PotA ABC-type spermidine/putrescine transport syst 95.34
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 95.32
PRK08084235 DNA replication initiation factor; Provisional 95.31
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 95.29
PRK05480209 uridine/cytidine kinase; Provisional 95.28
COG3839 338 MalK ABC-type sugar transport systems, ATPase comp 95.25
PF00005137 ABC_tran: ABC transporter This structure is on hol 95.19
PRK05922 434 type III secretion system ATPase; Validated 95.17
TIGR03496 411 FliI_clade1 flagellar protein export ATPase FliI. 95.13
PRK06762166 hypothetical protein; Provisional 95.13
PF14229122 DUF4332: Domain of unknown function (DUF4332) 95.12
TIGR00962 501 atpA proton translocating ATP synthase, F1 alpha s 95.1
cd01134369 V_A-ATPase_A V/A-type ATP synthase catalytic subun 95.07
TIGR02027297 rpoA DNA-directed RNA polymerase, alpha subunit, b 95.06
PF12846 304 AAA_10: AAA-like domain 95.05
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 95.04
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 95.03
PRK08118167 topology modulation protein; Reviewed 95.01
TIGR00235207 udk uridine kinase. Model contains a number of lon 95.0
PRK06820 440 type III secretion system ATPase; Validated 94.96
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 94.96
PF00006215 ATP-synt_ab: ATP synthase alpha/beta family, nucle 94.96
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 94.95
PRK14973936 DNA topoisomerase I; Provisional 94.94
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 94.93
PF05625363 PAXNEB: PAXNEB protein; InterPro: IPR008728 The RN 94.92
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 94.92
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 94.91
PRK07721 438 fliI flagellum-specific ATP synthase; Validated 94.9
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 94.88
PRK00411 394 cdc6 cell division control protein 6; Reviewed 94.86
TIGR03689 512 pup_AAA proteasome ATPase. In the Actinobacteria, 94.85
PF05729166 NACHT: NACHT domain 94.85
cd01136 326 ATPase_flagellum-secretory_path_III Flagellum-spec 94.85
PRK14973936 DNA topoisomerase I; Provisional 94.84
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 94.83
PRK07165 507 F0F1 ATP synthase subunit alpha; Validated 94.81
KOG0733|consensus802 94.8
CHL00059 485 atpA ATP synthase CF1 alpha subunit 94.79
PRK12402 337 replication factor C small subunit 2; Reviewed 94.79
PRK08149 428 ATP synthase SpaL; Validated 94.79
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 94.79
PRK08181269 transposase; Validated 94.78
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 94.78
TIGR03498 418 FliI_clade3 flagellar protein export ATPase FliI. 94.75
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 94.74
KOG0736|consensus953 94.73
TIGR02546 422 III_secr_ATP type III secretion apparatus H+-trans 94.73
KOG2373|consensus514 94.73
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 94.73
PRK14088 440 dnaA chromosomal replication initiation protein; P 94.73
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 94.72
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 94.71
PRK13343 502 F0F1 ATP synthase subunit alpha; Provisional 94.71
PRK14087 450 dnaA chromosomal replication initiation protein; P 94.71
PRK04196 460 V-type ATP synthase subunit B; Provisional 94.71
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 94.71
PF1355562 AAA_29: P-loop containing region of AAA domain 94.7
COG2255 332 RuvB Holliday junction resolvasome, helicase subun 94.7
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 94.7
cd01135276 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) 94.69
PRK00300205 gmk guanylate kinase; Provisional 94.68
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 94.66
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 94.65
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 94.65
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 94.65
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 94.63
TIGR02640 262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 94.62
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 94.61
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 94.6
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 94.6
CHL00195489 ycf46 Ycf46; Provisional 94.59
TIGR01042 591 V-ATPase_V1_A V-type (H+)-ATPase V1, A subunit. Th 94.58
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 94.58
PRK14527191 adenylate kinase; Provisional 94.56
cd03246173 ABCC_Protease_Secretion This family represents the 94.56
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 94.55
PRK06696223 uridine kinase; Validated 94.55
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 94.54
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 94.54
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 94.53
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 94.53
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 94.53
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 94.52
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 94.52
PF09848 352 DUF2075: Uncharacterized conserved protein (DUF207 94.51
PRK08727233 hypothetical protein; Validated 94.5
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 94.5
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 94.49
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 94.49
COG4619223 ABC-type uncharacterized transport system, ATPase 94.48
PRK07261171 topology modulation protein; Provisional 94.48
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 94.47
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 94.46
PRK12377248 putative replication protein; Provisional 94.46
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 94.45
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 94.45
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 94.42
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 94.41
PTZ00301210 uridine kinase; Provisional 94.4
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 94.4
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 94.4
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 94.4
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 94.39
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 94.38
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 94.38
PRK03846198 adenylylsulfate kinase; Provisional 94.38
COG2256 436 MGS1 ATPase related to the helicase subunit of the 94.36
TIGR01040 466 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit. Th 94.35
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 94.34
smart00763 361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 94.34
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 94.34
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 94.34
cd03216163 ABC_Carb_Monos_I This family represents the domain 94.33
PRK03839180 putative kinase; Provisional 94.32
PRK13768 253 GTPase; Provisional 94.31
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 94.31
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 94.3
PRK06835329 DNA replication protein DnaC; Validated 94.29
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 94.29
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 94.27
PRK04192 586 V-type ATP synthase subunit A; Provisional 94.27
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 94.26
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 94.25
PRK09281 502 F0F1 ATP synthase subunit alpha; Validated 94.25
PRK00131175 aroK shikimate kinase; Reviewed 94.25
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 94.24
TIGR03574 249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 94.24
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 94.24
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 94.24
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 94.24
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 94.23
PRK06526254 transposase; Provisional 94.23
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 94.22
PRK06921266 hypothetical protein; Provisional 94.22
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 94.21
TIGR03238 504 dnd_assoc_3 dnd system-associated protein 3. cereu 94.21
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 94.21
TIGR01026 440 fliI_yscN ATPase FliI/YscN family. This family of 94.2
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 94.2
TIGR00362 405 DnaA chromosomal replication initiator protein Dna 94.19
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 94.19
COG1136226 SalX ABC-type antimicrobial peptide transport syst 94.18
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 94.18
PRK07667193 uridine kinase; Provisional 94.17
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 94.17
PRK02118 436 V-type ATP synthase subunit B; Provisional 94.16
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 94.14
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 94.14
PRK07952244 DNA replication protein DnaC; Validated 94.12
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 94.12
cd01128249 rho_factor Transcription termination factor rho is 94.12
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 94.11
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 94.11
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 94.11
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 94.11
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 94.11
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 94.09
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 94.06
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 94.05
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 94.05
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 94.04
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 94.03
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 94.02
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 94.02
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 94.01
PRK06315 442 type III secretion system ATPase; Provisional 94.0
PRK13650 279 cbiO cobalt transporter ATP-binding subunit; Provi 94.0
cd03215182 ABC_Carb_Monos_II This family represents domain II 94.0
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 94.0
PRK00149 450 dnaA chromosomal replication initiation protein; R 93.98
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 93.98
PRK13646 286 cbiO cobalt transporter ATP-binding subunit; Provi 93.95
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 93.94
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 93.94
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 93.92
cd03269210 ABC_putative_ATPase This subfamily is involved in 93.92
TIGR01043 578 ATP_syn_A_arch ATP synthase archaeal, A subunit. A 93.9
PRK01172674 ski2-like helicase; Provisional 93.9
COG1072283 CoaA Panthothenate kinase [Coenzyme metabolism] 93.9
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 93.9
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 93.89
COG1474 366 CDC6 Cdc6-related protein, AAA superfamily ATPase 93.88
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 93.88
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 93.88
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 93.88
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 93.87
TIGR02928 365 orc1/cdc6 family replication initiation protein. M 93.87
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 93.86
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 93.85
PRK10908222 cell division protein FtsE; Provisional 93.85
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 93.85
PRK06793 432 fliI flagellum-specific ATP synthase; Validated 93.85
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 93.84
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 93.84
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 93.83
PRK12422 445 chromosomal replication initiation protein; Provis 93.82
COG1123539 ATPase components of various ABC-type transport sy 93.81
TIGR03324 497 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit a 93.81
PRK13635 279 cbiO cobalt transporter ATP-binding subunit; Provi 93.8
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 93.78
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 93.78
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 93.77
PRK13649 280 cbiO cobalt transporter ATP-binding subunit; Provi 93.77
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 93.77
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 93.77
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 93.73
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 93.73
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 93.73
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 93.71
PRK03992389 proteasome-activating nucleotidase; Provisional 93.71
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 93.71
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 93.7
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 93.69
cd03299235 ABC_ModC_like Archeal protein closely related to M 93.69
PRK08154309 anaerobic benzoate catabolism transcriptional regu 93.68
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 93.66
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 93.64
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 93.64
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 93.64
CHL00013327 rpoA RNA polymerase alpha subunit 93.6
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 93.6
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 93.6
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 93.59
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 93.59
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 93.58
PRK14531183 adenylate kinase; Provisional 93.57
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 93.57
PRK14530215 adenylate kinase; Provisional 93.56
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 93.55
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 93.55
PRK08116268 hypothetical protein; Validated 93.54
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 93.54
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 93.51
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 93.5
PRK13645 289 cbiO cobalt transporter ATP-binding subunit; Provi 93.49
PLN03210 1153 Resistant to P. syringae 6; Provisional 93.49
PRK13644 274 cbiO cobalt transporter ATP-binding subunit; Provi 93.49
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 93.48
PRK13634 290 cbiO cobalt transporter ATP-binding subunit; Provi 93.47
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 93.46
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 93.46
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 93.46
PLN00020 413 ribulose bisphosphate carboxylase/oxygenase activa 93.45
COG1157 441 FliI Flagellar biosynthesis/type III secretory pat 93.45
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 93.44
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 93.44
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 93.44
PF08433 270 KTI12: Chromatin associated protein KTI12 ; InterP 93.44
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 93.43
PRK14242253 phosphate transporter ATP-binding protein; Provisi 93.42
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 93.41
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 93.4
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 93.4
TIGR00750 300 lao LAO/AO transport system ATPase. Mutations have 93.4
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 93.39
PRK07196 434 fliI flagellum-specific ATP synthase; Validated 93.38
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain 93.38
PRK14240250 phosphate transporter ATP-binding protein; Provisi 93.37
PRK14235267 phosphate transporter ATP-binding protein; Provisi 93.36
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 93.36
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 93.35
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 93.33
PRK09984262 phosphonate/organophosphate ester transporter subu 93.29
PRK07594 433 type III secretion system ATPase SsaN; Validated 93.29
PLN03025 319 replication factor C subunit; Provisional 93.28
TIGR00635 305 ruvB Holliday junction DNA helicase, RuvB subunit. 93.28
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 93.28
PF14229122 DUF4332: Domain of unknown function (DUF4332) 93.27
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 93.25
PRK14241258 phosphate transporter ATP-binding protein; Provisi 93.23
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 93.22
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 93.19
PF02456 369 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR 93.18
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 93.18
PRK13637 287 cbiO cobalt transporter ATP-binding subunit; Provi 93.17
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 93.17
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 93.15
cd03234226 ABCG_White The White subfamily represents ABC tran 93.14
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 93.13
COG0541 451 Ffh Signal recognition particle GTPase [Intracellu 93.1
PRK13643 288 cbiO cobalt transporter ATP-binding subunit; Provi 93.1
PRK10253265 iron-enterobactin transporter ATP-binding protein; 93.1
PRK14238271 phosphate transporter ATP-binding protein; Provisi 93.09
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 93.09
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 93.08
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 93.08
PRK13639 275 cbiO cobalt transporter ATP-binding subunit; Provi 93.06
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 93.06
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 93.05
PRK15093 330 antimicrobial peptide ABC transporter ATP-binding 93.04
PRK13631 320 cbiO cobalt transporter ATP-binding subunit; Provi 93.04
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 93.04
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 93.03
PRK10619257 histidine/lysine/arginine/ornithine transporter su 93.03
PRK06002 450 fliI flagellum-specific ATP synthase; Validated 93.03
PRK15453 290 phosphoribulokinase; Provisional 93.01
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 93.01
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 93.01
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 93.0
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 93.0
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 92.99
PRK14239252 phosphate transporter ATP-binding protein; Provisi 92.98
PRK00080 328 ruvB Holliday junction DNA helicase RuvB; Reviewed 92.98
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 92.98
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 92.97
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 92.96
PF01656195 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domai 92.96
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 92.96
cd02037169 MRP-like MRP (Multiple Resistance and pH adaptatio 92.95
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 92.95
TIGR01188 302 drrA daunorubicin resistance ABC transporter ATP-b 92.92
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 92.91
TIGR03029274 EpsG chain length determinant protein tyrosine kin 92.91
PRK11022 326 dppD dipeptide transporter ATP-binding subunit; Pr 92.9
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 92.9
cd03114148 ArgK-like The function of this protein family is u 92.89
KOG0743|consensus457 92.89
PRK11144 352 modC molybdate transporter ATP-binding protein; Pr 92.88
PHA02624647 large T antigen; Provisional 92.87
KOG1532|consensus 366 92.86
PRK13705 388 plasmid-partitioning protein SopA; Provisional 92.86
TIGR01287 275 nifH nitrogenase iron protein. This model describe 92.85
PRK13652 277 cbiO cobalt transporter ATP-binding subunit; Provi 92.84
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 92.84
PRK09825176 idnK D-gluconate kinase; Provisional 92.84
PRK13641 287 cbiO cobalt transporter ATP-binding subunit; Provi 92.81
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 92.81
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 92.81
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 92.81
PRK12608 380 transcription termination factor Rho; Provisional 92.81
PRK14532188 adenylate kinase; Provisional 92.8
PRK06547172 hypothetical protein; Provisional 92.78
KOG0989|consensus 346 92.77
COG3265161 GntK Gluconate kinase [Carbohydrate transport and 92.77
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 92.77
TIGR03754 643 conj_TOL_TraD conjugative coupling factor TraD, TO 92.76
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 92.76
TIGR01186 363 proV glycine betaine/L-proline transport ATP bindi 92.75
PHA02530 300 pseT polynucleotide kinase; Provisional 92.73
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 92.72
TIGR01288 303 nodI ATP-binding ABC transporter family nodulation 92.72
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 92.72
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 92.71
PRK15079 331 oligopeptide ABC transporter ATP-binding protein O 92.7
cd03271261 ABC_UvrA_II The excision repair protein UvrA domai 92.69
TIGR02142 354 modC_ABC molybdenum ABC transporter, ATP-binding p 92.69
PRK14236272 phosphate transporter ATP-binding protein; Provisi 92.69
PRK14237267 phosphate transporter ATP-binding protein; Provisi 92.69
PRK06217183 hypothetical protein; Validated 92.68
PRK13636 283 cbiO cobalt transporter ATP-binding subunit; Provi 92.68
PRK10536262 hypothetical protein; Provisional 92.67
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 92.67
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.1e-59  Score=455.48  Aligned_cols=254  Identities=50%  Similarity=0.809  Sum_probs=234.8

Q ss_pred             ccccccccccccccccchHHhhCCCCHHHHHHHHhCCCCchHHHhcCCHHHHHHHhCCCHHHHHHHHHHHHhHhccccch
Q psy13674         60 AVEEEDEEDGEEFFQDVDILQNYNINVADIKKLKSVGLCTIKGVQMTTRRKMSQIKGFSEAKVDKIKEACMKICDNSFLT  139 (315)
Q Consensus        60 ~~~~~~~~~~~~~~~~i~~L~~~gl~~~~i~kL~~aGi~Tv~dll~~~~~~L~~~~gis~~~v~ki~~~~~~~~~~~~~t  139 (315)
                      +.++++.+++|++|++|+.|+.+||++.+++||+++||+|++||+.+++++|++++|+|+.+|++|++.+++.++++|.|
T Consensus        15 ~~~~~~~~~~~~~~~~~~~l~~~g~~~~~~~kL~~~g~~tv~~~~~~~~~~L~~~~g~s~~~~~ki~~~a~~~~~~~~~t   94 (344)
T PLN03187         15 LVEAEEVDEEEDLFESIDKLISQGINAGDVKKLQDAGIYTCNGLMMHTKKNLTGIKGLSEAKVDKICEAAEKLLNQGFIT   94 (344)
T ss_pred             hhhhhhhhhhhhcccCHHHHhhCCCCHHHHHHHHHcCCCcHHHHHhCCHHHHHHhcCCCHHHHHHHHHHHHHhhcccCCc
Confidence            44555666677789999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhhcCccceecCChhHHHhhcCCCCcccEEEEecCCCCChhhHHHHHHHHccCCccccCCCCCeEEEEeCCCCCC
Q psy13674        140 AAQVVEKRKQVFKITTGSTELDKILGGGIESMAITEAFGEFRTGKTQLSHTLSITAQLPDETRGYTGGKVIYVDSENTLY  219 (315)
Q Consensus       140 A~ell~~~~~~~~isTG~~~LD~lL~GGl~~g~ItEi~G~~GsGKTqLalqla~~~~lp~~~~gg~~~~vvyIDtE~~F~  219 (315)
                      |.+++++++...+|+||+++||++|+|||++|+||||+|+|||||||||+|+|+++++|.+ .||.+++|+|||||++|+
T Consensus        95 a~~~~~~~~~~~~isTG~~~LD~lLgGGi~~G~ItEI~G~~GsGKTql~lqlav~~qlp~~-~gg~~~~vvyIdTE~tF~  173 (344)
T PLN03187         95 GSDALLKRKSVVRITTGSQALDELLGGGIETRCITEAFGEFRSGKTQLAHTLCVTTQLPTE-MGGGNGKVAYIDTEGTFR  173 (344)
T ss_pred             HHHHHhhhccCceecCCcHhHHhhcCCCCCCCeEEEEecCCCCChhHHHHHHHHHHhcchh-hCCCCceEEEEEcCCCCC
Confidence            9999998888999999999999999999999999999999999999999999999999977 778889999999999999


Q ss_pred             hhhHHHHHHHHHHH----------------------------------------------------------------HH
Q psy13674        220 PLLNIIAIASLVTL----------------------------------------------------------------VG  235 (315)
Q Consensus       220 ~~~Rl~~iaer~~l----------------------------------------------------------------L~  235 (315)
                      |+ ||.++++++++                                                                |.
T Consensus       174 pe-Rl~~ia~~~g~d~~~~l~~I~~~~~~~~e~~~~~l~~l~~~i~~~~~~LvVIDSital~r~~~~~rg~l~~rq~~L~  252 (344)
T PLN03187        174 PD-RIVPIAERFGMDADAVLDNIIYARAYTYEHQYNLLLGLAAKMAEEPFRLLIVDSVIALFRVDFTGRGELAERQQKLA  252 (344)
T ss_pred             HH-HHHHHHHHcCCChhhhcCeEEEecCCCHHHHHHHHHHHHHHHHhcCCCEEEEeCcHHhhhccccCccchHHHHHHHH
Confidence            99 99999987532                                                                45


Q ss_pred             HHHHHHHHHhhcc-cEEEEE-----------ccCCCCcccccccccccccEEEEEEecCCCeEEEEEEECCCCCCeeEEE
Q psy13674        236 SRLPMSFHITRED-LIVFFP-----------LNADPKKPVGGNIMAHASTTRISLRKGRGETRIAKIYDSPDMPEAEAMF  303 (315)
Q Consensus       236 ~~~~~L~~LA~e~-iaVV~~-----------~~~~~~~PalG~~wah~~~tRl~L~k~~g~~R~~~I~KSp~~p~~~~~F  303 (315)
                      ++++.|+++|++| ++||.+           |.+++.+|+||++|+|++++|++|+|.+|+.|+++|+|||++|++++.|
T Consensus       253 ~~~~~L~~lA~~~~vavvvTNqv~~~~~~~~~~~~~~~pagG~~~~h~~~~Rl~l~k~~~~~R~~~v~ksp~lp~~~~~f  332 (344)
T PLN03187        253 QMLSRLTKIAEEFNVAVYMTNQVIADPGGGMFISDPKKPAGGHVLAHAATIRLMLRKGKGEQRVCKVFDAPNLPEAEAEF  332 (344)
T ss_pred             HHHHHHHHHHHHcCCEEEEEecEEEcCCcccccCCCCCCCCchhhheeeeEEEEEEcCCCCeEEEEEEECCCCCCceEEE
Confidence            6778899999999 999853           2245678999999999999999999988999999999999999999999


Q ss_pred             EEeCCCcccCCC
Q psy13674        304 AITNGGIADAKD  315 (315)
Q Consensus       304 ~It~~GI~~~~~  315 (315)
                      .|+++||+|++|
T Consensus       333 ~It~~GI~d~~~  344 (344)
T PLN03187        333 QITSGGIMDAKD  344 (344)
T ss_pred             EEeCCCccCCCC
Confidence            999999999875



>KOG1434|consensus Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>PLN03186 DNA repair protein RAD51 homolog; Provisional Back     alignment and domain information
>TIGR02239 recomb_RAD51 DNA repair protein RAD51 Back     alignment and domain information
>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>KOG1564|consensus Back     alignment and domain information
>KOG1433|consensus Back     alignment and domain information
>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PRK09519 recA DNA recombination protein RecA; Reviewed Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>PRK08760 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK07004 replicative DNA helicase; Provisional Back     alignment and domain information
>PHA02542 41 41 helicase; Provisional Back     alignment and domain information
>PRK05748 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK06321 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK05595 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08506 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK09165 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK05636 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08006 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08840 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK06904 replicative DNA helicase; Validated Back     alignment and domain information
>COG2874 FlaH Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK06749 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>COG0305 DnaB Replicative DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>PRK07773 replicative DNA helicase; Validated Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>KOG2859|consensus Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PF14520 HHH_5: Helix-hairpin-helix domain; PDB: 3AUO_B 3AU6_A 3AU2_A 3B0X_A 3B0Y_A 1SZP_C 3LDA_A 1WCN_A 2JZB_B 2ZTC_A Back     alignment and domain information
>COG3598 RepA RecA-family ATPase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01954 nusA_Cterm_rpt transcription termination factor NusA, C-terminal duplication Back     alignment and domain information
>PF03118 RNA_pol_A_CTD: Bacterial RNA polymerase, alpha chain C terminal domain; InterPro: IPR011260 The core of the bacterial RNA polymerase (RNAP) consists of four subunits, two alpha, a beta and a beta', which are conserved from bacteria to mammals Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK07758 hypothetical protein; Provisional Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK12766 50S ribosomal protein L32e; Provisional Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>KOG0744|consensus Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK09099 type III secretion system ATPase; Provisional Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0734|consensus Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain Back     alignment and domain information
>PRK09280 F0F1 ATP synthase subunit beta; Validated Back     alignment and domain information
>PF07088 GvpD: GvpD gas vesicle protein; InterPro: IPR009788 This family consists of several archaeal GvpD gas vesicle proteins Back     alignment and domain information
>TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK08927 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK05688 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK06936 type III secretion system ATPase; Provisional Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK08972 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR01039 atpD ATP synthase, F1 beta subunit Back     alignment and domain information
>PRK07960 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01041 ATP_syn_B_arch ATP synthase archaeal, B subunit Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK12597 F0F1 ATP synthase subunit beta; Provisional Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK05182 DNA-directed RNA polymerase subunit alpha; Provisional Back     alignment and domain information
>PRK08472 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PRK05922 type III secretion system ATPase; Validated Back     alignment and domain information
>TIGR03496 FliI_clade1 flagellar protein export ATPase FliI Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PF14229 DUF4332: Domain of unknown function (DUF4332) Back     alignment and domain information
>TIGR00962 atpA proton translocating ATP synthase, F1 alpha subunit Back     alignment and domain information
>cd01134 V_A-ATPase_A V/A-type ATP synthase catalytic subunit A Back     alignment and domain information
>TIGR02027 rpoA DNA-directed RNA polymerase, alpha subunit, bacterial and chloroplast-type Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PRK06820 type III secretion system ATPase; Validated Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK14973 DNA topoisomerase I; Provisional Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PF05625 PAXNEB: PAXNEB protein; InterPro: IPR008728 The RNA polymerase II elongator complex is a major histone acetyltransferase component of the RNA polymerase II (RNAPII) holoenzyme and is involved in transcriptional elongation [, ] Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PRK07721 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein Back     alignment and domain information
>PRK14973 DNA topoisomerase I; Provisional Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>PRK07165 F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>CHL00059 atpA ATP synthase CF1 alpha subunit Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK08149 ATP synthase SpaL; Validated Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>TIGR03498 FliI_clade3 flagellar protein export ATPase FliI Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>KOG0736|consensus Back     alignment and domain information
>TIGR02546 III_secr_ATP type III secretion apparatus H+-transporting two-sector ATPase Back     alignment and domain information
>KOG2373|consensus Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK13343 F0F1 ATP synthase subunit alpha; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK04196 V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>TIGR01042 V-ATPase_V1_A V-type (H+)-ATPase V1, A subunit Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01040 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>PRK04192 V-type ATP synthase subunit A; Provisional Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>PRK09281 F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3 Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>TIGR01026 fliI_yscN ATPase FliI/YscN family Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>PRK02118 V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>PRK06315 type III secretion system ATPase; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>TIGR01043 ATP_syn_A_arch ATP synthase archaeal, A subunit Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>COG1072 CoaA Panthothenate kinase [Coenzyme metabolism] Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>PRK06793 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>TIGR03324 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit alpha Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>CHL00013 rpoA RNA polymerase alpha subunit Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>COG1157 FliI Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK07196 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PRK07594 type III secretion system ATPase SsaN; Validated Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PF14229 DUF4332: Domain of unknown function (DUF4332) Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF02456 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR003389 Va2 protein can interact with the adenoviral packaging signal and this interaction involves DNA sequences that have previously been demonstrated to be required for packaging [] Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK06002 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>PF01656 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domain; InterPro: IPR002586 This entry consists of various cobyrinic acid a,c-diamide synthases Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03029 EpsG chain length determinant protein tyrosine kinase EpsG Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>KOG0743|consensus Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>KOG1532|consensus Back     alignment and domain information
>PRK13705 plasmid-partitioning protein SopA; Provisional Back     alignment and domain information
>TIGR01287 nifH nitrogenase iron protein Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>COG3265 GntK Gluconate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>TIGR03754 conj_TOL_TraD conjugative coupling factor TraD, TOL family Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query315
2zjb_A343 Crystal Structure Of The Human Dmc1-M200v Polymorph 3e-58
2zjb_A343 Crystal Structure Of The Human Dmc1-M200v Polymorph 3e-24
1v5w_A343 Crystal Structure Of The Human Dmc1 Protein Length 3e-58
1v5w_A343 Crystal Structure Of The Human Dmc1 Protein Length 3e-24
3lda_A400 Yeast Rad51 H352y Filament Interface Mutant Length 2e-31
3lda_A400 Yeast Rad51 H352y Filament Interface Mutant Length 4e-16
1szp_A321 A Crystal Structure Of The Rad51 Filament Length = 6e-31
1szp_A321 A Crystal Structure Of The Rad51 Filament Length = 2e-16
1pzn_A349 Rad51 (Rada) Length = 349 1e-25
1pzn_A349 Rad51 (Rada) Length = 349 1e-14
1n0w_A243 Crystal Structure Of A Rad51-Brca2 Brc Repeat Compl 2e-22
2dfl_A324 Crystal Structure Of Left-Handed Rada Filament Leng 2e-19
2dfl_A324 Crystal Structure Of Left-Handed Rada Filament Leng 1e-10
2bke_A324 Conformational Flexibility Revealed By The Crystal 2e-19
2bke_A324 Conformational Flexibility Revealed By The Crystal 1e-10
4a6p_A231 Rada C-Terminal Atpase Domain From Pyrococcus Furio 1e-18
4a6p_A231 Rada C-Terminal Atpase Domain From Pyrococcus Furio 2e-11
4b2i_A231 Humanised Monomeric Rada In Complex With Indazole L 3e-18
4b2i_A231 Humanised Monomeric Rada In Complex With Indazole L 2e-11
1t4g_A322 Atpase In Complex With Amp-pnp Length = 322 2e-15
1t4g_A322 Atpase In Complex With Amp-pnp Length = 322 2e-12
3ntu_A319 Rada Recombinase D302k Mutant In Complex With Amp-P 3e-15
3ntu_A319 Rada Recombinase D302k Mutant In Complex With Amp-P 2e-11
2f1h_A322 Recombinase In Complex With Amp-pnp And Potassium L 6e-15
2f1h_A322 Recombinase In Complex With Amp-pnp And Potassium L 2e-12
3etl_A322 Rada Recombinase From Methanococcus Maripaludis In 1e-14
3etl_A322 Rada Recombinase From Methanococcus Maripaludis In 2e-11
1b22_A114 Rad51 (N-Terminal Domain) Length = 114 3e-13
2gdj_A264 Delta-62 Rada Recombinase In Complex With Amp-Pnp A 1e-12
4dc9_A266 Hexameric Ring Of Methanococcus Voltae Rada Length 1e-12
2cvf_A220 Crystal Structure Of The Radb Recombinase Length = 3e-04
>pdb|2ZJB|A Chain A, Crystal Structure Of The Human Dmc1-M200v Polymorphic Variant Length = 343 Back     alignment and structure

Iteration: 1

Score = 221 bits (564), Expect = 3e-58, Method: Compositional matrix adjust. Identities = 106/149 (71%), Positives = 122/149 (81%), Gaps = 1/149 (0%) Query: 72 FFQDVDILQNYNINVADIKKLKSVGLCTIKGVQMTTRRKMSQIKGFSEAKVDKIKEACMK 131 FQD+D+LQ + INVADIKKLKSVG+CTIKG+QMTTRR + +KG SEAKVDKIKEA K Sbjct: 23 LFQDIDLLQKHGINVADIKKLKSVGICTIKGIQMTTRRALCNVKGLSEAKVDKIKEAANK 82 Query: 132 ICDNSFLTAAQVVEKRKQVFKITTGSTELDKILGGGIESMAITEAFGEFRTGKTQLSHTL 191 + + FLTA + EKRK VF ITTGS E DK+LGGGIESMAITEAFGEFRTGKTQLSHTL Sbjct: 83 LIEPGFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTL 142 Query: 192 SITAQLPDETRGYTGGKVIYVDSENTLYP 220 +TAQLP GY GGK+I++D+ENT P Sbjct: 143 CVTAQLPG-AGGYPGGKIIFIDTENTFRP 170
>pdb|2ZJB|A Chain A, Crystal Structure Of The Human Dmc1-M200v Polymorphic Variant Length = 343 Back     alignment and structure
>pdb|1V5W|A Chain A, Crystal Structure Of The Human Dmc1 Protein Length = 343 Back     alignment and structure
>pdb|1V5W|A Chain A, Crystal Structure Of The Human Dmc1 Protein Length = 343 Back     alignment and structure
>pdb|3LDA|A Chain A, Yeast Rad51 H352y Filament Interface Mutant Length = 400 Back     alignment and structure
>pdb|3LDA|A Chain A, Yeast Rad51 H352y Filament Interface Mutant Length = 400 Back     alignment and structure
>pdb|1SZP|A Chain A, A Crystal Structure Of The Rad51 Filament Length = 321 Back     alignment and structure
>pdb|1SZP|A Chain A, A Crystal Structure Of The Rad51 Filament Length = 321 Back     alignment and structure
>pdb|1PZN|A Chain A, Rad51 (Rada) Length = 349 Back     alignment and structure
>pdb|1PZN|A Chain A, Rad51 (Rada) Length = 349 Back     alignment and structure
>pdb|1N0W|A Chain A, Crystal Structure Of A Rad51-Brca2 Brc Repeat Complex Length = 243 Back     alignment and structure
>pdb|2DFL|A Chain A, Crystal Structure Of Left-Handed Rada Filament Length = 324 Back     alignment and structure
>pdb|2DFL|A Chain A, Crystal Structure Of Left-Handed Rada Filament Length = 324 Back     alignment and structure
>pdb|2BKE|A Chain A, Conformational Flexibility Revealed By The Crystal Structure Of A Crenarchaeal Rada Length = 324 Back     alignment and structure
>pdb|2BKE|A Chain A, Conformational Flexibility Revealed By The Crystal Structure Of A Crenarchaeal Rada Length = 324 Back     alignment and structure
>pdb|4A6P|A Chain A, Rada C-Terminal Atpase Domain From Pyrococcus Furiosus Length = 231 Back     alignment and structure
>pdb|4A6P|A Chain A, Rada C-Terminal Atpase Domain From Pyrococcus Furiosus Length = 231 Back     alignment and structure
>pdb|4B2I|A Chain A, Humanised Monomeric Rada In Complex With Indazole Length = 231 Back     alignment and structure
>pdb|4B2I|A Chain A, Humanised Monomeric Rada In Complex With Indazole Length = 231 Back     alignment and structure
>pdb|1T4G|A Chain A, Atpase In Complex With Amp-pnp Length = 322 Back     alignment and structure
>pdb|1T4G|A Chain A, Atpase In Complex With Amp-pnp Length = 322 Back     alignment and structure
>pdb|3NTU|A Chain A, Rada Recombinase D302k Mutant In Complex With Amp-Pnp Length = 319 Back     alignment and structure
>pdb|3NTU|A Chain A, Rada Recombinase D302k Mutant In Complex With Amp-Pnp Length = 319 Back     alignment and structure
>pdb|2F1H|A Chain A, Recombinase In Complex With Amp-pnp And Potassium Length = 322 Back     alignment and structure
>pdb|2F1H|A Chain A, Recombinase In Complex With Amp-pnp And Potassium Length = 322 Back     alignment and structure
>pdb|3ETL|A Chain A, Rada Recombinase From Methanococcus Maripaludis In Complex With Amppnp Length = 322 Back     alignment and structure
>pdb|3ETL|A Chain A, Rada Recombinase From Methanococcus Maripaludis In Complex With Amppnp Length = 322 Back     alignment and structure
>pdb|1B22|A Chain A, Rad51 (N-Terminal Domain) Length = 114 Back     alignment and structure
>pdb|2GDJ|A Chain A, Delta-62 Rada Recombinase In Complex With Amp-Pnp And Magnesium Length = 264 Back     alignment and structure
>pdb|4DC9|A Chain A, Hexameric Ring Of Methanococcus Voltae Rada Length = 266 Back     alignment and structure
>pdb|2CVF|A Chain A, Crystal Structure Of The Radb Recombinase Length = 220 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query315
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 6e-55
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 9e-27
2z43_A324 DNA repair and recombination protein RADA; archaea 6e-55
2z43_A324 DNA repair and recombination protein RADA; archaea 7e-26
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 3e-54
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 5e-20
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 6e-49
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 2e-18
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 7e-43
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 7e-18
1b22_A114 DNA repair protein RAD51; DNA binding, riken struc 4e-32
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 7e-26
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 5e-25
2cvh_A220 DNA repair and recombination protein RADB; filamen 9e-23
2cvh_A220 DNA repair and recombination protein RADB; filamen 7e-20
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Length = 343 Back     alignment and structure
 Score =  181 bits (460), Expect = 6e-55
 Identities = 112/202 (55%), Positives = 140/202 (69%), Gaps = 9/202 (4%)

Query: 57  RTAAVEEEDEEDGEEFFQDVDILQNYNINVADIKKLKSVGLCTIKGVQMTTRRKMSQIKG 116
           +  A E   +++ E  FQD+D+LQ + INVADIKKLKSVG+CTIKG+QMTTRR +  +KG
Sbjct: 8   QVVAEEPGFQDEEESLFQDIDLLQKHGINVADIKKLKSVGICTIKGIQMTTRRALCNVKG 67

Query: 117 FSEAKVDKIKEACMKICDNSFLTAAQVVEKRKQVFKITTGSTELDKILGGGIESMAITEA 176
            SEAKVDKIKEA  K+ +  FLTA +  EKRK VF ITTGS E DK+LGGGIESMAITEA
Sbjct: 68  LSEAKVDKIKEAANKLIEPGFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEA 127

Query: 177 FGEFRTGKTQLSHTLSITAQLPDETRGYTGGKVIYVDSENTLYPLLNIIAIASLVTLVGS 236
           FGEFRTGKTQLSHTL +TAQLP    GY GGK+I++D+ENT  P   +  IA        
Sbjct: 128 FGEFRTGKTQLSHTLCVTAQLPGA-GGYPGGKIIFIDTENTFRPDR-LRDIA-------D 178

Query: 237 RLPMSFHITREDLIVFFPLNAD 258
           R  +      ++++      ++
Sbjct: 179 RFNVDHDAVLDNVLYARAYTSE 200


>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Length = 343 Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Length = 324 Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Length = 324 Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Length = 400 Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Length = 400 Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Length = 349 Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Length = 349 Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Length = 322 Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Length = 322 Back     alignment and structure
>1b22_A DNA repair protein RAD51; DNA binding, riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.60.4.1 Length = 114 Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Length = 243 Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Length = 243 Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Length = 220 Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Length = 220 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query315
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 100.0
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 100.0
2z43_A324 DNA repair and recombination protein RADA; archaea 100.0
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 100.0
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 100.0
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 99.94
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 99.91
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 99.91
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 99.9
4a74_A231 DNA repair and recombination protein RADA; hydrola 99.89
2cvh_A220 DNA repair and recombination protein RADB; filamen 99.89
3io5_A333 Recombination and repair protein; storage dimer, i 99.88
1u94_A356 RECA protein, recombinase A; homologous recombinat 99.87
1xp8_A366 RECA protein, recombinase A; recombination, radior 99.86
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 99.85
1b22_A114 DNA repair protein RAD51; DNA binding, riken struc 99.84
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 99.8
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 99.78
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 99.77
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 99.76
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 99.62
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 99.62
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 99.61
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 99.61
2r6a_A454 DNAB helicase, replicative helicase; replication, 99.53
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 99.52
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 99.5
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 99.49
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 99.42
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 99.42
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 99.35
3bs4_A 260 Uncharacterized protein PH0321; structural genomic 99.25
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 99.04
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 98.93
2kz3_A83 Putative uncharacterized protein RAD51L3; RAD51D, 98.85
1wcn_A70 Transcription elongation protein NUSA; RNA-binding 98.66
1u9l_A70 Transcription elongation protein NUSA; escherichia 98.57
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 97.47
3gfk_B79 DNA-directed RNA polymerase subunit alpha; protein 97.46
1z3e_B73 DNA-directed RNA polymerase alpha chain; bacterial 97.46
3k4g_A86 DNA-directed RNA polymerase subunit alpha; bacteri 97.45
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 97.16
1coo_A98 RNA polymerase alpha subunit; transcription regula 97.14
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 96.94
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 96.82
4a8j_A 361 Elongator complex protein 4; transcription; 2.10A 96.75
1vma_A306 Cell division protein FTSY; TM0570, structural gen 96.71
3bos_A242 Putative DNA replication factor; P-loop containing 96.58
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 96.57
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 96.51
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 96.43
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 96.4
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 96.37
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 96.31
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 96.28
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 96.26
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 96.22
2og2_A359 Putative signal recognition particle receptor; nuc 96.22
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 96.09
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 96.07
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 96.04
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 96.0
2chg_A226 Replication factor C small subunit; DNA-binding pr 95.98
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 95.94
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 95.92
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 95.92
1gvn_B 287 Zeta; postsegregational killing system, plasmid; 1 95.9
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 95.86
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 95.83
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 95.83
2kjq_A149 DNAA-related protein; solution structure, NESG, st 95.81
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 95.78
1tue_A212 Replication protein E1; helicase, replication, E1E 95.7
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 95.67
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 95.61
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 95.6
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 95.59
2xxa_A 433 Signal recognition particle protein; protein trans 95.54
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 95.5
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 95.44
2dpy_A 438 FLII, flagellum-specific ATP synthase; beta barrel 95.44
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 95.43
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 95.43
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 95.41
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 95.39
3ice_A 422 Transcription termination factor RHO; transcriptio 95.38
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 95.37
2ffh_A 425 Protein (FFH); SRP54, signal recognition particle, 95.37
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 95.36
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 95.36
2obl_A 347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 95.35
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 95.34
1sxj_B 323 Activator 1 37 kDa subunit; clamp loader, processi 95.29
1sky_E 473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 95.29
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 95.18
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 95.12
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 95.11
3vaa_A199 Shikimate kinase, SK; structural genomics, center 95.1
2qe7_A 502 ATP synthase subunit alpha; blockage of ATP hydrol 95.05
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 95.04
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 95.0
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 94.97
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 94.93
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 94.93
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 94.92
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 94.91
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 94.91
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 94.91
3oaa_A 513 ATP synthase subunit alpha; rossmann fold, hydrola 94.89
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 94.88
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 94.88
2ck3_A 510 ATP synthase subunit alpha\, mitochondrial; hydrol 94.87
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 94.87
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 94.86
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 94.84
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 94.8
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 94.78
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 94.77
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 94.76
3gqb_B 464 V-type ATP synthase beta chain; A3B3, V-ATPase, AT 94.75
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 94.75
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 94.74
4fcw_A 311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 94.73
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 94.7
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 94.68
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 94.64
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 94.58
1kag_A173 SKI, shikimate kinase I; transferase, structural g 94.57
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 94.56
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 94.54
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 94.53
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 94.51
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 94.5
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 94.5
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 94.5
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 94.5
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 94.49
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 94.46
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 94.43
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 94.42
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 94.42
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 94.39
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 94.38
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 94.38
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 94.35
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 94.33
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 94.33
2ck3_D 482 ATP synthase subunit beta\, mitochondrial; hydrola 94.32
1fx0_B 498 ATP synthase beta chain; latent ATPase, thermal st 94.28
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 94.25
1vq8_Y241 50S ribosomal protein L32E; ribosome 50S, protein- 94.24
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 94.23
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 94.22
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 94.22
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 94.21
2eyu_A261 Twitching motility protein PILT; pilus retraction 94.21
1g6h_A257 High-affinity branched-chain amino acid transport 94.19
2r62_A268 Cell division protease FTSH homolog; ATPase domain 94.17
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 94.16
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 94.15
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 94.15
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 94.14
2r9v_A 515 ATP synthase subunit alpha; TM1612, structural gen 94.14
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 94.12
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 94.1
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 94.09
2fna_A 357 Conserved hypothetical protein; structural genomic 94.09
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 94.08
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 94.08
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 94.06
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 94.06
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 94.05
1ofh_A 310 ATP-dependent HSL protease ATP-binding subunit HSL 94.0
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 93.99
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 93.99
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 93.97
2vli_A183 Antibiotic resistance protein; transferase, tunica 93.96
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 93.94
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 93.93
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 93.91
1b0u_A262 Histidine permease; ABC transporter, transport pro 93.9
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 93.89
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 93.89
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 93.87
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 93.87
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 93.87
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 93.85
1ji0_A240 ABC transporter; ATP binding protein, structural g 93.83
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 93.83
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 93.82
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 93.82
2c61_A 469 A-type ATP synthase non-catalytic subunit B; hydro 93.81
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 93.81
2qgz_A308 Helicase loader, putative primosome component; str 93.8
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 93.75
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 93.74
2qen_A 350 Walker-type ATPase; unknown function; HET: ADP; 2. 93.73
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 93.73
3end_A 307 Light-independent protochlorophyllide reductase ir 93.7
3u61_B 324 DNA polymerase accessory protein 44; AAA+, ATP hyd 93.66
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 93.66
3vr4_A 600 V-type sodium ATPase catalytic subunit A; V-ATPase 93.64
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 93.62
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 93.6
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 93.59
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 93.59
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 93.57
2ghi_A260 Transport protein; multidrug resistance protein, M 93.57
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 93.57
2ze6_A 253 Isopentenyl transferase; crown GALL tumor, cytokin 93.55
3l0o_A 427 Transcription termination factor RHO; helicase, RH 93.55
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 93.55
4ag6_A 392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 93.54
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 93.53
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 93.53
1sgw_A214 Putative ABC transporter; structural genomics, P p 93.49
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 93.48
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 93.48
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 93.46
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 93.46
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 93.42
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 93.41
1fx0_A 507 ATP synthase alpha chain; latent ATPase, thermal s 93.4
3co5_A143 Putative two-component system transcriptional RES 93.39
2gno_A 305 DNA polymerase III, gamma subunit-related protein; 93.38
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 93.37
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 93.35
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 93.26
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 93.25
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 93.24
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 93.23
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 93.23
3vr4_D 465 V-type sodium ATPase subunit D; V-ATPase, rotary m 93.18
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 93.16
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 93.15
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 93.08
2a5y_B 549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 93.06
3gqb_A 578 V-type ATP synthase alpha chain; A3B3, V-ATPase, A 93.04
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 93.01
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 92.99
3a4m_A 260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 92.97
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 92.97
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 92.94
1ihu_A 589 Arsenical pump-driving ATPase; aluminum fluoride, 92.93
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 92.93
3lu0_A329 DNA-directed RNA polymerase subunit alpha; E. coli 92.93
3mfy_A 588 V-type ATP synthase alpha chain; A-type ATP syntha 92.91
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 92.9
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 92.87
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 92.84
1via_A175 Shikimate kinase; structural genomics, transferase 92.8
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 92.8
3la6_A286 Tyrosine-protein kinase WZC; P-loop protein, nucle 92.77
1yrb_A 262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 92.73
2chq_A 319 Replication factor C small subunit; DNA-binding pr 92.72
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 92.69
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 92.69
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 92.69
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 92.62
3eiq_A 414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 92.61
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 92.58
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 92.57
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 92.56
2woj_A 354 ATPase GET3; tail-anchored, membrane protein, targ 92.55
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 92.5
3ez9_A 403 Para; DNA binding, winged-HTH, partition, biosynth 92.5
3im1_A328 Protein SNU246, PRE-mRNA-splicing helicase BRR2; A 92.48
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 92.47
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 92.45
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 92.45
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 92.44
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 92.44
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 92.42
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 92.42
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 92.39
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 92.34
2r44_A 331 Uncharacterized protein; putative ATPase, structur 92.28
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 92.28
3kta_A182 Chromosome segregation protein SMC; structural mai 92.25
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 92.24
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 92.23
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 92.21
3tlx_A243 Adenylate kinase 2; structural genomics, structura 92.21
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 92.15
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 92.15
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 92.11
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 92.11
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 92.11
2a1j_A63 DNA repair endonuclease XPF; XPF, xeroderma pigmen 92.1
1cp2_A 269 CP2, nitrogenase iron protein; oxidoreductase; 1.9 92.08
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 92.07
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 92.06
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 92.02
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 91.98
3iqw_A 334 Tail-anchored protein targeting factor GET3; ATPas 91.97
2ewv_A372 Twitching motility protein PILT; pilus retraction 91.96
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 91.95
1ojl_A 304 Transcriptional regulatory protein ZRAR; response 91.95
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 91.91
3ez2_A 398 Plasmid partition protein A; type IA, DNA binding, 91.85
3ea0_A 245 ATPase, para family; alpha-beta-alpha sandwich, st 91.79
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 91.75
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 91.71
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 91.7
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 91.69
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 91.68
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 91.67
3kjh_A 254 CO dehydrogenase/acetyl-COA synthase complex, acce 91.64
1a5t_A 334 Delta prime, HOLB; zinc finger, DNA replication; 2 91.61
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 91.61
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 91.61
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 91.59
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 91.57
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 91.54
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 91.54
1odf_A 290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 91.53
1a7j_A 290 Phosphoribulokinase; transferase, calvin cycle; 2. 91.49
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 91.47
3bor_A237 Human initiation factor 4A-II; translation initiat 91.38
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 91.37
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 91.35
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 91.35
3io3_A 348 DEHA2D07832P; chaperone, membrane traffic, ATPase; 91.35
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 91.33
3zq6_A 324 Putative arsenical pump-driving ATPase; tail-ancho 91.32
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 91.32
1p9r_A 418 General secretion pathway protein E; bacterial typ 91.28
2woo_A 329 ATPase GET3; tail-anchored, membrane protein, targ 91.25
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 91.25
1hyq_A 263 MIND, cell division inhibitor (MIND-1); MINC, FTSZ 91.23
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 91.2
3p32_A 355 Probable GTPase RV1496/MT1543; structural genomics 91.18
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 91.09
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 91.05
1ltq_A 301 Polynucleotide kinase; phosphatase, alpha/beta, P- 91.02
1g3q_A237 MIND ATPase, cell division inhibitor; alpha-beta-a 91.0
3bfv_A271 CAPA1, CAPB2, membrane protein CAPA1, protein tyro 90.93
3ug7_A 349 Arsenical pump-driving ATPase; tail-anchored, memb 90.87
2afh_E 289 Nitrogenase iron protein 1; nitrogen fixation, iro 90.86
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 90.85
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 90.85
1ihu_A 589 Arsenical pump-driving ATPase; aluminum fluoride, 90.84
2q0z_X339 Protein Pro2281; SEC63, SEC, NESG, HR1979, structu 90.81
1xjc_A169 MOBB protein homolog; structural genomics, midwest 90.8
2a6h_A315 DNA-directed RNA polymerase alpha chain; RNA polym 90.8
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 90.77
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 90.76
3pvs_A 447 Replication-associated recombination protein A; ma 90.75
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 90.7
3cio_A299 ETK, tyrosine-protein kinase ETK; WZC, escherichia 90.64
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 90.53
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 90.52
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 90.49
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 90.44
3a8t_A 339 Adenylate isopentenyltransferase; rossmann fold pr 90.34
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 90.31
3crm_A 323 TRNA delta(2)-isopentenylpyrophosphate transferase 90.29
2npi_A 460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 90.28
2ph1_A 262 Nucleotide-binding protein; alpha-beta protein, st 90.21
3fmp_B 479 ATP-dependent RNA helicase DDX19B; nuclear porin, 90.11
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 89.98
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 89.83
3q9l_A 260 Septum site-determining protein MIND; ATPase, bact 89.81
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 89.76
3cwq_A209 Para family chromosome partitioning protein; alpha 89.73
2oap_1 511 GSPE-2, type II secretion system protein; hexameri 89.66
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 89.65
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 89.63
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 89.61
4dez_A356 POL IV 1, DNA polymerase IV 1; Y-family, transfera 89.6
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 89.59
3d3q_A 340 TRNA delta(2)-isopentenylpyrophosphate transferase 89.5
2qm8_A 337 GTPase/ATPase; G protein, G3E, metallochaperone, c 89.48
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 89.48
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 89.38
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 89.37
1z00_A89 DNA excision repair protein ERCC-1; helix-hairpin- 89.36
3r20_A233 Cytidylate kinase; structural genomics, seattle st 89.31
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 89.22
3fkq_A373 NTRC-like two-domain protein; RER070207001320, str 89.15
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 89.11
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 89.08
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 89.08
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 89.06
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 88.95
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 88.84
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 88.8
2p67_A 341 LAO/AO transport system kinase; ARGK, structural G 88.71
3exa_A 322 TRNA delta(2)-isopentenylpyrophosphate transferase 88.71
3k9g_A 267 PF-32 protein; ssgcid, SBRI, decode biostructures, 88.67
3foz_A 316 TRNA delta(2)-isopentenylpyrophosphate transferas; 88.65
1e9r_A 437 Conjugal transfer protein TRWB; coupling protein, 88.62
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfuryl 88.49
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 88.48
2oze_A 298 ORF delta'; para, walker type atpases, DNA segrega 88.47
3bq0_A354 POL IV, DBH, DNA polymerase IV; Y-family, lesion b 88.45
1jx4_A352 DNA polymerase IV (family Y); protein-DNA complex, 88.44
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 88.34
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 88.31
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 88.3
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 88.27
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 88.26
3pxg_A 468 Negative regulator of genetic competence CLPC/MEC; 88.17
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 88.12
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 88.08
2a1j_B91 DNA excision repair protein ERCC-1; XPF, xeroderma 87.89
1z00_B84 DNA repair endonuclease XPF; helix-hairpin-helix, 87.8
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 87.7
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 87.34
1byi_A224 Dethiobiotin synthase; biotin synthesis, cyclo-lig 87.3
2va8_A715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 87.16
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 87.11
3q5d_A 447 Atlastin-1; G protein, GTPase, GDP/GTP binding, hy 87.11
1wcv_1 257 SOJ, segregation protein; ATPase, bacterial, chrom 87.09
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 87.06
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 86.96
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 86.92
2xj4_A 286 MIPZ; replication, cell division, ATPase, WACA; 1. 86.79
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 86.78
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 86.63
1oft_A161 SULA, hypothetical protein PA3008; bacterial cell 86.62
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 86.59
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 86.58
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 86.57
2hf9_A226 Probable hydrogenase nickel incorporation protein 86.57
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 86.54
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 86.5
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 86.49
1kft_A78 UVRC, excinuclease ABC subunit C; helix-hairpin-he 86.48
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 86.41
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 86.36
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 86.34
1x2i_A75 HEF helicase/nuclease; alpha helix, helix-hairpin- 86.33
3gqc_A504 DNA repair protein REV1; protein-DNA complex, DNA 86.29
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 86.27
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 86.21
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 86.17
3eph_A 409 TRNA isopentenyltransferase; transferase, alternat 86.15
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 86.14
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 86.07
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 86.06
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 86.0
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 86.0
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 86.0
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 85.96
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 85.89
2wji_A165 Ferrous iron transport protein B homolog; membrane 85.85
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 85.81
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 85.64
3f9v_A 595 Minichromosome maintenance protein MCM; replicativ 85.63
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 85.62
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 85.46
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 85.42
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 85.42
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 85.34
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 85.3
1y88_A199 Hypothetical protein AF1548; APC5567, structural g 85.27
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 85.18
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 85.09
1nij_A 318 Hypothetical protein YJIA; structural genomics, P- 84.95
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 84.9
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 84.89
3pg5_A 361 Uncharacterized protein; structural genomics, PSI- 84.87
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 84.86
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 84.81
1e69_A 322 Chromosome segregation SMC protein; structural mai 84.79
4f4y_A362 POL IV, DNA polymerase IV; Y-family polymerase, tr 84.69
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 84.63
2ged_A193 SR-beta, signal recognition particle receptor beta 84.63
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 84.6
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 84.51
2ga8_A 359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 84.49
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 84.48
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 84.44
1nrj_B218 SR-beta, signal recognition particle receptor beta 84.42
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 84.42
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 84.37
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 84.35
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 84.33
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 84.24
3fwy_A 314 Light-independent protochlorophyllide reductase I 84.23
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 84.03
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 84.02
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 84.0
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 83.99
3sop_A 270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 83.99
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 83.94
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 83.85
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 83.81
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 83.75
3bqs_A93 Uncharacterized protein; 10114F, NYSGXRC, PSI-2, s 83.75
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 83.71
1im4_A221 DBH; DNA polymerase PALM, thumb, fingers, helix-ha 83.67
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 83.6
1w1w_A 430 Structural maintenance of chromosome 1; cohesin, c 83.59
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 83.57
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 83.29
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 83.29
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 83.28
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 83.24
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
Probab=100.00  E-value=1.1e-48  Score=383.91  Aligned_cols=248  Identities=42%  Similarity=0.692  Sum_probs=216.0

Q ss_pred             ccccccccccchHHhhCCCCHHHHHHHHhCCCCchHHHhcCCHHHHHHHhCCCHHHHHHHHHHHHhHhccccchHHHHHH
Q psy13674         66 EEDGEEFFQDVDILQNYNINVADIKKLKSVGLCTIKGVQMTTRRKMSQIKGFSEAKVDKIKEACMKICDNSFLTAAQVVE  145 (315)
Q Consensus        66 ~~~~~~~~~~i~~L~~~gl~~~~i~kL~~aGi~Tv~dll~~~~~~L~~~~gis~~~v~ki~~~~~~~~~~~~~tA~ell~  145 (315)
                      ++|++.+|+||+.|+.+||++.+++||++|||+|+++|+.+++++|++++|+|+.+|+++++++++.++.+|.||.++++
T Consensus        73 ~~~~~~~~~~~~~l~~~gi~~~~~~~L~~ag~~tv~~~~~~~~~~L~~~~gis~~~~~~i~~~a~~~~~~~~~ta~~l~~  152 (400)
T 3lda_A           73 DEAALGSFVPIEKLQVNGITMADVKKLRESGLHTAEAVAYAPRKDLLEIKGISEAKADKLLNEAARLVPMGFVTAADFHM  152 (400)
T ss_dssp             -----CCSCBGGGGCCTTCCHHHHHHHHHTTCCBHHHHHHSCHHHHHTSTTCCHHHHHHHHHHHHHHSCCSCCCHHHHHH
T ss_pred             ccccccCccCHHHHHhCCCCHHHHHHHHHcCCCcHHHHHhCCHHHHHHHhCCCHHHHHHHHHHHHHhccccCCCHHHHHh
Confidence            66667789999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhcCccceecCChhHHHhhcCCCCcccEEEEecCCCCChhhHHHHHHHHccCCccccCCCCCeEEEEeCCCCCChhhHHH
Q psy13674        146 KRKQVFKITTGSTELDKILGGGIESMAITEAFGEFRTGKTQLSHTLSITAQLPDETRGYTGGKVIYVDSENTLYPLLNII  225 (315)
Q Consensus       146 ~~~~~~~isTG~~~LD~lL~GGl~~g~ItEi~G~~GsGKTqLalqla~~~~lp~~~~gg~~~~vvyIDtE~~F~~~~Rl~  225 (315)
                      +++...+|+||++.||++|+|||+.|.+++|+|+||+|||+||+++|+++++|.+ .|+.+++++|||+|..|++. |+.
T Consensus       153 ~~~~~~~i~TG~~~LD~lLgGGI~~Gei~~I~G~sGsGKTTLl~~la~~~~~p~~-~Gg~~~~viyid~E~~~~~~-rl~  230 (400)
T 3lda_A          153 RRSELICLTTGSKNLDTLLGGGVETGSITELFGEFRTGKSQLCHTLAVTCQIPLD-IGGGEGKCLYIDTEGTFRPV-RLV  230 (400)
T ss_dssp             HHHTSCEECCSCHHHHHHTTTSEETTSEEEEEESTTSSHHHHHHHHHHHTTSCGG-GTCCSSEEEEEESSSCCCHH-HHH
T ss_pred             hhccCCccccCChhHHHHhcCCcCCCcEEEEEcCCCCChHHHHHHHHHHhccCcc-cCCCCCcEEEEeCCCccCHH-HHH
Confidence            8889999999999999999999999999999999999999999999999999877 77788999999999999998 888


Q ss_pred             HHHHHHHH----------------------------------------------------------------HHHHHHHH
Q psy13674        226 AIASLVTL----------------------------------------------------------------VGSRLPMS  241 (315)
Q Consensus       226 ~iaer~~l----------------------------------------------------------------L~~~~~~L  241 (315)
                      ++++++++                                                                +.+++..|
T Consensus       231 ~~a~~~gl~~~~vleni~~~~~~~~~~~~~~l~~~~~~l~~~~~~llVIDs~t~~~~~~~sg~g~l~~Rq~~l~~il~~L  310 (400)
T 3lda_A          231 SIAQRFGLDPDDALNNVAYARAYNADHQLRLLDAAAQMMSESRFSLIVVDSVMALYRTDFSGRGELSARQMHLAKFMRAL  310 (400)
T ss_dssp             HHHHHTTCCHHHHHHTEEEEECCSHHHHHHHHHHHHHHHHHSCEEEEEEETGGGGCC------CCHHHHHHHHHHHHHHH
T ss_pred             HHHHHcCCChHhHhhcEEEeccCChHHHHHHHHHHHHHHHhcCCceEEecchhhhCchhhcCccchHHHHHHHHHHHHHH
Confidence            77765321                                                                15678889


Q ss_pred             HHHhhcc-cEEEEE------------ccCCCCcccccccccccccEEEEEEecCCCeEEEEEEECCCCCCeeEEEEEeCC
Q psy13674        242 FHITRED-LIVFFP------------LNADPKKPVGGNIMAHASTTRISLRKGRGETRIAKIYDSPDMPEAEAMFAITNG  308 (315)
Q Consensus       242 ~~LA~e~-iaVV~~------------~~~~~~~PalG~~wah~~~tRl~L~k~~g~~R~~~I~KSp~~p~~~~~F~It~~  308 (315)
                      +++++++ ++||.+            |.+++.+|++|..|+|++++|++|++.+++.|+++|+|+|+.|++++.|.|+++
T Consensus       311 ~~lake~gitVIlv~Hv~~~~~g~~~~~g~~~~p~gg~~l~~~ad~vl~L~~~~g~~R~l~v~K~R~~p~~e~~F~It~~  390 (400)
T 3lda_A          311 QRLADQFGVAVVVTNQVVAQVDGGMAFNPDPKKPIGGNIMAYSSTTRLGFKKGKGCQRLCKVVDSPCLPEAECVFAIYED  390 (400)
T ss_dssp             HHHHHHHCCEEEEEEEC--------------------CHHHHHCSEEEEEEECSTTEEEEEEEECSSSCSCEEEEEEETT
T ss_pred             HHHHHHcCCEEEEEEeecccCCccccccCCCccCCchhHHHHhcceEEEEEecCCCcEEEEEEcCCCCCCCceEEEEeCC
Confidence            9999999 877742            223567899999999999999999998888999999999999999999999999


Q ss_pred             CcccCCC
Q psy13674        309 GIADAKD  315 (315)
Q Consensus       309 GI~~~~~  315 (315)
                      ||+++++
T Consensus       391 Gi~~~~~  397 (400)
T 3lda_A          391 GVGDPRE  397 (400)
T ss_dssp             EEECCC-
T ss_pred             ccccccc
Confidence            9999863



>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1b22_A DNA repair protein RAD51; DNA binding, riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.60.4.1 Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>3bs4_A Uncharacterized protein PH0321; structural genomics, unknown function, PSI-2, protein struct initiative; 1.60A {Pyrococcus horikoshii} Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2kz3_A Putative uncharacterized protein RAD51L3; RAD51D, homologous recombination, unknown function; NMR {Homo sapiens} Back     alignment and structure
>1wcn_A Transcription elongation protein NUSA; RNA-binding protein, escherichia coli NUSA, transcription regulation, regulation of RNA binding; NMR {Escherichia coli} PDB: 2jzb_B Back     alignment and structure
>1u9l_A Transcription elongation protein NUSA; escherichia coli NUSA, phage lambda protein N, regulation of RNA binding, transcription antitermination, X-RAY crystallography; 1.90A {Escherichia coli} SCOP: a.60.4.2 PDB: 1wcl_A Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3gfk_B DNA-directed RNA polymerase subunit alpha; protein-protein complex, cytoplasm, redox-active center, stress response, transcription; 2.30A {Bacillus subtilis} SCOP: a.60.3.1 Back     alignment and structure
>1z3e_B DNA-directed RNA polymerase alpha chain; bacterial transcription regulation, disulfide stress; 1.50A {Bacillus subtilis} SCOP: a.60.3.1 PDB: 3ihq_B Back     alignment and structure
>3k4g_A DNA-directed RNA polymerase subunit alpha; bacterial transcription regulation, DNA-directed RNA polymer nucleotidyltransferase; HET: MLY; 2.05A {Escherichia coli k-12} SCOP: a.60.3.1 PDB: 3n4m_B* 1lb2_B* 3n97_B* 1xs9_D Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>1coo_A RNA polymerase alpha subunit; transcription regulation, nucleotidyl transferase; NMR {Escherichia coli} SCOP: a.60.3.1 PDB: 2jzb_A Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>4a8j_A Elongator complex protein 4; transcription; 2.10A {Saccharomyces cerevisiae} PDB: 4ejs_A Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Back     alignment and structure
>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1vq8_Y 50S ribosomal protein L32E; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: c.9.2.1 PDB: 1vq4_Y* 1vq5_Y* 1vq6_Y* 1vq7_Y* 1s72_Y* 1vq9_Y* 1vqk_Y* 1vql_Y* 1vqm_Y* 1vqn_Y* 1vqo_Y* 1vqp_Y* 1yhq_Y* 1yi2_Y* 1yij_Y* 1yit_Y* 1yj9_Y* 1yjn_Y* 1yjw_Y* 2otj_Y* ... Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>3vr4_A V-type sodium ATPase catalytic subunit A; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_A* 3vr2_A* 3vr5_A 3vr6_A* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>3lu0_A DNA-directed RNA polymerase subunit alpha; E. coli RNA polymerase, nucleotidyltransferase, transcription, transferase; 11.20A {Escherichia coli} PDB: 3iyd_A Back     alignment and structure
>3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>3ez9_A Para; DNA binding, winged-HTH, partition, biosynthetic protein; 2.80A {Salmonella enterica subsp} PDB: 3ezf_A Back     alignment and structure
>3im1_A Protein SNU246, PRE-mRNA-splicing helicase BRR2; ATPase, RNA helicase, rnpase, RNA unwindase, molecular model mRNA splicing; 1.65A {Saccharomyces cerevisiae} PDB: 3im2_A* 3hib_A Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2a1j_A DNA repair endonuclease XPF; XPF, xeroderma pigmentosum, DNA repair, endonuclease, helix-hairpin-helix, DNA binding protein; HET: DNA; 2.70A {Homo sapiens} SCOP: a.60.2.5 PDB: 2kn7_A* Back     alignment and structure
>1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>3ez2_A Plasmid partition protein A; type IA, DNA binding, winged-HTH, DNA bindin; HET: ADP EPE; 2.05A {Escherichia coli} PDB: 3ez6_A* 3ez7_A Back     alignment and structure
>3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} Back     alignment and structure
>3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* Back     alignment and structure
>3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* Back     alignment and structure
>3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* Back     alignment and structure
>2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Back     alignment and structure
>2q0z_X Protein Pro2281; SEC63, SEC, NESG, HR1979, structural genomics, translocase, northeast structural genomics consortium, PSI-2; 2.00A {Homo sapiens} SCOP: a.289.1.1 b.1.18.22 Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>2a6h_A DNA-directed RNA polymerase alpha chain; RNA polymerase holoenzyme, streptolydigin, antibiotic, transcription regulation; HET: STD; 2.40A {Thermus thermophilus} SCOP: d.74.3.1 d.181.1.1 PDB: 1smy_A* 1zyr_A* 1iw7_A* 2a69_A* 2a6e_A 2a68_A* 2be5_A* 2cw0_A 2o5i_A 2o5j_A* 2ppb_A* 3aoh_A* 3aoi_A* 3dxj_A* 3eql_A* 1i6v_A* 1ynj_A* 1l9z_A 1l9u_A* 1ynn_A* ... Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>4dez_A POL IV 1, DNA polymerase IV 1; Y-family, transferase; HET: DNA; 2.60A {Mycobacterium smegmatis} Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>1z00_A DNA excision repair protein ERCC-1; helix-hairpin-helix, hydrolase; HET: DNA; NMR {Homo sapiens} SCOP: a.60.2.5 Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} Back     alignment and structure
>3bq0_A POL IV, DBH, DNA polymerase IV; Y-family, lesion bypass; HET: DNA; 2.60A {Sulfolobus acidocaldarius} SCOP: d.240.1.1 e.8.1.7 PDB: 3bq1_A* 3bq2_A* 1k1q_A 1k1s_A Back     alignment and structure
>1jx4_A DNA polymerase IV (family Y); protein-DNA complex, Y-family, transferase-D complex; HET: DNA MSE ADI; 1.70A {Sulfolobus solfataricus} SCOP: d.240.1.1 e.8.1.7 PDB: 1jxl_A* 1n48_A* 1n56_A* 1ryr_A* 1rys_A* 1s0m_A* 1s0n_A* 1s0o_A* 1s10_A* 1s97_A* 1s9f_A* 2ia6_A* 2ibk_A* 2r8g_A* 2r8h_A* 2r8i_A* 2rdj_A* 3fds_A* 3m9m_B* 3m9n_B* ... Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2a1j_B DNA excision repair protein ERCC-1; XPF, xeroderma pigmentosum, DNA repair, endonuclease, helix-hairpin-helix, DNA binding protein; HET: DNA; 2.70A {Homo sapiens} SCOP: a.60.2.5 Back     alignment and structure
>1z00_B DNA repair endonuclease XPF; helix-hairpin-helix, hydrolase; HET: DNA; NMR {Homo sapiens} SCOP: a.60.2.5 PDB: 2aq0_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1byi_A Dethiobiotin synthase; biotin synthesis, cyclo-ligase, ligase; 0.97A {Escherichia coli} SCOP: c.37.1.10 PDB: 1bs1_A* 1a82_A 1dad_A* 1dae_A* 1daf_A* 1dag_A* 1dah_A* 1dai_A* 1dak_A* 1dam_A* 1dbs_A 1dts_A Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Back     alignment and structure
>1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>1oft_A SULA, hypothetical protein PA3008; bacterial cell division inhibitor, FTSZ, SULA protein; 2.9A {Pseudomonas aeruginosa} SCOP: c.37.1.22 Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>1kft_A UVRC, excinuclease ABC subunit C; helix-hairpin-helix, HHH domain, DNA-binding domain, DNA binding protein; NMR {Escherichia coli} SCOP: a.60.2.3 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>1x2i_A HEF helicase/nuclease; alpha helix, helix-hairpin-helix DNA binding domain, homodimer, hydrolase; 1.45A {Pyrococcus furiosus} SCOP: a.60.2.5 Back     alignment and structure
>3gqc_A DNA repair protein REV1; protein-DNA complex, DNA damage, DNA repair, DNA synthesis, binding, magnesium, metal-binding; HET: DNA DOC DCP; 2.50A {Homo sapiens} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1y88_A Hypothetical protein AF1548; APC5567, structural genomics, protein structure INIT PSI, midwest center for structural genomics center, MCSG; 1.85A {Archaeoglobus fulgidus} SCOP: a.60.4.3 c.52.1.30 Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>3pg5_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 3.30A {Corynebacterium diphtheriae} Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>4f4y_A POL IV, DNA polymerase IV; Y-family polymerase, transferase-DNA complex; HET: DNA DCP; 2.34A {Sulfolobus acidocaldarius} PDB: 3bq0_A* 3bq1_A* 3bq2_A* 4hyk_A* 1k1q_A 1k1s_A Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>1im4_A DBH; DNA polymerase PALM, thumb, fingers, helix-hairpin-helix, fidelity, processivity, transferase; 2.30A {Sulfolobus solfataricus} SCOP: e.8.1.7 Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 315
d1pzna2254 c.37.1.11 (A:96-349) DNA repair protein Rad51, cat 6e-20
d1pzna2254 c.37.1.11 (A:96-349) DNA repair protein Rad51, cat 2e-12
d1v5wa_258 c.37.1.11 (A:) Meiotic recombination protein DMC1/ 1e-19
d1v5wa_258 c.37.1.11 (A:) Meiotic recombination protein DMC1/ 1e-15
d1szpa2251 c.37.1.11 (A:145-395) DNA repair protein Rad51, ca 1e-18
d1szpa2251 c.37.1.11 (A:145-395) DNA repair protein Rad51, ca 9e-13
d1b22a_70 a.60.4.1 (A:) DNA repair protein Rad51, N-terminal 1e-17
d1szpa164 a.60.4.1 (A:81-144) DNA repair protein Rad51, N-te 5e-16
d2i1qa2258 c.37.1.11 (A:65-322) DNA repair protein Rad51, cat 1e-15
d2i1qa2258 c.37.1.11 (A:65-322) DNA repair protein Rad51, cat 4e-13
d1u94a1263 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {E 3e-14
d1n0wa_242 c.37.1.11 (A:) DNA repair protein Rad51, catalytic 2e-12
d1n0wa_242 c.37.1.11 (A:) DNA repair protein Rad51, catalytic 1e-11
d1xp8a1268 c.37.1.11 (A:15-282) RecA protein, ATPase-domain { 2e-11
d1mo6a1269 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {M 3e-10
d1mo6a1269 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {M 4e-05
d1tf7a1242 c.37.1.11 (A:14-255) Circadian clock protein KaiC 5e-08
d1tf7a2242 c.37.1.11 (A:256-497) Circadian clock protein KaiC 6e-08
d1pzna161 a.60.4.1 (A:35-95) DNA repair protein Rad51, N-ter 2e-06
d2i1qa160 a.60.4.1 (A:5-64) DNA repair protein Rad51, N-term 6e-06
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 254 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: DNA repair protein Rad51, catalytic domain
species: Archaeon Pyrococcus furiosus [TaxId: 2261]
 Score = 85.1 bits (209), Expect = 6e-20
 Identities = 46/85 (54%), Positives = 63/85 (74%), Gaps = 1/85 (1%)

Query: 136 SFLTAAQVVEKRKQVFKITTGSTELDKILGGGIESMAITEAFGEFRTGKTQLSHTLSITA 195
           +F+ A + ++KR  + +I+TGS  LDK+LGGGIE+ AITE FGEF +GKTQL+HTL++  
Sbjct: 1   TFMRADEYLKKRATIGRISTGSKSLDKLLGGGIETQAITEVFGEFGSGKTQLAHTLAVMV 60

Query: 196 QLPDETRGYTGGKVIYVDSENTLYP 220
           QLP E  G   G VI++D+ENT  P
Sbjct: 61  QLPPEEGGL-NGSVIWIDTENTFRP 84


>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 254 Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 251 Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 251 Back     information, alignment and structure
>d1b22a_ a.60.4.1 (A:) DNA repair protein Rad51, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1szpa1 a.60.4.1 (A:81-144) DNA repair protein Rad51, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 64 Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Length = 258 Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Length = 258 Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Length = 263 Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Length = 268 Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 269 Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 269 Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Length = 242 Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Length = 242 Back     information, alignment and structure
>d1pzna1 a.60.4.1 (A:35-95) DNA repair protein Rad51, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 61 Back     information, alignment and structure
>d2i1qa1 a.60.4.1 (A:5-64) DNA repair protein Rad51, N-terminal domain {Archaeon Methanococcus voltae [TaxId: 2188]} Length = 60 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query315
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 100.0
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 100.0
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 99.97
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 99.97
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 99.97
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 99.96
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 99.95
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 99.95
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 99.89
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 99.86
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 99.56
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 99.53
d1szpa164 DNA repair protein Rad51, N-terminal domain {Baker 99.34
d1b22a_70 DNA repair protein Rad51, N-terminal domain {Human 99.33
d2i1qa160 DNA repair protein Rad51, N-terminal domain {Archa 98.45
d1pzna161 DNA repair protein Rad51, N-terminal domain {Archa 98.33
d1doqa_69 C-terminal domain of RNA polymerase alpha subunit 97.64
d1lb2b_72 C-terminal domain of RNA polymerase alpha subunit 97.31
d1z3eb167 C-terminal domain of RNA polymerase alpha subunit 97.14
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 96.79
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 96.75
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 96.64
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 96.48
d2awna2232 Maltose transport protein MalK, N-terminal domain 96.47
d1u9la_68 Transcription elongation protein NusA {Escherichia 96.46
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.38
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 96.37
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.33
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 96.28
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.24
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.22
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 96.21
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.16
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.13
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.11
d1svma_362 Papillomavirus large T antigen helicase domain {Si 96.11
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 96.09
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 96.09
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.01
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 95.99
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 95.97
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 95.96
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 95.94
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 95.93
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 95.93
d1vmaa2213 GTPase domain of the signal recognition particle r 95.92
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.91
d1okkd2207 GTPase domain of the signal recognition particle r 95.86
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 95.86
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 95.83
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 95.82
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 95.74
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 95.7
d2qy9a2211 GTPase domain of the signal recognition particle r 95.68
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 95.61
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.61
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 95.59
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 95.56
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 95.49
d2bgwa170 DNA repair endonuclease XPF {Aeropyrum pernix [Tax 95.46
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 95.39
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 95.34
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 95.24
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 95.24
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 95.14
d2a1ja162 DNA repair endonuclease XPF {Human (Homo sapiens) 95.13
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 94.91
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 94.9
d1j8yf2211 GTPase domain of the signal sequence recognition p 94.89
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 94.88
d1kfta_56 Excinuclease UvrC C-terminal domain {Escherichia c 94.88
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 94.83
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 94.81
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 94.75
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 94.73
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 94.73
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 94.7
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 94.66
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 94.64
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 94.63
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 94.61
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 94.61
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 94.56
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 94.56
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 94.49
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 94.42
d2a1jb178 DNA excision repair protein ERCC-1 {Human (Homo sa 94.39
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 94.38
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 94.36
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 94.36
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 94.26
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 94.17
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 94.14
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 94.08
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 94.05
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 93.86
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 93.79
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 93.78
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 93.72
d1g2912240 Maltose transport protein MalK, N-terminal domain 93.71
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 93.7
d1x2ia168 ATP-dependent RNA helicase PF2015 {Pyrococcus furi 93.67
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 93.39
d1ihua2 279 Arsenite-translocating ATPase ArsA {Escherichia co 93.31
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 93.22
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 93.21
d2hyda1255 Putative multidrug export ATP-binding/permease pro 93.18
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 93.08
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 93.01
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 92.97
d2q0zx1176 Protein pro2281 {Human (Homo sapiens) [TaxId: 9606 92.97
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 92.92
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 92.92
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 92.85
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 92.82
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 92.6
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 92.49
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 92.31
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 92.22
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 92.19
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 91.99
d1dxsa_57 C-terminal domain of p73 {Human (Homo sapiens) [Ta 91.96
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 91.95
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 91.84
d1a7ja_ 288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 91.75
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 91.65
d1xpua3 289 Transcription termination factor Rho, ATPase domai 91.51
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 91.5
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 91.44
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 91.42
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 91.36
d2qm8a1 323 Metallochaperone MeaB {Methylobacterium extorquens 91.34
d1jx4a2240 DinB homolog (DBH) {Archaeon Sulfolobus solfataric 91.31
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 91.07
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 91.05
d1qvra3 315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 90.99
d1r6bx3 315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 90.73
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 90.71
d1y88a159 Hypothetical protein AF1548, C-terminal domain {Ar 90.52
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 90.49
d1ihua1 296 Arsenite-translocating ATPase ArsA {Escherichia co 90.44
d1c9ka_180 Adenosylcobinamide kinase/adenosylcobinamide phosp 90.35
d1cp2a_ 269 Nitrogenase iron protein {Clostridium pasteurianum 90.12
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 90.06
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 89.89
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 89.87
d1odfa_ 286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 89.78
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 89.78
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 89.69
d1zeta2273 DNA polymerase iota {Human (Homo sapiens) [TaxId: 89.46
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 89.21
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 89.02
d1tuea_205 Replication protein E1 helicase domain {Human papi 89.01
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 88.85
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 88.83
d2p67a1 327 LAO/AO transport system kinase ArgK {Escherichia c 88.82
d1v38a_78 Sam-domain protein samsn-1 {Mouse (Mus musculus) [ 88.78
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 88.73
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 88.7
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 88.69
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 88.47
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 88.32
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 88.29
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 88.19
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 88.16
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 88.05
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 88.0
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 87.92
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 87.86
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 87.8
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 87.61
g1f2t.1 292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 87.56
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 87.55
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 87.5
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 87.39
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 87.38
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 87.24
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 87.21
d2afhe1 289 Nitrogenase iron protein {Azotobacter vinelandii [ 87.05
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 86.86
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 86.8
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 86.77
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 86.75
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 86.73
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 86.62
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 86.56
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 86.54
d1ucva_81 Ephrin type-A receptor 8, C-terminal domain {Human 86.54
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 86.41
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 86.38
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 86.33
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 86.24
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 86.21
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 86.14
d1ow5a_60 Serine/threonine-protein kinase ste11 {Baker's yea 86.12
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 86.04
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 86.02
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 85.96
d1x40a178 Centaurin-delta 1 (Arap2) {Human(Homo sapiens) [Ta 85.96
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 85.9
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 85.84
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 85.71
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 85.7
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 85.7
d1jmsa360 Terminal deoxynucleotidyl transferase {Mouse (Mus 85.53
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 85.47
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 85.33
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 85.26
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 85.25
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 85.0
d2fmpa257 DNA polymerase beta {Human (Homo sapiens) [TaxId: 84.92
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 84.9
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 84.82
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 84.82
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 84.74
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 84.73
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 84.71
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 84.7
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 84.58
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 84.52
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 84.42
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 84.36
d2bmfa2 305 Dengue virus helicase {Dengue virus type 2 [TaxId: 84.28
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 84.28
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 84.27
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 84.15
d2fh5b1207 Signal recognition particle receptor beta-subunit 84.02
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 84.01
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 83.94
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 83.82
d1b4fa_74 EphB2 receptor {Human (Homo sapiens) [TaxId: 9606] 83.77
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 83.66
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 83.45
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 83.31
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 83.03
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 83.0
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 82.76
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 82.75
d1gm5a2180 RecG "wedge" domain {Thermotoga maritima [TaxId: 2 82.73
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 82.45
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 82.25
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 82.1
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 82.01
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 81.97
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 81.96
d1b0xa_72 EphA4 receptor tyrosine kinases {Mouse (Mus muscul 81.96
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 81.91
d1nrjb_209 Signal recognition particle receptor beta-subunit 81.91
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 81.29
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 81.0
d1e69a_ 308 Smc head domain {Thermotoga maritima [TaxId: 2336] 80.99
g1xew.1 329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 80.84
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 80.82
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 80.66
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 80.6
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 80.52
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 80.41
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 80.02
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Meiotic recombination protein DMC1/LIM15 homolog
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=9.4e-34  Score=249.54  Aligned_cols=179  Identities=66%  Similarity=0.975  Sum_probs=150.6

Q ss_pred             cccchHHHHHHhhcCccceecCChhHHHhhcCCCCcccEEEEecCCCCChhhHHHHHHHHccCCccccCCCCCeEEEEeC
Q psy13674        135 NSFLTAAQVVEKRKQVFKITTGSTELDKILGGGIESMAITEAFGEFRTGKTQLSHTLSITAQLPDETRGYTGGKVIYVDS  214 (315)
Q Consensus       135 ~~~~tA~ell~~~~~~~~isTG~~~LD~lL~GGl~~g~ItEi~G~~GsGKTqLalqla~~~~lp~~~~gg~~~~vvyIDt  214 (315)
                      |||.||.|++++++...+|+||++.||++|+||||.|++++|+|+||+|||+||+|+|.+++.... .+.....++|+++
T Consensus         1 ~~~~~~~~~~~~~~~~~ri~TGi~~LD~~lgGGip~G~~~~i~G~~GsGKT~lalq~~~~~~~~~~-~~~~~~~~~~~~~   79 (258)
T d1v5wa_           1 PGFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQLPGA-GGYPGGKIIFIDT   79 (258)
T ss_dssp             CCSEEHHHHHHHGGGCCCBCCSCHHHHHHTTSSBCSSEEEEEECCTTCTHHHHHHHHHHHTTSCBT-TTBCCCEEEEEES
T ss_pred             CCcccHHHHHHhhcCCceecCCCHHHHHhhcCCCcCCEEEEEECCCCCCHHHHHHHHHHHHHhhhh-cccccceEEEech
Confidence            689999999999999999999999999999999999999999999999999999999999987543 3456788999999


Q ss_pred             CCCCChhhHHHHHHHHHHH-------------------------------------------------------------
Q psy13674        215 ENTLYPLLNIIAIASLVTL-------------------------------------------------------------  233 (315)
Q Consensus       215 E~~F~~~~Rl~~iaer~~l-------------------------------------------------------------  233 (315)
                      +..|... ++.++..+++.                                                             
T Consensus        80 ~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vid~~~~~~~~~~~~~~~~~  158 (258)
T d1v5wa_          80 ENTFRPD-RLRDIADRFNVDHDAVLDNVLYARAYTSEHQMELLDYVAAKFHEEAGIFKLLIIDSIMALFRVDFSGRGELA  158 (258)
T ss_dssp             SSCCCHH-HHHHHHHHTTCCHHHHHHTEEEEECCSTTHHHHHHHHHHHHHHHSCSSEEEEEEETSGGGHHHHCCGGGCHH
T ss_pred             HHHHHHH-HHHHHHhhhcccchhhhhcccccccCcHHHHHHHHHHHHHHhhhhccCceEEEeeehhhhhhccccCCcchh
Confidence            9999988 77776554210                                                             


Q ss_pred             -----HHHHHHHHHHHhhcc-cEEEEEc------------cCCCCcccccccccccccEEEEEEecCCCeEEEEEEECCC
Q psy13674        234 -----VGSRLPMSFHITRED-LIVFFPL------------NADPKKPVGGNIMAHASTTRISLRKGRGETRIAKIYDSPD  295 (315)
Q Consensus       234 -----L~~~~~~L~~LA~e~-iaVV~~~------------~~~~~~PalG~~wah~~~tRl~L~k~~g~~R~~~I~KSp~  295 (315)
                           +++++..|++++.++ ++++...            ......|++|+.|.|++++|+.|++.+++.|.++|.|+|+
T Consensus       159 ~~~~~l~~~~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~l~l~~~~~~~R~l~i~K~r~  238 (258)
T d1v5wa_         159 ERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPE  238 (258)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHTCEEEEEECC-------------------CCTTTTSSSEEEEEEESSTTEEEEEEEECTT
T ss_pred             HHHHHHHHHHHHHHHHHHhcCCEEEEeeeEeecccccccccCCceeecccceehheeEEEEEEEEcCCCEEEEEEEeCCC
Confidence                 677888999999999 6666421            1223578999999999999999999889999999999999


Q ss_pred             CCCeeEEEEEeCCCcccCCC
Q psy13674        296 MPEAEAMFAITNGGIADAKD  315 (315)
Q Consensus       296 ~p~~~~~F~It~~GI~~~~~  315 (315)
                      .|+..++|+|+++||++++|
T Consensus       239 ~~~~~~~F~It~~GI~~~~~  258 (258)
T d1v5wa_         239 MPENEATFAITAGGIGDAKE  258 (258)
T ss_dssp             CCSSCEEEEEETTEEEECCC
T ss_pred             CCCcEEEEEEcCCCcccCCC
Confidence            99888999999999999986



>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1szpa1 a.60.4.1 (A:81-144) DNA repair protein Rad51, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b22a_ a.60.4.1 (A:) DNA repair protein Rad51, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i1qa1 a.60.4.1 (A:5-64) DNA repair protein Rad51, N-terminal domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1pzna1 a.60.4.1 (A:35-95) DNA repair protein Rad51, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1doqa_ a.60.3.1 (A:) C-terminal domain of RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lb2b_ a.60.3.1 (B:) C-terminal domain of RNA polymerase alpha subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z3eb1 a.60.3.1 (B:245-311) C-terminal domain of RNA polymerase alpha subunit {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u9la_ a.60.4.2 (A:) Transcription elongation protein NusA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bgwa1 a.60.2.5 (A:160-229) DNA repair endonuclease XPF {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2a1ja1 a.60.2.5 (A:837-898) DNA repair endonuclease XPF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kfta_ a.60.2.3 (A:) Excinuclease UvrC C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2a1jb1 a.60.2.5 (B:219-296) DNA excision repair protein ERCC-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1x2ia1 a.60.2.5 (A:2-69) ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2q0zx1 a.289.1.1 (X:33-208) Protein pro2281 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1dxsa_ a.60.1.2 (A:) C-terminal domain of p73 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1jx4a2 e.8.1.7 (A:1-240) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1y88a1 a.60.4.3 (A:128-186) Hypothetical protein AF1548, C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zeta2 e.8.1.7 (A:27-299) DNA polymerase iota {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v38a_ a.60.1.2 (A:) Sam-domain protein samsn-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ucva_ a.60.1.2 (A:) Ephrin type-A receptor 8, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ow5a_ a.60.1.2 (A:) Serine/threonine-protein kinase ste11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x40a1 a.60.1.2 (A:8-85) Centaurin-delta 1 (Arap2) {Human(Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmsa3 a.60.12.1 (A:243-302) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d2fmpa2 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b4fa_ a.60.1.2 (A:) EphB2 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gm5a2 b.40.4.9 (A:106-285) RecG "wedge" domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1b0xa_ a.60.1.2 (A:) EphA4 receptor tyrosine kinases {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure