Psyllid ID: psy13746


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290----
MSNVASFPAQGGFYPDGIIGLIGQAWAMIFASAGYKVSLYDVLSEQIENAKNTIQHTLQDYHQKGCLKGSLSPAHAGYKVSLYDVLSEQIENAKNTIQHTLQDYHQKGCLKGSLSPEEQFGLISGTPVLRECLEDAIFIQESVPEILQIKHQVYRAIDIFMSSNTILSSSTSSFLPSVLSEHSTHRSQFIVAHPVNPPYFIPLVEIVPAAWTSERVITRTREIMTEIGMKPVTLTTEIRGFALNRIQFAVLNECYHLVHDGVLSAKDIDRVMSEGLGLRYAFLGPLETIHLNSA
ccccccccccccEEEEEEEcHHcHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHccccEEEEcccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHccccccccHHHHHccccEEEEEccccHHHHHHHHHHHHHcccccEEEEEccccccHHHHHcccccccEEEEEccccccccccEEEEcccccccHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcccccccccccHHHHcccccc
ccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHcccccEEEEEEccccccHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccHHHHHHcccEEEEEcHHHHHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHccccccEEEEEcccccccEEEEEEEccccccHHHHHHHHHHHHHcccccEEEccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccccccccHHHHHHHccc
msnvasfpaqggfypdgiIGLIGQAWAMIFASAGYKVSLYDVLSEQIENAKNTIQHTLQDyhqkgclkgslspahagykvSLYDVLSEQIENAKNTIQHTLQDyhqkgclkgslspeeqfglisgtpvLRECLEDAIFIQESVPEILQIKHQVYRAIDIfmssntilssstssflpsvlsehsthrsqfivahpvnppyfiplveivpaawtserVITRTREIMTeigmkpvtlTTEIRGFALNRIQFAVLNECYHLVHDGVLSAKDIDRVMSeglglryaflgpletihlnsa
msnvasfpaqggfYPDGIIGLIGQAWAMIFASAGYKVSLYDVLSEQIENAKNTIQHTLQDYHQKGCLKGSLSPAHAGYKVSLYDVLSEQIENAKNTIQHTLQDYHQKGCLKGSLSPEEQFGLISGTPVLRECLEDAIFIQESVPEILQIKHQVYRAIDIFMSSNTILSSSTSSFLPSVLSEHSTHRSQFIVAHPVNPPYFIPLVEIVPAAWTSERVITRTReimteigmkpvtLTTEIRGFALNRIQFAVLNECYHLVHDGVLSAKDIDRVMSEGLGLRyaflgpletihlnsa
MSNVASFPAQGGFYPDGIIGLIGQAWAMIFASAGYKVSLYDVLSEQIENAKNTIQHTLQDYHQKGCLKGSLSPAHAGYKVSLYDVLSEQIENAKNTIQHTLQDYHQKGCLKGSLSPEEQFGLISGTPVLRECLEDAIFIQESVPEILQIKHQVYRAIDIFMssntilssstssflpsvlsEHSTHRSQFIVAHPVNPPYFIPLVEIVPAAWTSERVITRTREIMTEIGMKPVTLTTEIRGFALNRIQFAVLNECYHLVHDGVLSAKDIDRVMSEGLGLRYAFLGPLETIHLNSA
*********QGGFYPDGIIGLIGQAWAMIFASAGYKVSLYDVLSEQIENAKNTIQHTLQDYHQKGCLKGSLSPAHAGYKVSLYDVLSEQIENAKNTIQHTLQDYHQKGCLKGSLSPEEQFGLISGTPVLRECLEDAIFIQESVPEILQIKHQVYRAIDIFMS*************************QFIVAHPVNPPYFIPLVEIVPAAWTSERVITRTREIMTEIGMKPVTLTTEIRGFALNRIQFAVLNECYHLVHDGVLSAKDIDRVMSEGLGLRYAFLGPLETIH****
*************YPDGIIGLIGQAWAMIFASAGYKVSLYDVLSEQIENAKNTIQHTLQDYHQKGCLKGSLSPAHAGYKVSLYDVLSEQIENAKNTIQHTLQD**************EQFGLISGTPVLRECLEDAIFIQESVPEILQIKHQVYRAIDIFMSSNTILSSSTSSFLPSVLSEHSTHRSQFIVAHPVNPPYFIPLVEIVPAAWTSERVITRTREIMTEIGMKPVTLTTEIRGFALNRIQFAVLNECYHLVHDGVLSAKDIDRVMSEGLGLRYAFLGPLETIHLNS*
MSNVASFPAQGGFYPDGIIGLIGQAWAMIFASAGYKVSLYDVLSEQIENAKNTIQHTLQDYHQKGCLKGSLSPAHAGYKVSLYDVLSEQIENAKNTIQHTLQDYHQKGCLKGSLSPEEQFGLISGTPVLRECLEDAIFIQESVPEILQIKHQVYRAIDIFMSSNTILSSSTSSFLPSVLSEHSTHRSQFIVAHPVNPPYFIPLVEIVPAAWTSERVITRTREIMTEIGMKPVTLTTEIRGFALNRIQFAVLNECYHLVHDGVLSAKDIDRVMSEGLGLRYAFLGPLETIHLNSA
***VASFPAQGGFYPDGIIGLIGQAWAMIFASAGYKVSLY*********AKNTIQHTLQDYHQKGCLKGSLSPAHAGYKVSLYDVLSEQIENAKNTIQHTLQDYHQKGCLKGSLSPEEQFGLISGTPVLRECLEDAIFIQESVPEILQIKHQVYRAIDIFMSSNTILSSSTSSFLPSVLSEHSTHRSQFIVAHPVNPPYFIPLVEIVPAAWTSERVITRTREIMTEIGMKPVTLTTEIRGFALNRIQFAVLNECYHLVHDGVLSAKDIDRVMSEGLGLRYAFLGPLETIHLNSA
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSNVASFPAQGGFYPDGIIGLIGQAWAMIFASAGYKVSLxxxxxxxxxxxxxxxxxxxxxYHQKGCLKGSLSPAHAGYKVSLxxxxxxxxxxxxxxxxxxxxxYHQKGCLKGSLSPEEQFGLISGTPVLRECLEDAIFIQESVPEILQIKHQVYRAIDIFMSSNTILSSSTSSFLPSVLSEHSTHRSQFIVAHPVNPPYFIPLVEIVPAAWTSERVITRTREIMTEIGMKPVTLTTEIRGFALNRIQFAVLNECYHLVHDGVLSAKDIDRVMSEGLGLRYAFLGPLETIHLNSA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query294 2.2.26 [Sep-21-2011]
Q5RDZ2319 Lambda-crystallin homolog yes N/A 0.785 0.724 0.427 2e-59
Q9Y2S2319 Lambda-crystallin homolog yes N/A 0.785 0.724 0.427 2e-59
Q99KP3319 Lambda-crystallin homolog yes N/A 0.823 0.758 0.426 2e-52
Q811X6319 Lambda-crystallin homolog yes N/A 0.823 0.758 0.423 3e-52
Q8SQ26322 Lambda-crystallin homolog yes N/A 0.785 0.717 0.423 5e-52
P14755319 Lambda-crystallin OS=Oryc yes N/A 0.785 0.724 0.419 2e-51
Q8SPX7321 Lambda-crystallin homolog yes N/A 0.816 0.747 0.411 1e-50
Q8CUW0307 L-carnitine dehydrogenase yes N/A 0.591 0.566 0.401 5e-33
Q8CQB9321 L-carnitine dehydrogenase yes N/A 0.591 0.542 0.384 1e-31
Q4V182326 L-carnitine dehydrogenase yes N/A 0.714 0.644 0.348 9e-31
>sp|Q5RDZ2|CRYL1_PONAB Lambda-crystallin homolog OS=Pongo abelii GN=CRYL1 PE=2 SV=3 Back     alignment and function desciption
 Score =  229 bits (584), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 117/274 (42%), Positives = 163/274 (59%), Gaps = 43/274 (15%)

Query: 20  GLIGQAWAMIFASAGYKVSLYDVLSEQIENAKNTIQHTLQDYHQKGCLKGSLSPAHAGYK 79
           G+IG++WAM+FAS G                                           ++
Sbjct: 15  GVIGRSWAMLFASGG-------------------------------------------FQ 31

Query: 80  VSLYDVLSEQIENAKNTIQHTLQDYHQKGCLKGSLSPEEQFGLISGTPVLRECLEDAIFI 139
           V LYD+  +QI NA   I+  ++   Q G LKGSLS EEQ  LISG P ++E +E A+ I
Sbjct: 32  VKLYDIEQQQIRNALENIRKEMKLLEQAGSLKGSLSVEEQLSLISGCPNIQEAVEGAMHI 91

Query: 140 QESVPEILQIKHQVYRAIDIFMSSNTILSSSTSSFLPSVLSEHSTHRSQFIVAHPVNPPY 199
           QE VPE L++K +++  +D  +    ILSSSTS  +PS L     H  Q IVAHPVNPPY
Sbjct: 92  QECVPEDLELKKKIFAQLDSIIDDRVILSSSTSCLMPSKLFAGLVHVKQCIVAHPVNPPY 151

Query: 200 FIPLVEIVPAAWTSERVITRTREIMTEIGMKPVTLTTEIRGFALNRIQFAVLNECYHLVH 259
           +IPLVE+VP   T+   + RT  +M +IG  P+ +  E+ GF LNR+Q+A+++E + LV 
Sbjct: 152 YIPLVELVPHPETAPTTVDRTHALMKKIGQCPMRVQKEVAGFVLNRLQYAIISEAWRLVE 211

Query: 260 DGVLSAKDIDRVMSEGLGLRYAFLGPLETIHLNS 293
           +G++S  D+D VMSEGLG+RYAF+GPLET+HLN+
Sbjct: 212 EGIVSPSDLDLVMSEGLGMRYAFIGPLETMHLNA 245





Pongo abelii (taxid: 9601)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 4EC: 5
>sp|Q9Y2S2|CRYL1_HUMAN Lambda-crystallin homolog OS=Homo sapiens GN=CRYL1 PE=1 SV=3 Back     alignment and function description
>sp|Q99KP3|CRYL1_MOUSE Lambda-crystallin homolog OS=Mus musculus GN=Cryl1 PE=2 SV=3 Back     alignment and function description
>sp|Q811X6|CRYL1_RAT Lambda-crystallin homolog OS=Rattus norvegicus GN=Cryl1 PE=2 SV=3 Back     alignment and function description
>sp|Q8SQ26|CRYL1_PIG Lambda-crystallin homolog OS=Sus scrofa GN=CRYL1 PE=2 SV=3 Back     alignment and function description
>sp|P14755|CRYL1_RABIT Lambda-crystallin OS=Oryctolagus cuniculus GN=CRYL1 PE=1 SV=3 Back     alignment and function description
>sp|Q8SPX7|CRYL1_BOVIN Lambda-crystallin homolog OS=Bos taurus GN=CRYL1 PE=2 SV=3 Back     alignment and function description
>sp|Q8CUW0|LCDH_OCEIH L-carnitine dehydrogenase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=lcdH PE=3 SV=1 Back     alignment and function description
>sp|Q8CQB9|LCDH_STAES L-carnitine dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=lcdH PE=3 SV=1 Back     alignment and function description
>sp|Q4V182|LCDH_BACCZ L-carnitine dehydrogenase OS=Bacillus cereus (strain ZK / E33L) GN=lcdH PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query294
158285772315 AGAP007378-PB [Anopheles gambiae str. PE 0.785 0.733 0.485 7e-71
195040405318 GH12278 [Drosophila grimshawi] gi|193900 0.795 0.735 0.469 3e-69
195134454313 GI10976 [Drosophila mojavensis] gi|19390 0.795 0.747 0.469 9e-69
45549573315 CG9914 [Drosophila melanogaster] gi|3358 0.795 0.742 0.476 1e-68
195351396318 GM13412 [Drosophila sechellia] gi|194124 0.795 0.735 0.476 2e-68
312384823304 hypothetical protein AND_01493 [Anophele 0.785 0.759 0.474 2e-68
194770170317 GF19071 [Drosophila ananassae] gi|190619 0.795 0.738 0.469 4e-68
195403081318 GJ18534 [Drosophila virilis] gi|19414096 0.795 0.735 0.469 5e-68
195448304316 GK25055 [Drosophila willistoni] gi|19416 0.795 0.740 0.476 7e-68
194893905315 GG19334 [Drosophila erecta] gi|190649613 0.795 0.742 0.473 1e-67
>gi|158285772|ref|XP_308454.4| AGAP007378-PB [Anopheles gambiae str. PEST] gi|347965269|ref|XP_003435742.1| AGAP013544-PA [Anopheles gambiae str. PEST] gi|333466437|gb|EGK96241.1| AGAP013544-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
 Score =  273 bits (698), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 133/274 (48%), Positives = 176/274 (64%), Gaps = 43/274 (15%)

Query: 20  GLIGQAWAMIFASAGYKVSLYDVLSEQIENAKNTIQHTLQDYHQKGCLKGSLSPAHAGYK 79
           GLIG++WAM+FA  G                                           Y+
Sbjct: 16  GLIGRSWAMLFAGVG-------------------------------------------YQ 32

Query: 80  VSLYDVLSEQIENAKNTIQHTLQDYHQKGCLKGSLSPEEQFGLISGTPVLRECLEDAIFI 139
           V++YD++ E +E A    +  L+   ++G ++G+LS  EQF  I GT  L++ + DAI++
Sbjct: 33  VTIYDIIPEIVEKALKETKLELESVEKQGTIRGTLSAAEQFACIRGTDNLKDAVTDAIYV 92

Query: 140 QESVPEILQIKHQVYRAIDIFMSSNTILSSSTSSFLPSVLSEHSTHRSQFIVAHPVNPPY 199
           QE VPE L IK ++Y  +D  +  NTIL+SSTS+F+PS+ SE   HR+Q +VAHPVNPPY
Sbjct: 93  QECVPERLDIKKKLYGELDGLVGPNTILASSTSTFMPSLFSEDLKHRAQVLVAHPVNPPY 152

Query: 200 FIPLVEIVPAAWTSERVITRTREIMTEIGMKPVTLTTEIRGFALNRIQFAVLNECYHLVH 259
           ++PLVEIVPA WT     T+ RE+MTEIG KPVTL+ +I GFALNRIQ+A+LNE + LV 
Sbjct: 153 YVPLVEIVPAPWTKPEYTTKARELMTEIGQKPVTLSRQIEGFALNRIQYAILNETWRLVA 212

Query: 260 DGVLSAKDIDRVMSEGLGLRYAFLGPLETIHLNS 293
           DG+LS KDID VMSEGLG+RYAFLGPLET HLN+
Sbjct: 213 DGILSVKDIDVVMSEGLGMRYAFLGPLETAHLNA 246




Source: Anopheles gambiae str. PEST

Species: Anopheles gambiae

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|195040405|ref|XP_001991062.1| GH12278 [Drosophila grimshawi] gi|193900820|gb|EDV99686.1| GH12278 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|195134454|ref|XP_002011652.1| GI10976 [Drosophila mojavensis] gi|193906775|gb|EDW05642.1| GI10976 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|45549573|ref|NP_573114.2| CG9914 [Drosophila melanogaster] gi|33589300|gb|AAQ22417.1| RH68464p [Drosophila melanogaster] gi|45447016|gb|AAF48586.2| CG9914 [Drosophila melanogaster] gi|220959622|gb|ACL92354.1| CG9914-PA [synthetic construct] Back     alignment and taxonomy information
>gi|195351396|ref|XP_002042220.1| GM13412 [Drosophila sechellia] gi|194124063|gb|EDW46106.1| GM13412 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|312384823|gb|EFR29456.1| hypothetical protein AND_01493 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|194770170|ref|XP_001967170.1| GF19071 [Drosophila ananassae] gi|190619290|gb|EDV34814.1| GF19071 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195403081|ref|XP_002060123.1| GJ18534 [Drosophila virilis] gi|194140967|gb|EDW57393.1| GJ18534 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195448304|ref|XP_002071598.1| GK25055 [Drosophila willistoni] gi|194167683|gb|EDW82584.1| GK25055 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|194893905|ref|XP_001977964.1| GG19334 [Drosophila erecta] gi|190649613|gb|EDV46891.1| GG19334 [Drosophila erecta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query294
FB|FBgn0030737315 CG9914 [Drosophila melanogaste 0.748 0.698 0.495 1.6e-54
FB|FBgn0033949315 CG10131 [Drosophila melanogast 0.748 0.698 0.472 9.2e-52
UNIPROTKB|Q9Y2S2319 CRYL1 "Lambda-crystallin homol 0.748 0.689 0.45 8.5e-49
UNIPROTKB|Q5RDZ2319 CRYL1 "Lambda-crystallin homol 0.748 0.689 0.45 8.5e-49
UNIPROTKB|P14755319 CRYL1 "Lambda-crystallin" [Ory 0.748 0.689 0.445 2.6e-47
UNIPROTKB|E2R471387 CRYL1 "Uncharacterized protein 0.748 0.568 0.436 3.3e-47
MGI|MGI:1915881319 Cryl1 "crystallin, lambda 1" [ 0.748 0.689 0.445 5.4e-47
RGD|631427319 Cryl1 "crystallin, lambda 1" [ 0.748 0.689 0.440 6.9e-47
UNIPROTKB|Q8SQ26322 CRYL1 "Lambda-crystallin homol 0.748 0.683 0.440 1.8e-46
UNIPROTKB|F1NPU2321 CRYL1 "Uncharacterized protein 0.775 0.710 0.419 1.8e-46
FB|FBgn0030737 CG9914 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 563 (203.2 bits), Expect = 1.6e-54, P = 1.6e-54
 Identities = 109/220 (49%), Positives = 142/220 (64%)

Query:    74 AHAGYKVSLYDVLSEQIENAKNTIQHTLQDYHQKGCLKGSLSPEEQFGLISGTPVLRECL 133
             A  GY+V LYD+L EQ+  A    Q  LQD   KG L+G L+  +QF  ISGT  L+E +
Sbjct:    25 ASVGYQVVLYDILPEQVSTALTATQKELQDLEAKGLLRGKLTAAQQFACISGTNDLKELV 84

Query:   134 EDAIFIQESVPEILQIKHQVYRAIDIFMXXXXXXXXXXXXXXXXXXXEHSTHRSQFIVAH 193
             + AIF+QE +PE L +K  +Y+ +D  +                       +++  +V+H
Sbjct:    85 KGAIFVQECIPERLDLKKALYKQLDAVVGPNTILSSSTSTFLPSLFSADLKNKANVLVSH 144

Query:   194 PVNPPYFIPLVEIVPAAWTSERVITRTREIMTEIGMKPVTLTTEIRGFALNRIQFAVLNE 253
             PVNPPY++PLVEIVPA WT    + +TR +M EIG KPVTL+ EI GFALNRIQ+A+LNE
Sbjct:   145 PVNPPYYVPLVEIVPAPWTKPEWVKKTRALMEEIGQKPVTLSREIEGFALNRIQYAILNE 204

Query:   254 CYHLVHDGVLSAKDIDRVMSEGLGLRYAFLGPLETIHLNS 293
              + LV  G+L+ KDID VMS GLG RYAFLGPLET HLN+
Sbjct:   205 TWRLVEAGILNVKDIDSVMSNGLGPRYAFLGPLETAHLNA 244


GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0006631 "fatty acid metabolic process" evidence=IEA
GO:0070403 "NAD+ binding" evidence=IEA
GO:0003857 "3-hydroxyacyl-CoA dehydrogenase activity" evidence=IEA
FB|FBgn0033949 CG10131 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y2S2 CRYL1 "Lambda-crystallin homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5RDZ2 CRYL1 "Lambda-crystallin homolog" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
UNIPROTKB|P14755 CRYL1 "Lambda-crystallin" [Oryctolagus cuniculus (taxid:9986)] Back     alignment and assigned GO terms
UNIPROTKB|E2R471 CRYL1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1915881 Cryl1 "crystallin, lambda 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|631427 Cryl1 "crystallin, lambda 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q8SQ26 CRYL1 "Lambda-crystallin homolog" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1NPU2 CRYL1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9RVG1HBD_DEIRA1, ., 1, ., 1, ., 1, 5, 70.31480.69040.7302yesN/A
Q8SQ26CRYL1_PIG1, ., 1, ., 1, ., 4, 50.42330.78570.7173yesN/A
Q9Y2S2CRYL1_HUMAN1, ., 1, ., 1, ., 4, 50.42700.78570.7241yesN/A
Q4ZSC0LCDH_PSEU21, ., 1, ., 1, ., 1, 0, 80.33480.71420.6603yesN/A
D7B2S5LCDH_NOCDD1, ., 1, ., 1, ., 1, 0, 80.30230.71420.6382yesN/A
Q8SPX7CRYL1_BOVIN1, ., 1, ., 1, ., 4, 50.41110.81630.7476yesN/A
B1VLT7LCDH_STRGG1, ., 1, ., 1, ., 1, 0, 80.30690.71420.6268yesN/A
Q5RDZ2CRYL1_PONAB1, ., 1, ., 1, ., 4, 50.42700.78570.7241yesN/A
P14755CRYL1_RABIT1, ., 1, ., 1, ., 4, 50.41970.78570.7241yesN/A
Q4V182LCDH_BACCZ1, ., 1, ., 1, ., 1, 0, 80.34880.71420.6441yesN/A
Q99KP3CRYL1_MOUSE1, ., 1, ., 1, ., 4, 50.42650.82310.7586yesN/A
Q811X6CRYL1_RAT1, ., 1, ., 1, ., 4, 50.42300.82310.7586yesN/A
P77851HBD_THETC1, ., 1, ., 1, ., 1, 5, 70.30980.70400.7366yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.10.766
4th Layer1.1.1.45LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query294
PRK06129308 PRK06129, PRK06129, 3-hydroxyacyl-CoA dehydrogenas 8e-85
COG1250307 COG1250, FadB, 3-hydroxyacyl-CoA dehydrogenase [Li 2e-60
pfam02737180 pfam02737, 3HCDH_N, 3-hydroxyacyl-CoA dehydrogenas 3e-45
PRK06130311 PRK06130, PRK06130, 3-hydroxybutyryl-CoA dehydroge 5e-45
PRK07531 495 PRK07531, PRK07531, bifunctional 3-hydroxyacyl-CoA 5e-45
PRK08269314 PRK08269, PRK08269, 3-hydroxybutyryl-CoA dehydroge 2e-38
PRK07066321 PRK07066, PRK07066, 3-hydroxybutyryl-CoA dehydroge 2e-35
PRK09260288 PRK09260, PRK09260, 3-hydroxybutyryl-CoA dehydroge 3e-28
PLN02545295 PLN02545, PLN02545, 3-hydroxybutyryl-CoA dehydroge 3e-28
PRK08293287 PRK08293, PRK08293, 3-hydroxybutyryl-CoA dehydroge 9e-27
PRK06035291 PRK06035, PRK06035, 3-hydroxyacyl-CoA dehydrogenas 2e-21
PRK05808282 PRK05808, PRK05808, 3-hydroxybutyryl-CoA dehydroge 3e-20
PRK07530292 PRK07530, PRK07530, 3-hydroxybutyryl-CoA dehydroge 2e-17
pfam0072597 pfam00725, 3HCDH, 3-hydroxyacyl-CoA dehydrogenase, 2e-16
PRK07819286 PRK07819, PRK07819, 3-hydroxybutyryl-CoA dehydroge 1e-15
TIGR02440 699 TIGR02440, FadJ, fatty oxidation complex, alpha su 2e-15
PRK08268 507 PRK08268, PRK08268, 3-hydroxy-acyl-CoA dehydrogena 7e-15
TIGR02279 503 TIGR02279, PaaC-3OHAcCoADH, 3-hydroxyacyl-CoA dehy 5e-14
TIGR02437 714 TIGR02437, FadB, fatty oxidation complex, alpha su 9e-13
PRK11154 708 PRK11154, fadJ, multifunctional fatty acid oxidati 1e-11
PRK11730 715 PRK11730, fadB, multifunctional fatty acid oxidati 5e-11
TIGR02441 737 TIGR02441, fa_ox_alpha_mit, fatty acid oxidation c 2e-06
>gnl|CDD|235706 PRK06129, PRK06129, 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
 Score =  256 bits (656), Expect = 8e-85
 Identities = 103/278 (37%), Positives = 141/278 (50%), Gaps = 46/278 (16%)

Query: 17  GIIG--LIGQAWAMIFASAGYKVSLYDVLSEQIENAKNTIQHTLQDYHQKGCLKGSLSPA 74
            IIG  LIG+AWA++FA AG++V L+D        A   I   L+D      L G     
Sbjct: 6   AIIGAGLIGRAWAIVFARAGHEVRLWDADPAAAAAAPAYIAGRLEDLAAFDLLDGE---- 61

Query: 75  HAGYKVSLYDVLSEQIENAKNTIQHTLQDYHQKGCLKGSLSPEEQFGLISGTPVLRECLE 134
                                                   +P+     I  T  L + + 
Sbjct: 62  ----------------------------------------APDAVLARIRVTDSLADAVA 81

Query: 135 DAIFIQESVPEILQIKHQVYRAIDIFMSSNTILSSSTSSFLPSVLSEHSTHRSQFIVAHP 194
           DA ++QES PE L++K  ++  +D     + IL+SSTS+ L S  +EH   R + +VAHP
Sbjct: 82  DADYVQESAPENLELKRALFAELDALAPPHAILASSTSALLASAFTEHLAGRERCLVAHP 141

Query: 195 VNPPYFIPLVEIVPAAWTSERVITRTREIMTEIGMKPVTLTTEIRGFALNRIQFAVLNEC 254
           +NPPY IP+VE+VPA WT+   + R   +    G  PV L  EI GF LNR+Q A+L E 
Sbjct: 142 INPPYLIPVVEVVPAPWTAPATLARAEALYRAAGQSPVRLRREIDGFVLNRLQGALLREA 201

Query: 255 YHLVHDGVLSAKDIDRVMSEGLGLRYAFLGPLETIHLN 292
           + LV DGV S  DID V+ +GLGLR++F+GP ETI LN
Sbjct: 202 FRLVADGVASVDDIDAVIRDGLGLRWSFMGPFETIDLN 239


Length = 308

>gnl|CDD|224170 COG1250, FadB, 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|202367 pfam02737, 3HCDH_N, 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|235707 PRK06130, PRK06130, 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|236044 PRK07531, PRK07531, bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>gnl|CDD|181340 PRK08269, PRK08269, 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|168796 PRK07066, PRK07066, 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|236434 PRK09260, PRK09260, 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|215300 PLN02545, PLN02545, 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|181359 PRK08293, PRK08293, 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180361 PRK06035, PRK06035, 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180269 PRK05808, PRK05808, 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|181018 PRK07530, PRK07530, 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|216084 pfam00725, 3HCDH, 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain Back     alignment and domain information
>gnl|CDD|181133 PRK07819, PRK07819, 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|131493 TIGR02440, FadJ, fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>gnl|CDD|236211 PRK08268, PRK08268, 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|188207 TIGR02279, PaaC-3OHAcCoADH, 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>gnl|CDD|131490 TIGR02437, FadB, fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>gnl|CDD|236864 PRK11154, fadJ, multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>gnl|CDD|183293 PRK11730, fadB, multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>gnl|CDD|131494 TIGR02441, fa_ox_alpha_mit, fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 294
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 100.0
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 100.0
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 100.0
KOG2304|consensus298 100.0
PRK11730 715 fadB multifunctional fatty acid oxidation complex 100.0
TIGR02437 714 FadB fatty oxidation complex, alpha subunit FadB. 100.0
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 100.0
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 100.0
TIGR02441 737 fa_ox_alpha_mit fatty acid oxidation complex, alph 100.0
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 100.0
TIGR02440 699 FadJ fatty oxidation complex, alpha subunit FadJ. 100.0
PRK11154 708 fadJ multifunctional fatty acid oxidation complex 100.0
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 100.0
PRK08269314 3-hydroxybutyryl-CoA dehydrogenase; Validated 100.0
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 100.0
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 100.0
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 100.0
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 100.0
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 100.0
KOG2305|consensus313 100.0
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 100.0
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 100.0
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 100.0
KOG1683|consensus 380 99.95
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 99.92
KOG0409|consensus327 99.86
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 99.85
PRK08268507 3-hydroxy-acyl-CoA dehydrogenase; Validated 99.85
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 99.84
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 99.81
TIGR01692288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 99.8
PRK15059292 tartronate semialdehyde reductase; Provisional 99.79
PRK07417279 arogenate dehydrogenase; Reviewed 99.77
PLN02350 493 phosphogluconate dehydrogenase (decarboxylating) 99.75
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 99.74
PLN02858 1378 fructose-bisphosphate aldolase 99.73
PRK06545 359 prephenate dehydrogenase; Validated 99.73
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 99.72
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 99.71
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 99.71
PRK08655 437 prephenate dehydrogenase; Provisional 99.71
PLN02688266 pyrroline-5-carboxylate reductase 99.71
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 99.7
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 99.7
PTZ00142 470 6-phosphogluconate dehydrogenase; Provisional 99.7
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 99.68
PRK08507275 prephenate dehydrogenase; Validated 99.66
TIGR03026 411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 99.66
PRK11064 415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 99.66
TIGR00873 467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 99.65
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 99.65
PRK07502307 cyclohexadienyl dehydrogenase; Validated 99.65
PLN02858 1378 fructose-bisphosphate aldolase 99.65
PRK15057 388 UDP-glucose 6-dehydrogenase; Provisional 99.64
PLN02256304 arogenate dehydrogenase 99.62
PRK12557342 H(2)-dependent methylenetetrahydromethanopterin de 99.62
PF02153258 PDH: Prephenate dehydrogenase; InterPro: IPR003099 99.59
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 99.59
PRK09287 459 6-phosphogluconate dehydrogenase; Validated 99.58
TIGR02279503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 99.58
PRK08818 370 prephenate dehydrogenase; Provisional 99.58
COG1004 414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 99.56
PRK15182 425 Vi polysaccharide biosynthesis protein TviB; Provi 99.56
PRK14806 735 bifunctional cyclohexadienyl dehydrogenase/ 3-phos 99.5
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 99.49
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 99.47
PLN02712667 arogenate dehydrogenase 99.43
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 99.43
COG0677 436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas 99.4
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid 99.4
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.39
PRK07680273 late competence protein ComER; Validated 99.39
TIGR01724341 hmd_rel H2-forming N(5),N(10)-methenyltetrahydrome 99.39
PLN02353 473 probable UDP-glucose 6-dehydrogenase 99.38
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 99.37
PRK05479330 ketol-acid reductoisomerase; Provisional 99.36
PLN02712 667 arogenate dehydrogenase 99.35
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.3
PTZ00431260 pyrroline carboxylate reductase; Provisional 99.24
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 99.23
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 99.21
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 99.2
PF0072597 3HCDH: 3-hydroxyacyl-CoA dehydrogenase, C-terminal 99.2
PRK08229341 2-dehydropantoate 2-reductase; Provisional 99.18
cd05297 423 GH4_alpha_glucosidase_galactosidase Glycoside Hydr 99.17
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 99.15
COG0362 473 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate 99.12
TIGR00465314 ilvC ketol-acid reductoisomerase. This is the seco 99.11
COG1023300 Gnd Predicted 6-phosphogluconate dehydrogenase [Ca 99.09
PRK06444197 prephenate dehydrogenase; Provisional 99.0
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 98.98
PRK12439341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 98.96
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 98.96
PTZ00345 365 glycerol-3-phosphate dehydrogenase; Provisional 98.94
TIGR00112245 proC pyrroline-5-carboxylate reductase. This enzym 98.93
TIGR03376342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 98.9
COG4007340 Predicted dehydrogenase related to H2-forming N5,N 98.86
PTZ00082321 L-lactate dehydrogenase; Provisional 98.85
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 98.82
COG2085211 Predicted dinucleotide-binding enzymes [General fu 98.81
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 98.8
PRK06223307 malate dehydrogenase; Reviewed 98.74
PTZ00117319 malate dehydrogenase; Provisional 98.73
TIGR02441737 fa_ox_alpha_mit fatty acid oxidation complex, alph 98.69
PRK12921305 2-dehydropantoate 2-reductase; Provisional 98.66
PRK12480330 D-lactate dehydrogenase; Provisional 98.65
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 98.51
KOG2380|consensus 480 98.49
PRK11861 673 bifunctional prephenate dehydrogenase/3-phosphoshi 98.47
KOG2653|consensus 487 98.46
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 98.45
TIGR02440699 FadJ fatty oxidation complex, alpha subunit FadJ. 98.43
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 98.42
PRK13243333 glyoxylate reductase; Reviewed 98.4
PRK11154708 fadJ multifunctional fatty acid oxidation complex 98.4
PRK06249313 2-dehydropantoate 2-reductase; Provisional 98.39
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 98.38
PRK13403335 ketol-acid reductoisomerase; Provisional 98.37
PRK07574385 formate dehydrogenase; Provisional 98.37
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 98.37
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 98.34
PLN03139386 formate dehydrogenase; Provisional 98.32
PRK06436303 glycerate dehydrogenase; Provisional 98.27
PRK11730715 fadB multifunctional fatty acid oxidation complex 98.22
KOG2711|consensus372 98.15
PRK08605332 D-lactate dehydrogenase; Validated 98.15
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 98.07
TIGR01327 525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 98.07
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 98.06
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 98.05
KOG2666|consensus 481 98.05
TIGR02437714 FadB fatty oxidation complex, alpha subunit FadB. 98.05
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 97.99
PRK13581 526 D-3-phosphoglycerate dehydrogenase; Provisional 97.96
PLN02928347 oxidoreductase family protein 97.93
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.88
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 97.85
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 97.84
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 97.84
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 97.82
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 97.78
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 97.74
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 97.72
PRK06932314 glycerate dehydrogenase; Provisional 97.7
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 97.7
PRK08306296 dipicolinate synthase subunit A; Reviewed 97.7
PRK06487317 glycerate dehydrogenase; Provisional 97.7
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 97.68
TIGR00745293 apbA_panE 2-dehydropantoate 2-reductase. This mode 97.68
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 97.66
KOG3124|consensus267 97.63
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.61
PRK15076 431 alpha-galactosidase; Provisional 97.61
PRK13302271 putative L-aspartate dehydrogenase; Provisional 97.6
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 97.6
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 97.59
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 97.57
PRK13304265 L-aspartate dehydrogenase; Reviewed 97.56
PLN02306386 hydroxypyruvate reductase 97.49
PRK06141314 ornithine cyclodeaminase; Validated 97.48
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 97.47
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 97.46
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 97.46
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.46
PRK00961342 H(2)-dependent methylenetetrahydromethanopterin de 97.45
TIGR01723340 hmd_TIGR 5,10-methenyltetrahydromethanopterin hydr 97.39
PRK04148134 hypothetical protein; Provisional 97.39
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 97.36
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 97.35
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 97.34
PLN02602350 lactate dehydrogenase 97.31
PRK05708305 2-dehydropantoate 2-reductase; Provisional 97.25
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 97.24
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 97.24
PTZ00075476 Adenosylhomocysteinase; Provisional 97.23
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 97.23
PLN02494477 adenosylhomocysteinase 97.22
PRK05225 487 ketol-acid reductoisomerase; Validated 97.22
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 97.21
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 97.16
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 97.12
COG0569225 TrkA K+ transport systems, NAD-binding component [ 97.11
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 97.05
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 97.05
PRK08618325 ornithine cyclodeaminase; Validated 97.02
PRK03659601 glutathione-regulated potassium-efflux system prot 97.0
PRK12549284 shikimate 5-dehydrogenase; Reviewed 96.98
PRK07340304 ornithine cyclodeaminase; Validated 96.98
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 96.92
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 96.9
COG0059338 IlvC Ketol-acid reductoisomerase [Amino acid trans 96.88
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 96.79
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 96.78
KOG0069|consensus336 96.76
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 96.76
COG0039313 Mdh Malate/lactate dehydrogenases [Energy producti 96.76
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 96.75
PRK10669558 putative cation:proton antiport protein; Provision 96.74
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 96.72
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 96.72
PLN00112444 malate dehydrogenase (NADP); Provisional 96.68
PF02423313 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst 96.64
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 96.64
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 96.61
COG0300265 DltE Short-chain dehydrogenases of various substra 96.61
PLN00106323 malate dehydrogenase 96.56
PRK06407301 ornithine cyclodeaminase; Provisional 96.56
PRK09496 453 trkA potassium transporter peripheral membrane com 96.54
PRK08291330 ectoine utilization protein EutC; Validated 96.54
COG2423330 Predicted ornithine cyclodeaminase, mu-crystallin 96.5
PRK03562621 glutathione-regulated potassium-efflux system prot 96.46
cd05197 425 GH4_glycoside_hydrolases Glycoside Hydrases Family 96.44
PRK06823315 ornithine cyclodeaminase; Validated 96.43
TIGR01757387 Malate-DH_plant malate dehydrogenase, NADP-depende 96.4
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehy 96.4
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 96.39
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 96.39
cd05298 437 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; 96.38
KOG1683|consensus380 96.36
PLN00203519 glutamyl-tRNA reductase 96.35
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 96.34
TIGR01759323 MalateDH-SF1 malate dehydrogenase. This model repr 96.34
PRK00683 418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.31
PRK05442326 malate dehydrogenase; Provisional 96.27
KOG1201|consensus300 96.26
PRK00048257 dihydrodipicolinate reductase; Provisional 96.25
TIGR01772312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 96.25
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 96.23
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 96.23
PRK06046326 alanine dehydrogenase; Validated 96.21
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 96.21
PRK09496453 trkA potassium transporter peripheral membrane com 96.16
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 96.16
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 96.11
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 96.11
PRK07589346 ornithine cyclodeaminase; Validated 96.11
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 96.09
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 96.04
CHL00194317 ycf39 Ycf39; Provisional 96.04
cd05296 419 GH4_P_beta_glucosidase Glycoside Hydrolases Family 96.03
TIGR01771299 L-LDH-NAD L-lactate dehydrogenase. This model repr 96.01
PRK05993277 short chain dehydrogenase; Provisional 95.99
COG2910211 Putative NADH-flavin reductase [General function p 95.97
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.9
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 95.89
PRK08340259 glucose-1-dehydrogenase; Provisional 95.89
PRK06718202 precorrin-2 dehydrogenase; Reviewed 95.88
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 95.87
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 95.87
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 95.86
PRK06182273 short chain dehydrogenase; Validated 95.84
PLN02253280 xanthoxin dehydrogenase 95.83
PTZ00325321 malate dehydrogenase; Provisional 95.83
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 95.83
PRK08339263 short chain dehydrogenase; Provisional 95.82
PRK08862227 short chain dehydrogenase; Provisional 95.82
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 95.81
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 95.81
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 95.78
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 95.73
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.71
PRK06199379 ornithine cyclodeaminase; Validated 95.7
PRK08265261 short chain dehydrogenase; Provisional 95.68
TIGR01758324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 95.65
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 95.65
PRK12828239 short chain dehydrogenase; Provisional 95.59
PRK05086312 malate dehydrogenase; Provisional 95.57
KOG1014|consensus312 95.57
PRK13940414 glutamyl-tRNA reductase; Provisional 95.54
PRK07890258 short chain dehydrogenase; Provisional 95.5
PRK09186256 flagellin modification protein A; Provisional 95.49
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 95.48
PRK07814263 short chain dehydrogenase; Provisional 95.46
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.45
PRK07825273 short chain dehydrogenase; Provisional 95.42
PLN03209 576 translocon at the inner envelope of chloroplast su 95.4
PRK09242257 tropinone reductase; Provisional 95.39
PRK05867253 short chain dehydrogenase; Provisional 95.38
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.32
COG0499420 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me 95.31
PRK08643256 acetoin reductase; Validated 95.3
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 95.3
PRK06172253 short chain dehydrogenase; Provisional 95.29
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.29
PRK13301267 putative L-aspartate dehydrogenase; Provisional 95.29
PRK07454241 short chain dehydrogenase; Provisional 95.28
TIGR00036266 dapB dihydrodipicolinate reductase. 95.27
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 95.26
PLN02516299 methylenetetrahydrofolate dehydrogenase (NADP+) 95.26
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 95.26
PRK07326237 short chain dehydrogenase; Provisional 95.25
PRK07062265 short chain dehydrogenase; Provisional 95.25
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 95.25
PRK06194287 hypothetical protein; Provisional 95.24
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.22
KOG1495|consensus332 95.2
PRK06139330 short chain dehydrogenase; Provisional 95.17
PRK05866293 short chain dehydrogenase; Provisional 95.17
PRK08267260 short chain dehydrogenase; Provisional 95.15
PRK07109334 short chain dehydrogenase; Provisional 95.14
TIGR01921324 DAP-DH diaminopimelate dehydrogenase. This model r 95.13
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 95.13
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.12
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 95.12
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 95.1
PRK14170284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.1
PRK06124256 gluconate 5-dehydrogenase; Provisional 95.09
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.08
PRK05876275 short chain dehydrogenase; Provisional 95.07
PRK06949258 short chain dehydrogenase; Provisional 95.07
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.06
PRK07063260 short chain dehydrogenase; Provisional 95.04
PRK06196315 oxidoreductase; Provisional 95.02
PRK12939250 short chain dehydrogenase; Provisional 95.02
PRK05884223 short chain dehydrogenase; Provisional 95.02
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.01
PRK06138252 short chain dehydrogenase; Provisional 95.0
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.0
PRK07478254 short chain dehydrogenase; Provisional 94.98
PRK05872296 short chain dehydrogenase; Provisional 94.98
PRK06180277 short chain dehydrogenase; Provisional 94.97
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 94.96
PRK07102243 short chain dehydrogenase; Provisional 94.93
PRK12548289 shikimate 5-dehydrogenase; Provisional 94.88
PRK14166282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.86
PRK06101240 short chain dehydrogenase; Provisional 94.85
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 94.84
PRK07677252 short chain dehydrogenase; Provisional 94.84
PF13561241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 94.84
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.83
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.83
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.83
PRK10538248 malonic semialdehyde reductase; Provisional 94.83
PRK07523255 gluconate 5-dehydrogenase; Provisional 94.81
PRK12829264 short chain dehydrogenase; Provisional 94.81
PRK05854313 short chain dehydrogenase; Provisional 94.75
PRK08085254 gluconate 5-dehydrogenase; Provisional 94.74
PRK07831262 short chain dehydrogenase; Provisional 94.73
PRK07774250 short chain dehydrogenase; Provisional 94.72
PRK14171288 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.72
PRK08589272 short chain dehydrogenase; Validated 94.71
PRK14187294 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.68
PRK14182282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.67
PRK06057255 short chain dehydrogenase; Provisional 94.64
PRK08703239 short chain dehydrogenase; Provisional 94.64
PRK04207341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 94.63
PRK07067257 sorbitol dehydrogenase; Provisional 94.63
PRK14193284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.59
PRK06179270 short chain dehydrogenase; Provisional 94.57
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 94.56
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.56
PRK06197306 short chain dehydrogenase; Provisional 94.49
PLN02616364 tetrahydrofolate dehydrogenase/cyclohydrolase, put 94.46
PRK08213259 gluconate 5-dehydrogenase; Provisional 94.45
PLN02897345 tetrahydrofolate dehydrogenase/cyclohydrolase, put 94.45
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.44
PRK06114254 short chain dehydrogenase; Provisional 94.43
PRK05693274 short chain dehydrogenase; Provisional 94.43
PF13380116 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 94.42
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 94.4
PRK08251248 short chain dehydrogenase; Provisional 94.4
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 94.39
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 94.39
PRK06720169 hypothetical protein; Provisional 94.39
PRK06940275 short chain dehydrogenase; Provisional 94.38
PRK05717255 oxidoreductase; Validated 94.34
PRK14181287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.34
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.32
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 94.32
PRK07074257 short chain dehydrogenase; Provisional 94.29
PRK09072263 short chain dehydrogenase; Provisional 94.28
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 94.28
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 94.27
PRK07832272 short chain dehydrogenase; Provisional 94.26
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.24
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.21
COG4074343 Mth H2-forming N5,N10-methylenetetrahydromethanopt 94.21
PRK06719157 precorrin-2 dehydrogenase; Validated 94.2
PRK07453322 protochlorophyllide oxidoreductase; Validated 94.2
TIGR01289314 LPOR light-dependent protochlorophyllide reductase 94.16
PRK08177225 short chain dehydrogenase; Provisional 94.14
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 94.12
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.12
PRK06924251 short chain dehydrogenase; Provisional 94.11
PRK06914280 short chain dehydrogenase; Provisional 94.08
PRK08277278 D-mannonate oxidoreductase; Provisional 94.07
PRK08263275 short chain dehydrogenase; Provisional 94.05
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 94.01
PRK05599246 hypothetical protein; Provisional 94.01
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 94.0
PRK06483236 dihydromonapterin reductase; Provisional 94.0
KOG1370|consensus434 93.99
PRK08017256 oxidoreductase; Provisional 93.97
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 93.95
PRK06953222 short chain dehydrogenase; Provisional 93.94
PRK06500249 short chain dehydrogenase; Provisional 93.93
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 93.93
PRK05650270 short chain dehydrogenase; Provisional 93.89
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 93.89
PRK05855582 short chain dehydrogenase; Validated 93.89
PRK07576264 short chain dehydrogenase; Provisional 93.88
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.84
PRK14027283 quinate/shikimate dehydrogenase; Provisional 93.81
PRK13303265 L-aspartate dehydrogenase; Provisional 93.8
PRK07060245 short chain dehydrogenase; Provisional 93.79
PF02056183 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterP 93.77
PRK07097265 gluconate 5-dehydrogenase; Provisional 93.75
PRK07775274 short chain dehydrogenase; Provisional 93.75
TIGR02415254 23BDH acetoin reductases. One member of this famil 93.72
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase 93.69
COG1486 442 CelF Alpha-galactosidases/6-phospho-beta-glucosida 93.68
PRK07035252 short chain dehydrogenase; Provisional 93.67
PRK07024257 short chain dehydrogenase; Provisional 93.64
PRK14174295 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.63
PRK12409 410 D-amino acid dehydrogenase small subunit; Provisio 93.63
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 93.61
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 93.6
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 93.57
PRK06482276 short chain dehydrogenase; Provisional 93.56
PRK12550272 shikimate 5-dehydrogenase; Reviewed 93.53
PRK14168297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.47
PRK14184286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.46
PRK08303305 short chain dehydrogenase; Provisional 93.45
COG0673342 MviM Predicted dehydrogenases and related proteins 93.45
PRK06181263 short chain dehydrogenase; Provisional 93.44
KOG1200|consensus256 93.4
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 93.39
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 93.36
PRK06841255 short chain dehydrogenase; Provisional 93.35
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 93.35
PRK06484520 short chain dehydrogenase; Validated 93.34
PRK05562223 precorrin-2 dehydrogenase; Provisional 93.3
PRK08219227 short chain dehydrogenase; Provisional 93.28
PRK05875276 short chain dehydrogenase; Provisional 93.2
PLN02968381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 93.19
PRK09134258 short chain dehydrogenase; Provisional 93.18
PRK14185293 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.14
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 93.11
PRK08628258 short chain dehydrogenase; Provisional 93.07
COG4091 438 Predicted homoserine dehydrogenase [Amino acid tra 93.04
PRK06125259 short chain dehydrogenase; Provisional 93.0
PRK05600370 thiamine biosynthesis protein ThiF; Validated 92.98
PLN02780320 ketoreductase/ oxidoreductase 92.87
PRK08223287 hypothetical protein; Validated 92.86
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 92.85
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 92.84
PRK14167297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.76
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 92.74
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 92.74
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 92.73
PRK07904253 short chain dehydrogenase; Provisional 92.71
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.71
PRK08226263 short chain dehydrogenase; Provisional 92.7
PRK12746254 short chain dehydrogenase; Provisional 92.7
KOG1502|consensus327 92.61
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 92.57
PRK06198260 short chain dehydrogenase; Provisional 92.56
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 92.55
PRK09135249 pteridine reductase; Provisional 92.54
PRK06484 520 short chain dehydrogenase; Validated 92.53
PRK07069251 short chain dehydrogenase; Validated 92.5
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 92.46
PRK12743256 oxidoreductase; Provisional 92.43
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 92.42
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 92.42
KOG0725|consensus270 92.38
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 92.33
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 92.33
PRK07877 722 hypothetical protein; Provisional 92.26
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 92.25
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 92.25
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.24
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 92.22
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 92.12
PRK07201657 short chain dehydrogenase; Provisional 92.1
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 92.1
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 92.03
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 91.99
PLN02214342 cinnamoyl-CoA reductase 91.97
PRK08300302 acetaldehyde dehydrogenase; Validated 91.96
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 91.94
PRK06732229 phosphopantothenate--cysteine ligase; Validated 91.92
KOG1205|consensus282 91.89
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 91.88
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 91.87
PRK14982340 acyl-ACP reductase; Provisional 91.86
PRK08278273 short chain dehydrogenase; Provisional 91.81
PRK00436343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 91.81
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 91.8
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 91.78
PRK07791286 short chain dehydrogenase; Provisional 91.7
PF03720106 UDPG_MGDP_dh_C: UDP-glucose/GDP-mannose dehydrogen 91.68
PLN02427386 UDP-apiose/xylose synthase 91.67
PRK09291257 short chain dehydrogenase; Provisional 91.64
PF10728132 DUF2520: Domain of unknown function (DUF2520); Int 91.63
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 91.62
PRK12747252 short chain dehydrogenase; Provisional 91.59
PRK06123248 short chain dehydrogenase; Provisional 91.57
PRK10637 457 cysG siroheme synthase; Provisional 91.56
TIGR01850346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 91.55
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
Probab=100.00  E-value=5.7e-51  Score=371.39  Aligned_cols=236  Identities=28%  Similarity=0.500  Sum_probs=216.5

Q ss_pred             CCccceEEE--ccccHHHHHHHHHCCCeEEEEeCChHHHHHHHHHHHhhhhhhhhcccccCCCCCccCCceeEEeecchH
Q psy13746         11 GGFYPDGII--GLIGQAWAMIFASAGYKVSLYDVLSEQIENAKNTIQHTLQDYHQKGCLKGSLSPAHAGYKVSLYDVLSE   88 (294)
Q Consensus        11 ~~~~~i~ii--G~mG~~iA~~~~~~G~~V~~~d~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~v~~~d~~~~   88 (294)
                      +.+++|+||  |.||++||.+++.+|++|++||++++.++.+.+++.                                 
T Consensus         5 ~~i~~VaVIGaG~MG~giA~~~a~aG~~V~l~D~~~~~~~~~~~~i~---------------------------------   51 (321)
T PRK07066          5 TDIKTFAAIGSGVIGSGWVARALAHGLDVVAWDPAPGAEAALRANVA---------------------------------   51 (321)
T ss_pred             CCCCEEEEECcCHHHHHHHHHHHhCCCeEEEEeCCHHHHHHHHHHHH---------------------------------
Confidence            467899999  999999999999999999999999999887766554                                 


Q ss_pred             HHHHHHHHHHHHHHHHHhccccCCCCChhhhccCeeeccChhhhccCCcEEEEcCCcchHHHHHHHHHHhcccCCCeEEE
Q psy13746         89 QIENAKNTIQHTLQDYHQKGCLKGSLSPEEQFGLISGTPVLRECLEDAIFIQESVPEILQIKHQVYRAIDIFMSSNTILS  168 (294)
Q Consensus        89 ~~~~~~~~~~~~l~~~~~~g~~~~~~~~~~~~~~i~~~~~~~~a~~~aDlVieavpe~~~~k~~~~~~l~~~~~~~~ii~  168 (294)
                                +.++.+.+.|.     ......+++++++++++++++||+||||+||++++|+++|+++++.+++++||+
T Consensus        52 ----------~~~~~~~~~~~-----~~~~~~~~i~~~~~l~~av~~aDlViEavpE~l~vK~~lf~~l~~~~~~~aIla  116 (321)
T PRK07066         52 ----------NAWPALERQGL-----APGASPARLRFVATIEACVADADFIQESAPEREALKLELHERISRAAKPDAIIA  116 (321)
T ss_pred             ----------HHHHHHHHcCC-----ChhhHHhhceecCCHHHHhcCCCEEEECCcCCHHHHHHHHHHHHHhCCCCeEEE
Confidence                      33444444442     223455678889999889999999999999999999999999999999999999


Q ss_pred             ecCCCCCHHHHHhhcCCCCceeeeeecCCCCCCCeEEEecCCCCCHHHHHHHHHHHHHcCCeeEEEcccccccHHHHHHH
Q psy13746        169 SSTSSFLPSVLSEHSTHRSQFIVAHPVNPPYFIPLVEIVPAAWTSERVITRTREIMTEIGMKPVTLTTEIRGFALNRIQF  248 (294)
Q Consensus       169 s~tSt~~~~~ia~~l~~~~~~ig~h~~~p~~~~~lveiv~g~~t~~e~~~~~~~ll~~lG~~~v~v~~~~~g~v~nri~~  248 (294)
                      ||||+++++++++.+.+|.|++|+|||||++..+++||++|+.|++++++.+..|++.+|++|+++.+|.|||++||++.
T Consensus       117 SnTS~l~~s~la~~~~~p~R~~g~HffnP~~~~pLVEVv~g~~T~~e~~~~~~~f~~~lGk~pV~v~kd~pGFi~NRl~~  196 (321)
T PRK07066        117 SSTSGLLPTDFYARATHPERCVVGHPFNPVYLLPLVEVLGGERTAPEAVDAAMGIYRALGMRPLHVRKEVPGFIADRLLE  196 (321)
T ss_pred             ECCCccCHHHHHHhcCCcccEEEEecCCccccCceEEEeCCCCCCHHHHHHHHHHHHHcCCEeEecCCCCccHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999967999999999999


Q ss_pred             HHHHHHHHHHHcCCCCHHHHHHHHHcccCCCcCCCChhhhhcccCC
Q psy13746        249 AVLNECYHLVHDGVLSAKDIDRVMSEGLGLRYAFLGPLETIHLNSA  294 (294)
Q Consensus       249 a~~~Ea~~l~~~~~~~~~~id~a~~~g~g~~~~~~Gp~~~~D~~~~  294 (294)
                      ++++||++++++|.++++|||++++.|+|++|+.+|||+++|++|.
T Consensus       197 a~~~EA~~lv~eGvas~edID~a~~~g~g~r~~~~Gpf~~~Dl~Gl  242 (321)
T PRK07066        197 ALWREALHLVNEGVATTGEIDDAIRFGAGIRWSFMGTFLTYTLAGG  242 (321)
T ss_pred             HHHHHHHHHHHhCCCCHHHHHHHHHhCCCCCccCcCHHHHhhhcCh
Confidence            9999999999999999999999999999999999999999999873



>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG2304|consensus Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08269 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG2305|consensus Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>KOG1683|consensus Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>KOG0409|consensus Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>PRK12557 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase-related protein; Provisional Back     alignment and domain information
>PF02153 PDH: Prephenate dehydrogenase; InterPro: IPR003099 Members of this family are prephenate dehydrogenases 1 Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK09287 6-phosphogluconate dehydrogenase; Validated Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>TIGR01724 hmd_rel H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase-related protein Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PF00725 3HCDH: 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain; InterPro: IPR006108 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>COG0362 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK06444 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00112 proC pyrroline-5-carboxylate reductase Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>COG4007 Predicted dehydrogenase related to H2-forming N5,N10-methylenetetrahydromethanopterin dehydrogenase [General function prediction only] Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>KOG2380|consensus Back     alignment and domain information
>PRK11861 bifunctional prephenate dehydrogenase/3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>KOG2653|consensus Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>KOG2711|consensus Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>KOG2666|consensus Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR00745 apbA_panE 2-dehydropantoate 2-reductase Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>KOG3124|consensus Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK15076 alpha-galactosidase; Provisional Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK00961 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase; Provisional Back     alignment and domain information
>TIGR01723 hmd_TIGR 5,10-methenyltetrahydromethanopterin hydrogenase Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PRK05225 ketol-acid reductoisomerase; Validated Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>KOG0069|consensus Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PLN00112 malate dehydrogenase (NADP); Provisional Back     alignment and domain information
>PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism] Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>cd05197 GH4_glycoside_hydrolases Glycoside Hydrases Family 4 Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>cd05298 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- and pagL-like glycosidases Back     alignment and domain information
>KOG1683|consensus Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>KOG1201|consensus Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PRK07589 ornithine cyclodeaminase; Validated Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase Back     alignment and domain information
>TIGR01771 L-LDH-NAD L-lactate dehydrogenase Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06199 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>KOG1014|consensus Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>KOG1495|consensus Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG4074 Mth H2-forming N5,N10-methylenetetrahydromethanopterin dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>KOG1370|consensus Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF02056 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterPro: IPR001088 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] Back     alignment and domain information
>COG1486 CelF Alpha-galactosidases/6-phospho-beta-glucosidases, family 4 of glycosyl hydrolases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1200|consensus Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG4091 Predicted homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1502|consensus Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>KOG0725|consensus Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK07877 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06732 phosphopantothenate--cysteine ligase; Validated Back     alignment and domain information
>KOG1205|consensus Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF03720 UDPG_MGDP_dh_C: UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain; InterPro: IPR014027 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF10728 DUF2520: Domain of unknown function (DUF2520); InterPro: IPR018931 This presumed domain is found C-terminal to a Rossmann-like domain suggesting that these proteins are oxidoreductases Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10637 cysG siroheme synthase; Provisional Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query294
3f3s_A313 The Crystal Structure Of Human Lambda-Crystallin, C 5e-53
3ado_A319 Crystal Structure Of The Rabbit L-Gulonate 3-Dehydr 3e-51
1zej_A293 Crystal Structure Of The 3-Hydroxyacyl-Coa Dehydrog 5e-12
4dyd_A283 Substrate-Directed Dual Catalysis Of Dicarbonyl Com 6e-12
3hdh_A302 Pig Heart Short Chain L-3-Hydroxyacyl Coa Dehydroge 4e-10
1f12_A310 L-3-Hydroxyacyl-Coa Dehydrogenase Complexed With 3- 6e-10
1lso_A302 Crystal Structure Of The S137a Mutant Of L-3-Hydrox 1e-09
1f0y_A302 L-3-Hydroxyacyl-Coa Dehydrogenase Complexed With Ac 1e-09
1m76_A302 Crystal Structure Of The S137c Mutant Of L-3-Hydrox 2e-09
1lsj_A302 Crystal Structure Of The E110q Mutant Of L-3-hydrox 2e-09
1il0_A302 X-Ray Crystal Structure Of The E170q Mutant Of Huma 2e-09
1m75_A302 Crystal Structure Of The N208s Mutant Of L-3-Hydrox 5e-09
3had_A308 Biochemical Characterization And Structure Determin 1e-08
3rqs_A324 Crystal Structure Of Human L-3- Hydroxyacyl-Coa Deh 4e-08
2wtb_A 725 Arabidopsis Thaliana Multifuctional Protein, Mfp2 L 2e-07
2hdh_A293 Biochemical Characterization And Structure Determin 7e-07
3mog_A 483 Crystal Structure Of 3-Hydroxybutyryl-Coa Dehydroge 5e-06
1zcj_A 463 Crystal Structure Of 3-Hydroxyacyl-Coa Dehydrogenas 4e-05
2x58_A 727 The Crystal Structure Of Mfe1 Liganded With Coa Len 5e-05
3zwb_A 742 Crystal Structure Of Rat Peroxisomal Multifunctiona 5e-05
3zw8_A 742 Crystal Structure Of Rat Peroxisomal Multifunctiona 6e-05
1wdk_A 715 Fatty Acid Beta-Oxidation Multienzyme Complex From 3e-04
>pdb|3F3S|A Chain A, The Crystal Structure Of Human Lambda-Crystallin, Cryl1 Length = 313 Back     alignment and structure

Iteration: 1

Score = 204 bits (519), Expect = 5e-53, Method: Compositional matrix adjust. Identities = 107/274 (39%), Positives = 152/274 (55%), Gaps = 43/274 (15%) Query: 20 GLIGQAWAMIFASAGYKVSLYDVLSEQIENAKNTIQHTLQDYHQKGCLKGSLSPAHAGYK 79 G+IG++WAM+FAS G ++ Sbjct: 12 GVIGRSWAMLFASGG-------------------------------------------FQ 28 Query: 80 VSLYDVLSEQIENAKNTIQHTLQDYHQKGCLKGSLSPEEQFGLISGTPVLRECLEDAIFI 139 V LYD+ +QI NA I+ ++ Q G LKGSLS EEQ LISG P ++E +E A+ I Sbjct: 29 VKLYDIEQQQIRNALENIRKEMKLLEQAGSLKGSLSVEEQLSLISGCPNIQEAVEGAMHI 88 Query: 140 QESVPEILQIKHQVYRAIDIFMXXXXXXXXXXXXXXXXXXXEHSTHRSQFIVAHPVNPPY 199 QE VPE L++K +++ +D + H Q IVAHPVNPPY Sbjct: 89 QECVPEDLELKKKIFAQLDSIIDDRVILSSSTSCLMPSKLFAGLVHVKQCIVAHPVNPPY 148 Query: 200 FIPLVEIVPAAWTSERVITRTREIMTEIGMKPVTLTTEIRGFALNRIQFAVLNECYHLVH 259 +IPLVE+VP T+ + RT +M +IG P+ + E+ GF LNR+Q+A+++E + LV Sbjct: 149 YIPLVELVPHPETAPTTVDRTHALMKKIGQCPMRVQKEVAGFVLNRLQYAIISEAWRLVE 208 Query: 260 DGVLSAKDIDRVMSEGLGLRYAFLGPLETIHLNS 293 +G++S D+D VMSEGLG+RYAF+GPLET+HLN+ Sbjct: 209 EGIVSPSDLDLVMSEGLGMRYAFIGPLETMHLNA 242
>pdb|3ADO|A Chain A, Crystal Structure Of The Rabbit L-Gulonate 3-Dehydrogenase Length = 319 Back     alignment and structure
>pdb|1ZEJ|A Chain A, Crystal Structure Of The 3-Hydroxyacyl-Coa Dehydrogenase (Hbd-9, Af2017) From Archaeoglobus Fulgidus Dsm 4304 At 2.00 A Resolution Length = 293 Back     alignment and structure
>pdb|4DYD|A Chain A, Substrate-Directed Dual Catalysis Of Dicarbonyl Compounds By Diketoreductase Length = 283 Back     alignment and structure
>pdb|3HDH|A Chain A, Pig Heart Short Chain L-3-Hydroxyacyl Coa Dehydrogenase Revisited: Sequence Analysis And Crystal Structure Determination Length = 302 Back     alignment and structure
>pdb|1F12|A Chain A, L-3-Hydroxyacyl-Coa Dehydrogenase Complexed With 3- Hydroxybutyryl-Coa Length = 310 Back     alignment and structure
>pdb|1LSO|A Chain A, Crystal Structure Of The S137a Mutant Of L-3-Hydroxyacyl- Coa Dehydrogenase In Complex With Nad Length = 302 Back     alignment and structure
>pdb|1F0Y|A Chain A, L-3-Hydroxyacyl-Coa Dehydrogenase Complexed With Acetoacetyl-Coa And Nad+ Length = 302 Back     alignment and structure
>pdb|1M76|A Chain A, Crystal Structure Of The S137c Mutant Of L-3-Hydroxyacyl- Coa Dehydrogenase In Complex With Nad And Acetoacetyl-Coa Length = 302 Back     alignment and structure
>pdb|1LSJ|A Chain A, Crystal Structure Of The E110q Mutant Of L-3-hydroxyacyl- Coa Dehydrogenase In Complex With Nad Length = 302 Back     alignment and structure
>pdb|1IL0|A Chain A, X-Ray Crystal Structure Of The E170q Mutant Of Human L-3- Hydroxyacyl-Coa Dehydrogenase Length = 302 Back     alignment and structure
>pdb|1M75|A Chain A, Crystal Structure Of The N208s Mutant Of L-3-Hydroxyacyl- Coa Dehydrogenase In Complex With Nad And Acetoacetyl-Coa Length = 302 Back     alignment and structure
>pdb|3HAD|A Chain A, Biochemical Characterization And Structure Determination Of Human Heart Short Chain L-3-Hydroxyacyl Coa Dehydrogenase Provide Insight Into Catalytic Mechanism Length = 308 Back     alignment and structure
>pdb|3RQS|A Chain A, Crystal Structure Of Human L-3- Hydroxyacyl-Coa Dehydrogenase (Ec1.1.1.35) From Mitochondria At The Resolution 2.0 A, Northeast Structural Genomics Consortium Target Hr487, Mitochondrial Protein Partnership Length = 324 Back     alignment and structure
>pdb|2WTB|A Chain A, Arabidopsis Thaliana Multifuctional Protein, Mfp2 Length = 725 Back     alignment and structure
>pdb|2HDH|A Chain A, Biochemical Characterization And Structure Determination Of Human Heart Short Chain L-3-Hydroxyacyl Coa Dehydrogenase Provide Insight Into Catalytic Mechanism Length = 293 Back     alignment and structure
>pdb|3MOG|A Chain A, Crystal Structure Of 3-Hydroxybutyryl-Coa Dehydrogenase From Escherichia Coli K12 Substr. Mg1655 Length = 483 Back     alignment and structure
>pdb|1ZCJ|A Chain A, Crystal Structure Of 3-Hydroxyacyl-Coa Dehydrogenase Length = 463 Back     alignment and structure
>pdb|2X58|A Chain A, The Crystal Structure Of Mfe1 Liganded With Coa Length = 727 Back     alignment and structure
>pdb|3ZWB|A Chain A, Crystal Structure Of Rat Peroxisomal Multifunctional Enzyme Type 1 (rpmfe1) Complexed With 2trans-hexenoyl-coa Length = 742 Back     alignment and structure
>pdb|3ZW8|A Chain A, Crystal Structure Of Rat Peroxisomal Multifunctional Enzyme Type 1 (rpmfe1) In Apo Form Length = 742 Back     alignment and structure
>pdb|1WDK|A Chain A, Fatty Acid Beta-Oxidation Multienzyme Complex From Pseudomonas Fragi, Form I (Native2) Length = 715 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query294
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 1e-103
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 1e-39
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 2e-39
3mog_A483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 1e-16
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 3e-38
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 8e-29
3zwc_A 742 Peroxisomal bifunctional enzyme; beta oxidation pa 3e-28
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 4e-28
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 5e-28
3k6j_A 460 Protein F01G10.3, confirmed by transcript evidenc; 4e-24
3ctv_A110 HBD-10, 3-hydroxyacyl-COA dehydrogenase; structura 2e-06
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Length = 302 Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Length = 483 Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Length = 483 Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Length = 293 Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Length = 725 Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Length = 742 Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Length = 463 Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Length = 715 Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Length = 460 Back     alignment and structure
>3ctv_A HBD-10, 3-hydroxyacyl-COA dehydrogenase; structural genomics, APC7539, PSI-2, protein structure initiative; 2.46A {Archaeoglobus fulgidus dsm 4304} Length = 110 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query294
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 100.0
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 100.0
3k6j_A 460 Protein F01G10.3, confirmed by transcript evidenc; 100.0
3zwc_A 742 Peroxisomal bifunctional enzyme; beta oxidation pa 100.0
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 100.0
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 100.0
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 100.0
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 100.0
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 100.0
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 100.0
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 100.0
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 99.9
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 99.86
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 99.85
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 99.85
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 99.85
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 99.85
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 99.84
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 99.84
3qha_A296 Putative oxidoreductase; seattle structural genomi 99.84
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 99.83
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 99.83
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 99.82
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 99.8
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 99.79
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 99.78
3l6d_A306 Putative oxidoreductase; structural genomics, prot 99.77
4ezb_A317 Uncharacterized conserved protein; structural geno 99.75
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 99.74
4a7p_A 446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 99.74
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 99.73
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 99.73
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 99.73
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 99.72
3pid_A 432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 99.72
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 99.72
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 99.71
1vpd_A299 Tartronate semialdehyde reductase; structural geno 99.71
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 99.71
3ojo_A 431 CAP5O; rossmann fold, complex with cofactor NAD an 99.7
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 99.7
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 99.7
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 99.69
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 99.69
1yb4_A295 Tartronic semialdehyde reductase; structural genom 99.68
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 99.68
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 99.68
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 99.68
2q3e_A 467 UDP-glucose 6-dehydrogenase; hexamer, structural g 99.67
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 99.67
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 99.66
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 99.66
2i76_A276 Hypothetical protein; NADP, dehydrogenase, TM1727, 99.66
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 99.66
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 99.65
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 99.64
3mog_A483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 99.64
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 99.63
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 99.62
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 99.6
2o3j_A 481 UDP-glucose 6-dehydrogenase; structural genomics, 99.6
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 99.59
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 99.59
3vtf_A 444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 99.57
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 99.57
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 99.57
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 99.55
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 99.54
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 99.52
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 99.47
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 99.47
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 99.46
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 99.45
1dlj_A 402 UDP-glucose dehydrogenase; rossmann fold, ternary 99.41
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 99.41
3ctv_A110 HBD-10, 3-hydroxyacyl-COA dehydrogenase; structura 99.4
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 99.35
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 99.33
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 99.26
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 99.24
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 99.23
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 99.22
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 99.17
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 99.16
3fr7_A 525 Putative ketol-acid reductoisomerase (OS05G057370 99.1
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 99.09
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 99.08
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 98.62
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 99.04
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 99.0
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 98.93
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 98.89
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 98.83
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 98.81
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 98.79
1ygy_A 529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 98.78
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 98.77
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 98.77
3c7a_A 404 Octopine dehydrogenase; L) stereospecific opine de 98.76
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 98.75
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 98.74
4fgw_A 391 Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxi 98.73
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 98.73
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 98.72
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 98.69
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 98.67
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 98.67
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 98.62
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 98.58
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 98.57
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 98.57
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 98.53
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 98.52
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 98.52
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 98.5
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, o 98.49
3tl2_A315 Malate dehydrogenase; center for structural genomi 98.49
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 98.49
1obb_A 480 Maltase, alpha-glucosidase; glycosidase, sulfinic 98.49
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 98.49
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 98.48
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 98.47
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 98.47
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 98.46
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 98.45
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 98.44
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 98.43
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 98.43
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 98.4
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 98.36
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 98.36
3fef_A 450 Putative glucosidase LPLD; gulosidase, structural 98.35
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 98.35
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 98.35
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 98.35
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 98.35
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 98.34
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 98.32
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 98.32
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 98.31
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 98.31
1u8x_X 472 Maltose-6'-phosphate glucosidase; structural genom 98.29
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 98.26
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 98.26
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 98.25
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 98.24
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 98.23
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 98.22
1lss_A140 TRK system potassium uptake protein TRKA homolog; 98.2
3c85_A183 Putative glutathione-regulated potassium-efflux S 98.15
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 98.11
3oet_A381 Erythronate-4-phosphate dehydrogenase; structural 98.09
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 98.06
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 98.04
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 98.03
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 98.01
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 98.0
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 98.0
2o4c_A380 Erythronate-4-phosphate dehydrogenase; erythronate 98.0
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 98.0
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 97.99
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 97.98
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 97.97
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 97.95
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 97.95
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 97.94
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 97.93
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 97.91
1s6y_A 450 6-phospho-beta-glucosidase; hydrolase, structural 97.89
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 97.86
2rir_A300 Dipicolinate synthase, A chain; structural genomic 97.84
2duw_A145 Putative COA-binding protein; ligand binding prote 97.83
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 97.82
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 97.8
1id1_A153 Putative potassium channel protein; RCK domain, E. 97.79
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 97.79
2xxj_A310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 97.77
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 97.68
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 97.65
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 97.63
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 97.6
2b0j_A358 5,10-methenyltetrahydromethanopterin hydrogenase; 97.6
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 97.58
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 97.56
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 97.56
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 97.54
3zwc_A742 Peroxisomal bifunctional enzyme; beta oxidation pa 97.54
3uuw_A308 Putative oxidoreductase with NAD(P)-binding rossm 97.54
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 97.53
3q2i_A354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 97.51
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 97.51
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 97.5
3rc1_A350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 97.49
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 97.48
1wdk_A715 Fatty oxidation complex alpha subunit; alpha2BETA2 97.48
2wtb_A725 MFP2, fatty acid multifunctional protein (ATMFP2); 97.47
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 97.44
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 97.43
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 97.43
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 97.43
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 97.41
3euw_A344 MYO-inositol dehydrogenase; protein structure init 97.4
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 97.37
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 97.37
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 97.36
3e9m_A330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 97.36
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 97.33
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 97.33
3db2_A354 Putative NADPH-dependent oxidoreductase; two domai 97.31
3ec7_A357 Putative dehydrogenase; alpha-beta, structural gen 97.29
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 97.29
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 97.29
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 97.26
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 97.25
4hkt_A331 Inositol 2-dehydrogenase; structural genomics, nys 97.24
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 97.22
4h7p_A345 Malate dehydrogenase; ssgcid, structural G seattle 97.19
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 97.18
3ulk_A 491 Ketol-acid reductoisomerase; branched-chain amino 97.18
3c1a_A315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 97.12
3cea_A346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 97.11
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 97.08
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 97.07
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 97.05
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 97.05
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 97.05
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 97.04
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 97.04
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 97.01
1tlt_A319 Putative oxidoreductase (virulence factor MVIM HO; 96.97
3ezy_A344 Dehydrogenase; structural genomics, unknown functi 96.96
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 96.96
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 96.93
1iuk_A140 Hypothetical protein TT1466; structural genomics, 96.92
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 96.88
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 96.87
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 96.87
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 96.84
2glx_A332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 96.82
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 96.82
2ho3_A325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 96.82
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 96.81
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 96.81
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 96.8
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 96.8
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 96.78
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 96.77
1up7_A 417 6-phospho-beta-glucosidase; hydrolase, family4 hyd 96.77
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 96.77
3e18_A359 Oxidoreductase; dehydrogenase, NAD-binding, struct 96.76
2d59_A144 Hypothetical protein PH1109; COA binding, structur 96.73
4g65_A 461 TRK system potassium uptake protein TRKA; structur 96.73
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 96.72
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 96.69
3imf_A257 Short chain dehydrogenase; structural genomics, in 96.69
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 96.68
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 96.67
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 96.67
2p2s_A336 Putative oxidoreductase; YP_050235.1, structural g 96.66
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 96.65
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 96.65
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 96.65
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 96.63
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 96.61
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 96.61
3mz0_A344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 96.6
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 96.6
1xea_A323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 96.59
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 96.59
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 96.58
3cxt_A291 Dehydrogenase with different specificities; rossma 96.56
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 96.56
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 96.53
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 96.53
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 96.53
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 96.52
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 96.52
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 96.5
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 96.5
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 96.47
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 96.46
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 96.46
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 96.45
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 96.43
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 96.42
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 96.41
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 96.39
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 96.38
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 96.38
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 96.37
3rih_A293 Short chain dehydrogenase or reductase; structural 96.36
3evn_A329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 96.36
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 96.36
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 96.36
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 96.35
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 96.35
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 96.35
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 96.34
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 96.34
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 96.33
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 96.33
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 96.32
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 96.32
3hhp_A312 Malate dehydrogenase; MDH, citric acid cycle, TCA 96.31
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 96.3
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 96.29
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 96.28
1ydw_A362 AX110P-like protein; structural genomics, protein 96.28
1hye_A313 L-lactate/malate dehydrogenase; nucleotide binding 96.28
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 96.28
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 96.26
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 96.24
3u95_A 477 Glycoside hydrolase, family 4; hydrolysis, cytosol 96.24
4eso_A255 Putative oxidoreductase; NADP, structural genomics 96.24
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 96.23
1h6d_A433 Precursor form of glucose-fructose oxidoreductase; 96.22
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 96.21
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 96.21
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 96.2
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 96.2
3ohs_X334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 96.19
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 96.19
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 96.19
4dqx_A277 Probable oxidoreductase protein; structural genomi 96.18
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 96.18
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 96.18
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 96.17
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 96.15
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 96.15
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 96.15
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 96.14
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 96.14
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 96.13
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 96.13
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 96.12
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 96.12
3tox_A280 Short chain dehydrogenase; structural genomics, PS 96.12
3m2t_A359 Probable dehydrogenase; PSI, SGXNY, structural gen 96.11
1xkq_A280 Short-chain reductase family member (5D234); parra 96.11
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 96.1
3ius_A286 Uncharacterized conserved protein; APC63810, silic 96.1
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 96.08
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 96.08
1nff_A260 Putative oxidoreductase RV2002; directed evolution 96.07
1lnq_A336 MTHK channels, potassium channel related protein; 96.06
3tjr_A301 Short chain dehydrogenase; structural genomics, se 96.06
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 96.05
3slg_A372 PBGP3 protein; structural genomics, seattle struct 96.04
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 96.02
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 96.02
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 96.02
3tsc_A277 Putative oxidoreductase; structural genomics, seat 96.01
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 96.0
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 96.0
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 96.0
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 95.99
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 95.99
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 95.98
1spx_A278 Short-chain reductase family member (5L265); paral 95.97
3dty_A398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 95.96
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 95.95
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 95.94
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 95.94
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 95.94
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 95.93
3p2o_A285 Bifunctional protein fold; structural genomics, ce 95.93
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 95.93
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 95.92
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 95.92
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 95.91
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 95.9
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 95.9
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 95.89
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 95.89
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 95.87
3bio_A304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 95.87
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 95.86
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 95.85
1xhl_A297 Short-chain dehydrogenase/reductase family member 95.85
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 95.84
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 95.83
3v5n_A417 Oxidoreductase; structural genomics, PSI-biology, 95.83
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 95.83
1f06_A320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 95.81
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 95.81
5mdh_A333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 95.79
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 95.79
1xq1_A266 Putative tropinone reducatse; structural genomics, 95.78
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 95.78
3moi_A387 Probable dehydrogenase; structural genomics, PSI2, 95.78
2ixa_A 444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 95.78
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 95.77
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 95.76
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 95.75
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 95.75
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 95.75
2wm3_A299 NMRA-like family domain containing protein 1; unkn 95.74
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 95.71
3upl_A 446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 95.7
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 95.69
4had_A350 Probable oxidoreductase protein; structural genomi 95.69
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 95.69
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 95.69
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 95.68
3l07_A285 Bifunctional protein fold; structural genomics, ID 95.67
3u3x_A361 Oxidoreductase; structural genomics, PSI-biology, 95.67
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 95.66
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 95.66
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 95.65
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 95.65
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 95.65
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 95.62
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 95.61
3btv_A 438 Galactose/lactose metabolism regulatory protein GA 95.61
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 95.61
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 95.58
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 95.56
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 95.55
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 95.54
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 95.54
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 95.54
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 95.53
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 95.53
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 95.53
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 95.51
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 95.49
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 95.49
3gem_A260 Short chain dehydrogenase; structural genomics, AP 95.47
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 95.44
1xq6_A253 Unknown protein; structural genomics, protein stru 95.43
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 95.41
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 95.41
3edm_A259 Short chain dehydrogenase; structural genomics, ox 95.39
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 95.37
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 95.36
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 95.36
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 95.36
1zh8_A340 Oxidoreductase; TM0312, structural genomics, JO ce 95.35
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 95.32
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 95.3
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 95.29
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 95.29
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 95.27
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 95.26
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 95.23
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 95.21
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 95.2
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 95.18
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 95.17
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 95.15
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 95.12
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 95.08
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 95.08
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 95.07
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 95.07
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 95.05
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 95.05
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 95.04
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 95.04
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 95.04
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 95.03
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 95.0
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 94.98
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 94.94
2vt3_A215 REX, redox-sensing transcriptional repressor REX; 94.91
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 94.91
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 94.89
3e82_A364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 94.89
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 94.85
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 94.84
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 94.82
2nvw_A 479 Galactose/lactose metabolism regulatory protein GA 94.82
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 94.8
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 94.78
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 94.77
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 94.77
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 94.74
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 94.72
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 94.72
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 94.71
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 94.66
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 94.66
7mdh_A375 Protein (malate dehydrogenase); chloroplastic mala 94.65
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 94.64
3gdo_A358 Uncharacterized oxidoreductase YVAA; structural ge 94.62
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 94.62
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 94.58
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 94.52
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 94.52
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 94.49
4gqa_A412 NAD binding oxidoreductase; structural genomics, P 94.49
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 94.48
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 94.45
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 94.45
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 94.42
3e03_A274 Short chain dehydrogenase; structural genomics, PS 94.38
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 94.3
3qlj_A322 Short chain dehydrogenase; structural genomics, se 94.29
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 94.29
3kux_A352 Putative oxidoreductase; oxidoreductase family, cs 94.27
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
Probab=100.00  E-value=6e-55  Score=396.79  Aligned_cols=238  Identities=49%  Similarity=0.831  Sum_probs=225.5

Q ss_pred             ccceEEE--ccccHHHHHHHHHCCCeEEEEeCChHHHHHHHHHHHhhhhhhhhcccccCCCCCccCCceeEEeecchHHH
Q psy13746         13 FYPDGII--GLIGQAWAMIFASAGYKVSLYDVLSEQIENAKNTIQHTLQDYHQKGCLKGSLSPAHAGYKVSLYDVLSEQI   90 (294)
Q Consensus        13 ~~~i~ii--G~mG~~iA~~~~~~G~~V~~~d~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~v~~~d~~~~~~   90 (294)
                      +++|+||  |.||++||..++.+|++|++||++++.++++.+++.                                   
T Consensus         6 ~~~VaViGaG~MG~giA~~~a~~G~~V~l~D~~~~~l~~~~~~i~-----------------------------------   50 (319)
T 3ado_A            6 AGDVLIVGSGLVGRSWAMLFASGGFRVKLYDIEPRQITGALENIR-----------------------------------   50 (319)
T ss_dssp             -CEEEEECCSHHHHHHHHHHHHTTCCEEEECSCHHHHHHHHHHHH-----------------------------------
T ss_pred             CCeEEEECCcHHHHHHHHHHHhCCCeEEEEECCHHHHHHHHHHHH-----------------------------------
Confidence            5799999  999999999999999999999999999988877665                                   


Q ss_pred             HHHHHHHHHHHHHHHhccccCCCCChhhhccCeeeccChhhhccCCcEEEEcCCcchHHHHHHHHHHhcccCCCeEEEec
Q psy13746         91 ENAKNTIQHTLQDYHQKGCLKGSLSPEEQFGLISGTPVLRECLEDAIFIQESVPEILQIKHQVYRAIDIFMSSNTILSSS  170 (294)
Q Consensus        91 ~~~~~~~~~~l~~~~~~g~~~~~~~~~~~~~~i~~~~~~~~a~~~aDlVieavpe~~~~k~~~~~~l~~~~~~~~ii~s~  170 (294)
                              +.+.++.++|.+++..+.+..+++++.++|+.+++++||+||||+||++++|+++|++|++++++++||+||
T Consensus        51 --------~~l~~~~~~g~~~~~~~~~~~l~~i~~~~~l~~a~~~ad~ViEav~E~l~iK~~lf~~l~~~~~~~aIlaSN  122 (319)
T 3ado_A           51 --------KEMKSLQQSGSLKGSLSAEEQLSLISSCTNLAEAVEGVVHIQECVPENLDLKRKIFAQLDSIVDDRVVLSSS  122 (319)
T ss_dssp             --------HHHHHHHHTTCCCSSSCHHHHHHTEEEECCHHHHTTTEEEEEECCCSCHHHHHHHHHHHHTTCCSSSEEEEC
T ss_pred             --------HHHHHHHHcCCCCCccCHHHHHhhcccccchHhHhccCcEEeeccccHHHHHHHHHHHHHHHhhhcceeehh
Confidence                    567777888887776667778899999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCHHHHHhhcCCCCceeeeeecCCCCCCCeEEEecCCCCCHHHHHHHHHHHHHcCCeeEEEcccccccHHHHHHHHH
Q psy13746        171 TSSFLPSVLSEHSTHRSQFIVAHPVNPPYFIPLVEIVPAAWTSERVITRTREIMTEIGMKPVTLTTEIRGFALNRIQFAV  250 (294)
Q Consensus       171 tSt~~~~~ia~~l~~~~~~ig~h~~~p~~~~~lveiv~g~~t~~e~~~~~~~ll~~lG~~~v~v~~~~~g~v~nri~~a~  250 (294)
                      ||+++++++++.+.+|+||+|+|||||++..+++||++|+.|++++++++..|++.+|++|+++.+|.|||++||++.++
T Consensus       123 TSsl~is~ia~~~~~p~r~ig~HffNP~~~m~LVEiv~g~~Ts~~~~~~~~~~~~~~gk~pv~v~kd~pGFi~NRl~~~~  202 (319)
T 3ado_A          123 SSCLLPSKLFTGLAHVKQCIVAHPVNPPYYIPLVELVPHPETSPATVDRTHALMRKIGQSPVRVLKEIDGFVLNRLQYAI  202 (319)
T ss_dssp             CSSCCHHHHHTTCTTGGGEEEEEECSSTTTCCEEEEEECTTCCHHHHHHHHHHHHHTTCEEEECSSCCTTTTHHHHHHHH
T ss_pred             hhhccchhhhhhccCCCcEEEecCCCCccccchHHhcCCCCCcHHHHHHHHHHHHHhCCccCCcCCCCCCEeHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999887899999999999999


Q ss_pred             HHHHHHHHHcCCCCHHHHHHHHHcccCCCcCCCChhhhhcccC
Q psy13746        251 LNECYHLVHDGVLSAKDIDRVMSEGLGLRYAFLGPLETIHLNS  293 (294)
Q Consensus       251 ~~Ea~~l~~~~~~~~~~id~a~~~g~g~~~~~~Gp~~~~D~~~  293 (294)
                      ++||++++++|+++++|||.+++.|+|++|+.+|||+++|++|
T Consensus       203 ~~EA~~lv~eGvas~edID~~~~~g~g~~~a~mGPf~~~Dl~G  245 (319)
T 3ado_A          203 ISEAWRLVEEGIVSPSDLDLVMSDGLGMRYAFIGPLETMHLNA  245 (319)
T ss_dssp             HHHHHHHHHTTSSCHHHHHHHHHTTHHHHHTTSCHHHHHHHTT
T ss_pred             HHHHHHHHHhCCCCHHHHHHHHHhCCCCCCCCcchhhhhhhcC
Confidence            9999999999999999999999999999999999999999987



>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>3ctv_A HBD-10, 3-hydroxyacyl-COA dehydrogenase; structural genomics, APC7539, PSI-2, protein structure initiative; 2.46A {Archaeoglobus fulgidus dsm 4304} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>4fgw_A Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxidoreductase; 2.45A {Saccharomyces cerevisiae} Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>1obb_A Maltase, alpha-glucosidase; glycosidase, sulfinic acid, NAD+, maltose, hydrolase; HET: MAL NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG glucosidase, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1s6y_A 6-phospho-beta-glucosidase; hydrolase, structural genomics, PSI, protein structure initi midwest center for structural genomics; 2.31A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>2b0j_A 5,10-methenyltetrahydromethanopterin hydrogenase; rossmann fold, helix bundle, oxidoreductase; 1.75A {Methanocaldococcus jannaschii} SCOP: a.100.1.11 c.2.1.6 PDB: 3f47_A* 3daf_A* 3dag_A* 3f46_A* 3h65_A* Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>3ulk_A Ketol-acid reductoisomerase; branched-chain amino acid biosynthesis, rossmann fold, acetolactate, oxidoreductase; HET: CSX NDP; 2.30A {Escherichia coli} PDB: 1yrl_A* Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>1up7_A 6-phospho-beta-glucosidase; hydrolase, family4 hydrolase, Na dependent; HET: G6P NAD; 2.4A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 PDB: 1up6_A* 1up4_A Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3u95_A Glycoside hydrolase, family 4; hydrolysis, cytosol; 2.00A {Thermotoga neapolitana} PDB: 1vjt_A* Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>7mdh_A Protein (malate dehydrogenase); chloroplastic malate dehydrogenase (NADP+), activated by LIG chloroplastic malate dehydrogenase; 2.40A {Sorghum bicolor} SCOP: c.2.1.5 d.162.1.1 PDB: 1civ_A* Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 294
d1f0ya2192 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA 2e-23
d1wdka3186 c.2.1.6 (A:311-496) Fatty oxidation complex alpha 6e-21
d2b0ja2242 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopt 3e-09
d1f0ya199 a.100.1.3 (A:204-302) Short chain L-3-hydroxyacyl 7e-05
d1wdka295 a.100.1.3 (A:621-715) Fatty oxidation complex alph 0.002
d1bg6a2184 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvalin 0.002
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: 6-phosphogluconate dehydrogenase-like, N-terminal domain
domain: Short chain L-3-hydroxyacyl CoA dehydrogenase
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 93.1 bits (230), Expect = 2e-23
 Identities = 41/220 (18%), Positives = 87/220 (39%), Gaps = 41/220 (18%)

Query: 17  GIIG--LIGQAWAMIFASAGYKVSLYDVLSEQIENAKNTIQHTLQDYHQKGCLKGSLSPA 74
            +IG  L+G   A + A+ G+ V L D   + +  +K  I+ +L+   +           
Sbjct: 8   TVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLRKVAK----------- 56

Query: 75  HAGYKVSLYDVLSEQIENAKNTIQHTLQDYHQKGCLKGSLSPEEQFGLISGTPVLRECLE 134
                                           +    G    E+    I+ +      + 
Sbjct: 57  ----------------------------KKFAENPKAGDEFVEKTLSTIATSTDAASVVH 88

Query: 135 DAIFIQESVPEILQIKHQVYRAIDIFMSSNTILSSSTSSFLPSVLSEHSTHRSQFIVAHP 194
               + E++ E L++K+++++ +D F + +TI +S+TSS   + ++  +T + +F   H 
Sbjct: 89  STDLVVEAIVENLKVKNELFKRLDKFAAEHTIFASNTSSLQITSIANATTRQDRFAGLHF 148

Query: 195 VNPPYFIPLVEIVPAAWTSERVITRTREIMTEIGMKPVTL 234
            NP   + LVE++    TS++      +    +G  PV+ 
Sbjct: 149 FNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALGKHPVSC 188


>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Length = 186 Back     information, alignment and structure
>d2b0ja2 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]} Length = 242 Back     information, alignment and structure
>d1f0ya1 a.100.1.3 (A:204-302) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1wdka2 a.100.1.3 (A:621-715) Fatty oxidation complex alpha subunit, C-terminal domain {Pseudomonas fragi [TaxId: 296]} Length = 95 Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Length = 184 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query294
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 100.0
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 100.0
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 99.81
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 99.76
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 99.74
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 99.69
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 99.68
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 99.68
d2b0ja2242 5,10-methenyltetrahydromethanopterin hydrogenase, 99.64
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 99.62
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 99.51
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 99.46
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 99.44
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 99.38
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 99.33
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 99.32
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 99.29
d1f0ya199 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 99.23
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 99.2
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 99.06
d1wdka295 Fatty oxidation complex alpha subunit, C-terminal 98.95
d1wdka1124 Fatty oxidation complex alpha subunit, C-terminal 98.95
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 98.7
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 98.56
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 98.49
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 98.42
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 98.22
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 98.22
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 98.2
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 98.19
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 98.19
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 98.14
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 98.14
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 98.12
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 98.12
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 98.05
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 98.04
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 98.03
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 98.02
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 97.97
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 97.95
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 97.89
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 97.89
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 97.89
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 97.89
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 97.85
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 97.85
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 97.82
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 97.8
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 97.76
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 97.73
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 97.68
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 97.63
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 97.62
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 97.59
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 97.58
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 97.51
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 97.5
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 97.42
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 97.36
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 97.35
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 97.32
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 97.28
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 97.28
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 97.24
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 97.22
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 97.17
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 97.11
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 97.09
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 97.08
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 97.08
d1qmga2226 Class II ketol-acid reductoisomerase (KARI) {Spina 97.08
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 97.06
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 97.03
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 97.02
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 97.01
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 97.01
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 97.01
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 97.01
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 97.0
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 96.98
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 96.98
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 96.96
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 96.96
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 96.93
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 96.93
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 96.92
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 96.92
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 96.86
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 96.85
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 96.83
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 96.81
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 96.78
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 96.75
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 96.73
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 96.72
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 96.7
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 96.7
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 96.69
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 96.64
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 96.59
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 96.59
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 96.57
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 96.56
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 96.56
d1id1a_153 Rck domain from putative potassium channel Kch {Es 96.52
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 96.48
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 96.46
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 96.4
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 96.4
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 96.4
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 96.39
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 96.37
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 96.19
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 96.13
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 96.12
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 96.09
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 96.07
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 96.04
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 96.04
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 96.0
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 95.91
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 95.88
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 95.85
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 95.81
d1x7da_340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 95.81
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 95.79
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 95.64
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 95.64
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 95.63
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 95.61
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 95.46
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 95.41
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 95.4
d1omoa_320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 95.38
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 95.33
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 95.28
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 95.16
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 95.15
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 95.14
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.12
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 95.11
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 95.03
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 94.99
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 94.94
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 94.89
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 94.85
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 94.84
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 94.77
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 94.76
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 94.75
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 94.74
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 94.73
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 94.61
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 94.61
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 94.49
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 94.36
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 94.36
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 94.31
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 94.27
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.25
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 94.23
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 94.22
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 94.16
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 94.07
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 94.02
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 94.0
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 93.98
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 93.92
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 93.91
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 93.88
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 93.87
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 93.84
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 93.83
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 93.68
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 93.62
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 93.61
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 93.52
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 93.3
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 93.25
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 93.22
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 93.21
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 93.2
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 93.14
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 93.1
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 92.93
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 92.79
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 92.67
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 92.63
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 92.5
d2cvza1132 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 92.45
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 92.4
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 92.25
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 92.24
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 92.23
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 92.23
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 92.14
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 92.07
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 92.06
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 91.86
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 91.66
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 91.65
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 91.59
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 91.58
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 91.56
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 91.51
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 91.48
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 91.43
d3cuma1134 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 91.3
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 91.29
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 90.93
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 90.92
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 90.58
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 90.44
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 90.42
d1mv8a3136 GDP-mannose 6-dehydrogenase, GDP-binding domain {P 90.34
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 90.25
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 90.24
d1vpda1133 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 90.16
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 89.98
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 89.97
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 89.88
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 89.76
d2h1qa1251 Hypothetical protein Dhaf_3308 {Desulfitobacterium 89.72
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 89.67
d1pvva2163 Ornithine transcarbamoylase {Archaeon Pyrococcus f 89.64
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 89.39
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 89.36
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 89.27
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 89.25
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 88.86
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 88.5
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 88.47
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 88.38
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 88.36
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 88.29
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 88.21
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 87.89
d1u7za_223 Coenzyme A biosynthesis bifunctional protein CoaBC 87.85
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 87.81
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 87.66
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 87.53
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 87.45
d1uh5a_329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 87.44
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 86.96
d2nvwa1237 Galactose/lactose metabolism regulatory protein GA 86.95
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 86.59
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 86.48
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 86.33
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 86.06
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 86.03
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 85.35
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 85.11
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 84.92
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 84.75
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 84.73
d1dxha2185 Ornithine transcarbamoylase {Pseudomonas aeruginos 84.69
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 84.65
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 84.4
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 84.24
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 84.01
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 83.97
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 83.92
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 83.87
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 83.86
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 83.81
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 83.69
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 83.38
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 83.14
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 83.07
d1e5da1152 Rubredoxin oxygen:oxidoreductase (ROO), C-terminal 82.56
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 82.46
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 82.18
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 82.16
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 81.98
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 81.89
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 81.7
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 81.46
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 81.32
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 80.84
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 80.8
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 80.41
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 80.19
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: 6-phosphogluconate dehydrogenase-like, N-terminal domain
domain: Short chain L-3-hydroxyacyl CoA dehydrogenase
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=5.5e-39  Score=270.99  Aligned_cols=186  Identities=22%  Similarity=0.341  Sum_probs=165.3

Q ss_pred             CCCccceEEE--ccccHHHHHHHHHCCCeEEEEeCChHHHHHHHHHHHhhhhhhhhcccccCCCCCccCCceeEEeecch
Q psy13746         10 QGGFYPDGII--GLIGQAWAMIFASAGYKVSLYDVLSEQIENAKNTIQHTLQDYHQKGCLKGSLSPAHAGYKVSLYDVLS   87 (294)
Q Consensus        10 ~~~~~~i~ii--G~mG~~iA~~~~~~G~~V~~~d~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~v~~~d~~~   87 (294)
                      +|.++||+||  |.||++||..++++|++|++||++++.++++.+++.                                
T Consensus         1 ~~~IkkvaViGaG~mG~~iA~~~a~~G~~V~l~D~~~~~l~~a~~~i~--------------------------------   48 (192)
T d1f0ya2           1 KIIVKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIE--------------------------------   48 (192)
T ss_dssp             CCCCCEEEEECCSHHHHHHHHHHHHTTCEEEEECSCHHHHHHHHHHHH--------------------------------
T ss_pred             CceeEEEEEECcCHHHHHHHHHHHhCCCcEEEEECChHHHHHHHhhHH--------------------------------
Confidence            5789999999  999999999999999999999999999998877665                                


Q ss_pred             HHHHHHHHHHHHHHHHHHhccccCCCC----ChhhhccCeeeccChhhhccCCcEEEEcCCcchHHHHHHHHHHhcccCC
Q psy13746         88 EQIENAKNTIQHTLQDYHQKGCLKGSL----SPEEQFGLISGTPVLRECLEDAIFIQESVPEILQIKHQVYRAIDIFMSS  163 (294)
Q Consensus        88 ~~~~~~~~~~~~~l~~~~~~g~~~~~~----~~~~~~~~i~~~~~~~~a~~~aDlVieavpe~~~~k~~~~~~l~~~~~~  163 (294)
                                 +.+..++++|......    .....+.+++.++|+.+++++||+||||+||++++|+++|+++++.+++
T Consensus        49 -----------~~l~~~~~~~~~~~~~~~~~~~~~~l~~i~~~~d~~~a~~~ad~ViEav~E~l~~K~~v~~~l~~~~~~  117 (192)
T d1f0ya2          49 -----------ESLRKVAKKKFAENPKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEAIVENLKVKNELFKRLDKFAAE  117 (192)
T ss_dssp             -----------HHHHHHHHTTSSSCHHHHHHHHHHHHHTEEEESCHHHHTTSCSEEEECCCSCHHHHHHHHHHHTTTSCT
T ss_pred             -----------HHHHHHHHhhhhccchhhHHHHHHHHhhccccchhHhhhcccceehhhcccchhHHHHHHHHHhhhccc
Confidence                       4455555554322100    0123567899999999899999999999999999999999999999999


Q ss_pred             CeEEEecCCCCCHHHHHhhcCCCCceeeeeecCCCCCCCeEEEecCCCCCHHHHHHHHHHHHHcCCeeEEEccccc
Q psy13746        164 NTILSSSTSSFLPSVLSEHSTHRSQFIVAHPVNPPYFIPLVEIVPAAWTSERVITRTREIMTEIGMKPVTLTTEIR  239 (294)
Q Consensus       164 ~~ii~s~tSt~~~~~ia~~l~~~~~~ig~h~~~p~~~~~lveiv~g~~t~~e~~~~~~~ll~~lG~~~v~v~~~~~  239 (294)
                      ++||+||||++++++++..+.+|+||+|+|||+|++..+++||++|+.|++++++.+..|++.+|+.|+++ +|.|
T Consensus       118 ~~ilasnTS~l~i~~la~~~~~p~r~ig~HffnP~~~~~lVEIv~g~~T~~~~i~~~~~~~~~lgk~pV~v-~D~P  192 (192)
T d1f0ya2         118 HTIFASNTSSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALGKHPVSC-KDTP  192 (192)
T ss_dssp             TCEEEECCSSSCHHHHHTTSSCGGGEEEEEECSSTTTCCEEEEECCTTCCHHHHHHHHHHHHHTTCEEEEE-CSCT
T ss_pred             CceeeccCcccccchhhhhccCHhHEEeeccccccCcccEEEEcCCCCCCHHHHHHHHHHHHHcCCEEEEe-eccC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999 5765



>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2b0ja2 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1f0ya1 a.100.1.3 (A:204-302) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wdka2 a.100.1.3 (A:621-715) Fatty oxidation complex alpha subunit, C-terminal domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1wdka1 a.100.1.3 (A:497-620) Fatty oxidation complex alpha subunit, C-terminal domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1qmga2 c.2.1.6 (A:82-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cvza1 a.100.1.1 (A:158-289) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d3cuma1 a.100.1.1 (A:163-296) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1mv8a3 c.26.3.1 (A:301-436) GDP-mannose 6-dehydrogenase, GDP-binding domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vpda1 a.100.1.1 (A:164-296) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h1qa1 c.67.3.1 (A:1-251) Hypothetical protein Dhaf_3308 {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1dxha2 c.78.1.1 (A:151-335) Ornithine transcarbamoylase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1e5da1 c.23.5.1 (A:251-402) Rubredoxin oxygen:oxidoreductase (ROO), C-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure