Psyllid ID: psy13774
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 110 | ||||||
| 357623246 | 1316 | transitional endoplasmic reticulum ATPas | 0.745 | 0.062 | 0.952 | 5e-42 | |
| 193617621 | 804 | PREDICTED: transitional endoplasmic reti | 0.745 | 0.101 | 0.976 | 3e-41 | |
| 345486620 | 801 | PREDICTED: transitional endoplasmic reti | 0.745 | 0.102 | 0.976 | 3e-41 | |
| 391325496 | 798 | PREDICTED: transitional endoplasmic reti | 0.745 | 0.102 | 0.988 | 3e-41 | |
| 391325494 | 799 | PREDICTED: transitional endoplasmic reti | 0.745 | 0.102 | 0.988 | 3e-41 | |
| 380016377 | 893 | PREDICTED: LOW QUALITY PROTEIN: transiti | 0.745 | 0.091 | 0.964 | 4e-41 | |
| 383861759 | 811 | PREDICTED: transitional endoplasmic reti | 0.745 | 0.101 | 0.964 | 4e-41 | |
| 383861757 | 801 | PREDICTED: transitional endoplasmic reti | 0.745 | 0.102 | 0.964 | 4e-41 | |
| 328783535 | 811 | PREDICTED: transitional endoplasmic reti | 0.745 | 0.101 | 0.964 | 5e-41 | |
| 350426753 | 811 | PREDICTED: transitional endoplasmic reti | 0.745 | 0.101 | 0.964 | 6e-41 |
| >gi|357623246|gb|EHJ74479.1| transitional endoplasmic reticulum ATPase TER94 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
Score = 174 bits (441), Expect = 5e-42, Method: Composition-based stats.
Identities = 81/85 (95%), Positives = 83/85 (97%)
Query: 10 ARAAAPCVLFFDELDSIAKSRGGSVGDGGGAADRVINQILTEMDGMGAKKNVFIIGATNR 69
AR+A+PCVLFFDELDSIAKSRGGSV D GGAADRVINQILTEMDGMGAKKNVFIIGATNR
Sbjct: 1075 ARSASPCVLFFDELDSIAKSRGGSVSDAGGAADRVINQILTEMDGMGAKKNVFIIGATNR 1134
Query: 70 PDIIDPAILRPGRLDQLIYIPLPDE 94
PDIIDPAILRPGRLDQLIYIPLPDE
Sbjct: 1135 PDIIDPAILRPGRLDQLIYIPLPDE 1159
|
Source: Danaus plexippus Species: Danaus plexippus Genus: Danaus Family: Nymphalidae Order: Lepidoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|193617621|ref|XP_001949588.1| PREDICTED: transitional endoplasmic reticulum ATPase TER94-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|345486620|ref|XP_001605497.2| PREDICTED: transitional endoplasmic reticulum ATPase TER94-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|391325496|ref|XP_003737269.1| PREDICTED: transitional endoplasmic reticulum ATPase TER94-like isoform 2 [Metaseiulus occidentalis] | Back alignment and taxonomy information |
|---|
| >gi|391325494|ref|XP_003737268.1| PREDICTED: transitional endoplasmic reticulum ATPase TER94-like isoform 1 [Metaseiulus occidentalis] | Back alignment and taxonomy information |
|---|
| >gi|380016377|ref|XP_003692162.1| PREDICTED: LOW QUALITY PROTEIN: transitional endoplasmic reticulum ATPase TER94-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|383861759|ref|XP_003706352.1| PREDICTED: transitional endoplasmic reticulum ATPase TER94-like isoform 2 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|383861757|ref|XP_003706351.1| PREDICTED: transitional endoplasmic reticulum ATPase TER94-like isoform 1 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|328783535|ref|XP_392892.3| PREDICTED: transitional endoplasmic reticulum ATPase TER94 isoform 1 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|350426753|ref|XP_003494532.1| PREDICTED: transitional endoplasmic reticulum ATPase TER94-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 110 | ||||||
| FB|FBgn0261014 | 801 | TER94 "TER94" [Drosophila mela | 0.772 | 0.106 | 0.788 | 3.1e-29 | |
| WB|WBGene00008053 | 810 | cdc-48.2 [Caenorhabditis elega | 0.772 | 0.104 | 0.776 | 4.1e-29 | |
| UNIPROTKB|P54812 | 810 | cdc-48.2 "Transitional endopla | 0.772 | 0.104 | 0.776 | 4.1e-29 | |
| UNIPROTKB|H9KYT1 | 538 | LOC430766 "Uncharacterized pro | 0.772 | 0.157 | 0.776 | 1e-28 | |
| ZFIN|ZDB-GENE-030131-5408 | 806 | vcp "valosin containing protei | 0.772 | 0.105 | 0.776 | 2.9e-28 | |
| UNIPROTKB|E1BTS8 | 804 | LOC426240 "Uncharacterized pro | 0.772 | 0.105 | 0.776 | 3.7e-28 | |
| UNIPROTKB|Q6GL04 | 805 | vcp "Transitional endoplasmic | 0.772 | 0.105 | 0.776 | 3.7e-28 | |
| UNIPROTKB|G3X757 | 806 | VCP "Transitional endoplasmic | 0.772 | 0.105 | 0.776 | 3.8e-28 | |
| UNIPROTKB|Q3ZBT1 | 806 | VCP "Transitional endoplasmic | 0.772 | 0.105 | 0.776 | 3.8e-28 | |
| UNIPROTKB|P55072 | 806 | VCP "Transitional endoplasmic | 0.772 | 0.105 | 0.776 | 3.8e-28 |
| FB|FBgn0261014 TER94 "TER94" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 334 (122.6 bits), Expect = 3.1e-29, P = 3.1e-29
Identities = 67/85 (78%), Positives = 69/85 (81%)
Query: 10 ARAAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQILTEMDGMGAKKNVFIIGATNR 69
AR+AAPCVLFFDELDSIAK INQILTEMDGMGAKKNVFIIGATNR
Sbjct: 563 ARSAAPCVLFFDELDSIAKARGGNVGDAGGAADRVINQILTEMDGMGAKKNVFIIGATNR 622
Query: 70 PDIIDPAILRPGRLDQLIYIPLPDE 94
PDIIDPAILRPGRLDQLIYIPLPD+
Sbjct: 623 PDIIDPAILRPGRLDQLIYIPLPDD 647
|
|
| WB|WBGene00008053 cdc-48.2 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P54812 cdc-48.2 "Transitional endoplasmic reticulum ATPase homolog 2" [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H9KYT1 LOC430766 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-5408 vcp "valosin containing protein" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BTS8 LOC426240 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6GL04 vcp "Transitional endoplasmic reticulum ATPase" [Xenopus (Silurana) tropicalis (taxid:8364)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3X757 VCP "Transitional endoplasmic reticulum ATPase" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3ZBT1 VCP "Transitional endoplasmic reticulum ATPase" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P55072 VCP "Transitional endoplasmic reticulum ATPase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 110 | |||
| TIGR01243 | 733 | TIGR01243, CDC48, AAA family ATPase, CDC48 subfami | 3e-34 | |
| COG0464 | 494 | COG0464, SpoVK, ATPases of the AAA+ class [Posttra | 1e-31 | |
| PRK03992 | 389 | PRK03992, PRK03992, proteasome-activating nucleoti | 2e-30 | |
| COG1222 | 406 | COG1222, RPT1, ATP-dependent 26S proteasome regula | 2e-30 | |
| TIGR01241 | 495 | TIGR01241, FtsH_fam, ATP-dependent metalloprotease | 2e-29 | |
| COG0465 | 596 | COG0465, HflB, ATP-dependent Zn proteases [Posttra | 1e-28 | |
| TIGR01242 | 364 | TIGR01242, 26Sp45, 26S proteasome subunit P45 fami | 4e-27 | |
| CHL00176 | 638 | CHL00176, ftsH, cell division protein; Validated | 5e-27 | |
| pfam00004 | 131 | pfam00004, AAA, ATPase family associated with vari | 4e-26 | |
| PRK10733 | 644 | PRK10733, hflB, ATP-dependent metalloprotease; Rev | 1e-25 | |
| PTZ00454 | 398 | PTZ00454, PTZ00454, 26S protease regulatory subuni | 6e-23 | |
| TIGR03689 | 512 | TIGR03689, pup_AAA, proteasome ATPase | 3e-22 | |
| TIGR01243 | 733 | TIGR01243, CDC48, AAA family ATPase, CDC48 subfami | 5e-20 | |
| PTZ00361 | 438 | PTZ00361, PTZ00361, 26 proteosome regulatory subun | 8e-17 | |
| COG1223 | 368 | COG1223, COG1223, Predicted ATPase (AAA+ superfami | 3e-16 | |
| COG0464 | 494 | COG0464, SpoVK, ATPases of the AAA+ class [Posttra | 6e-15 | |
| cd00009 | 151 | cd00009, AAA, The AAA+ (ATPases Associated with a | 3e-11 | |
| CHL00195 | 489 | CHL00195, ycf46, Ycf46; Provisional | 2e-08 | |
| smart00382 | 148 | smart00382, AAA, ATPases associated with a variety | 3e-07 | |
| CHL00206 | 2281 | CHL00206, ycf2, Ycf2; Provisional | 0.002 |
| >gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
Score = 123 bits (311), Expect = 3e-34
Identities = 49/85 (57%), Positives = 63/85 (74%), Gaps = 2/85 (2%)
Query: 10 ARAAAPCVLFFDELDSIAKSRGGSVGDGGGAADRVINQILTEMDGMGAKKNVFIIGATNR 69
AR AAP ++FFDE+D+IA +RG DR++NQ+LTEMDG+ NV +I ATNR
Sbjct: 542 ARQAAPAIIFFDEIDAIAPARGARFDTS--VTDRIVNQLLTEMDGIQELSNVVVIAATNR 599
Query: 70 PDIIDPAILRPGRLDQLIYIPLPDE 94
PDI+DPA+LRPGR D+LI +P PDE
Sbjct: 600 PDILDPALLRPGRFDRLILVPPPDE 624
|
This subfamily of the AAA family ATPases includes two members each from three archaeal species. It also includes yeast CDC48 (cell division control protein 48) and the human ortholog, transitional endoplasmic reticulum ATPase (valosin-containing protein). These proteins in eukaryotes are involved in the budding and transfer of membrane from the transitional endoplasmic reticulum to the Golgi apparatus. Length = 733 |
| >gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >gnl|CDD|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >gnl|CDD|214386 CHL00176, ftsH, cell division protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) | Back alignment and domain information |
|---|
| >gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200312 TIGR03689, pup_AAA, proteasome ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >gnl|CDD|177094 CHL00195, ycf46, Ycf46; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >gnl|CDD|214396 CHL00206, ycf2, Ycf2; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 110 | |||
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 100.0 | |
| KOG0734|consensus | 752 | 99.97 | ||
| KOG0733|consensus | 802 | 99.97 | ||
| KOG0730|consensus | 693 | 99.97 | ||
| KOG0736|consensus | 953 | 99.96 | ||
| KOG0733|consensus | 802 | 99.96 | ||
| COG0465 | 596 | HflB ATP-dependent Zn proteases [Posttranslational | 99.95 | |
| KOG0652|consensus | 424 | 99.94 | ||
| KOG0728|consensus | 404 | 99.94 | ||
| KOG0731|consensus | 774 | 99.94 | ||
| KOG0727|consensus | 408 | 99.94 | ||
| KOG0735|consensus | 952 | 99.94 | ||
| KOG0726|consensus | 440 | 99.93 | ||
| KOG0738|consensus | 491 | 99.93 | ||
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 99.93 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 99.92 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 99.92 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 99.91 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 99.91 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 99.91 | |
| COG1223 | 368 | Predicted ATPase (AAA+ superfamily) [General funct | 99.91 | |
| CHL00206 | 2281 | ycf2 Ycf2; Provisional | 99.91 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 99.91 | |
| PRK10733 | 644 | hflB ATP-dependent metalloprotease; Reviewed | 99.91 | |
| KOG0739|consensus | 439 | 99.9 | ||
| KOG0729|consensus | 435 | 99.9 | ||
| CHL00176 | 638 | ftsH cell division protein; Validated | 99.89 | |
| KOG0651|consensus | 388 | 99.89 | ||
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 99.89 | |
| KOG0732|consensus | 1080 | 99.88 | ||
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 99.88 | |
| KOG0730|consensus | 693 | 99.87 | ||
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 99.85 | |
| KOG0740|consensus | 428 | 99.84 | ||
| KOG0737|consensus | 386 | 99.84 | ||
| KOG0741|consensus | 744 | 99.83 | ||
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 99.78 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 99.69 | |
| KOG0743|consensus | 457 | 99.6 | ||
| KOG0742|consensus | 630 | 99.58 | ||
| KOG0744|consensus | 423 | 99.33 | ||
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 99.32 | |
| KOG0735|consensus | 952 | 99.26 | ||
| KOG0736|consensus | 953 | 99.22 | ||
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 99.16 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 99.12 | |
| TIGR00763 | 775 | lon ATP-dependent protease La. This protein is ind | 99.01 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 98.96 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 98.96 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 98.93 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 98.91 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 98.9 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 98.77 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 98.67 | |
| PRK07940 | 394 | DNA polymerase III subunit delta'; Validated | 98.43 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 98.36 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 98.36 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 98.27 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 98.21 | |
| PRK10787 | 784 | DNA-binding ATP-dependent protease La; Provisional | 98.18 | |
| TIGR00678 | 188 | holB DNA polymerase III, delta' subunit. At positi | 98.17 | |
| PRK06964 | 342 | DNA polymerase III subunit delta'; Validated | 98.1 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 98.09 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 98.03 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 98.03 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 97.98 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 97.96 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 97.95 | |
| PRK05707 | 328 | DNA polymerase III subunit delta'; Validated | 97.94 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 97.94 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 97.92 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 97.92 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 97.89 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 97.87 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 97.87 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 97.86 | |
| TIGR02902 | 531 | spore_lonB ATP-dependent protease LonB. Members of | 97.85 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 97.83 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 97.83 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 97.78 | |
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 97.76 | |
| PRK09112 | 351 | DNA polymerase III subunit delta'; Validated | 97.74 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 97.73 | |
| PRK08769 | 319 | DNA polymerase III subunit delta'; Validated | 97.73 | |
| COG0466 | 782 | Lon ATP-dependent Lon protease, bacterial type [Po | 97.72 | |
| PRK04132 | 846 | replication factor C small subunit; Provisional | 97.72 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 97.71 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 97.71 | |
| PRK07993 | 334 | DNA polymerase III subunit delta'; Validated | 97.71 | |
| PRK06871 | 325 | DNA polymerase III subunit delta'; Validated | 97.7 | |
| PRK06090 | 319 | DNA polymerase III subunit delta'; Validated | 97.68 | |
| PRK05342 | 412 | clpX ATP-dependent protease ATP-binding subunit Cl | 97.67 | |
| PRK07471 | 365 | DNA polymerase III subunit delta'; Validated | 97.66 | |
| PRK08727 | 233 | hypothetical protein; Validated | 97.64 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 97.63 | |
| COG0714 | 329 | MoxR-like ATPases [General function prediction onl | 97.63 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 97.62 | |
| KOG2004|consensus | 906 | 97.61 | ||
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 97.6 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 97.58 | |
| PRK14970 | 367 | DNA polymerase III subunits gamma and tau; Provisi | 97.58 | |
| TIGR00382 | 413 | clpX endopeptidase Clp ATP-binding regulatory subu | 97.58 | |
| PRK07133 | 725 | DNA polymerase III subunits gamma and tau; Validat | 97.56 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 97.56 | |
| PRK05201 | 443 | hslU ATP-dependent protease ATP-binding subunit Hs | 97.56 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 97.56 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 97.55 | |
| PRK13407 | 334 | bchI magnesium chelatase subunit I; Provisional | 97.54 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 97.54 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 97.54 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 97.5 | |
| PRK14959 | 624 | DNA polymerase III subunits gamma and tau; Provisi | 97.48 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 97.48 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 97.46 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 97.44 | |
| PRK14965 | 576 | DNA polymerase III subunits gamma and tau; Provisi | 97.42 | |
| PRK14953 | 486 | DNA polymerase III subunits gamma and tau; Provisi | 97.41 | |
| PRK08058 | 329 | DNA polymerase III subunit delta'; Validated | 97.41 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 97.39 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 97.38 | |
| PRK14948 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 97.37 | |
| PF13177 | 162 | DNA_pol3_delta2: DNA polymerase III, delta subunit | 97.37 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 97.36 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 97.36 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 97.36 | |
| TIGR02030 | 337 | BchI-ChlI magnesium chelatase ATPase subunit I. Th | 97.35 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 97.35 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 97.35 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 97.33 | |
| TIGR00390 | 441 | hslU ATP-dependent protease HslVU, ATPase subunit. | 97.32 | |
| PRK06305 | 451 | DNA polymerase III subunits gamma and tau; Validat | 97.32 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 97.31 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 97.3 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 97.26 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 97.25 | |
| smart00350 | 509 | MCM minichromosome maintenance proteins. | 97.24 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 97.24 | |
| PRK08451 | 535 | DNA polymerase III subunits gamma and tau; Validat | 97.21 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 97.21 | |
| PRK07276 | 290 | DNA polymerase III subunit delta'; Validated | 97.21 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 97.16 | |
| PRK05564 | 313 | DNA polymerase III subunit delta'; Validated | 97.16 | |
| TIGR02903 | 615 | spore_lon_C ATP-dependent protease, Lon family. Me | 97.14 | |
| PRK06620 | 214 | hypothetical protein; Validated | 97.12 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 97.1 | |
| CHL00081 | 350 | chlI Mg-protoporyphyrin IX chelatase | 97.1 | |
| PRK06647 | 563 | DNA polymerase III subunits gamma and tau; Validat | 97.09 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 97.07 | |
| COG1220 | 444 | HslU ATP-dependent protease HslVU (ClpYQ), ATPase | 97.06 | |
| PRK07399 | 314 | DNA polymerase III subunit delta'; Validated | 97.04 | |
| PRK09087 | 226 | hypothetical protein; Validated | 97.03 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 97.03 | |
| PRK06581 | 263 | DNA polymerase III subunit delta'; Validated | 97.01 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 96.99 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 96.96 | |
| COG2812 | 515 | DnaX DNA polymerase III, gamma/tau subunits [DNA r | 96.96 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 96.96 | |
| COG0470 | 325 | HolB ATPase involved in DNA replication [DNA repli | 96.91 | |
| TIGR02031 | 589 | BchD-ChlD magnesium chelatase ATPase subunit D. Th | 96.91 | |
| PF01637 | 234 | Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 | 96.89 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 96.84 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 96.77 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 96.75 | |
| PRK08699 | 325 | DNA polymerase III subunit delta'; Validated | 96.75 | |
| PRK07132 | 299 | DNA polymerase III subunit delta'; Validated | 96.65 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 96.65 | |
| KOG0741|consensus | 744 | 96.63 | ||
| PHA02244 | 383 | ATPase-like protein | 96.62 | |
| PF05707 | 193 | Zot: Zonular occludens toxin (Zot); InterPro: IPR0 | 96.45 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 96.41 | |
| PRK14971 | 614 | DNA polymerase III subunits gamma and tau; Provisi | 96.41 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 96.31 | |
| PF12846 | 304 | AAA_10: AAA-like domain | 96.27 | |
| PRK05818 | 261 | DNA polymerase III subunit delta'; Validated | 96.26 | |
| PRK05917 | 290 | DNA polymerase III subunit delta'; Validated | 96.25 | |
| COG0593 | 408 | DnaA ATPase involved in DNA replication initiation | 96.21 | |
| TIGR02442 | 633 | Cob-chelat-sub cobaltochelatase subunit. A number | 96.18 | |
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 96.17 | |
| COG1219 | 408 | ClpX ATP-dependent protease Clp, ATPase subunit [P | 96.15 | |
| PRK09862 | 506 | putative ATP-dependent protease; Provisional | 96.05 | |
| PF07724 | 171 | AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR | 96.04 | |
| COG1239 | 423 | ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis | 96.01 | |
| PF05729 | 166 | NACHT: NACHT domain | 95.84 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 95.8 | |
| PRK08485 | 206 | DNA polymerase III subunit delta'; Validated | 95.79 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 95.76 | |
| KOG0989|consensus | 346 | 95.52 | ||
| PF00493 | 331 | MCM: MCM2/3/5 family This family extends the MCM d | 95.07 | |
| COG2607 | 287 | Predicted ATPase (AAA+ superfamily) [General funct | 94.95 | |
| PF06068 | 398 | TIP49: TIP49 C-terminus; InterPro: IPR010339 This | 94.94 | |
| PRK13531 | 498 | regulatory ATPase RavA; Provisional | 94.91 | |
| TIGR00368 | 499 | Mg chelatase-related protein. The N-terminal end m | 94.87 | |
| COG1224 | 450 | TIP49 DNA helicase TIP49, TBP-interacting protein | 94.67 | |
| KOG0745|consensus | 564 | 94.52 | ||
| KOG2028|consensus | 554 | 94.25 | ||
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 94.2 | |
| KOG1514|consensus | 767 | 94.08 | ||
| KOG1942|consensus | 456 | 94.08 | ||
| COG2255 | 332 | RuvB Holliday junction resolvasome, helicase subun | 93.99 | |
| PTZ00111 | 915 | DNA replication licensing factor MCM4; Provisional | 93.97 | |
| PRK13406 | 584 | bchD magnesium chelatase subunit D; Provisional | 93.46 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 93.4 | |
| PF12775 | 272 | AAA_7: P-loop containing dynein motor region D3; P | 93.27 | |
| PF07693 | 325 | KAP_NTPase: KAP family P-loop domain; InterPro: IP | 93.08 | |
| KOG2228|consensus | 408 | 92.86 | ||
| TIGR00764 | 608 | lon_rel lon-related putative ATP-dependent proteas | 92.85 | |
| PF13304 | 303 | AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T | 92.51 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 92.45 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 92.02 | |
| PHA00012 | 361 | I assembly protein | 91.46 | |
| PF13173 | 128 | AAA_14: AAA domain | 91.24 | |
| PF07726 | 131 | AAA_3: ATPase family associated with various cellu | 91.23 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 91.18 | |
| KOG1051|consensus | 898 | 90.93 | ||
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 90.81 | |
| KOG0732|consensus | 1080 | 89.75 | ||
| COG1134 | 249 | TagH ABC-type polysaccharide/polyol phosphate tran | 89.58 | |
| PRK10365 | 441 | transcriptional regulatory protein ZraR; Provision | 89.35 | |
| PF14532 | 138 | Sigma54_activ_2: Sigma-54 interaction domain; PDB: | 88.78 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 88.6 | |
| TIGR00602 | 637 | rad24 checkpoint protein rad24. This family is bas | 88.19 | |
| KOG2680|consensus | 454 | 87.53 | ||
| COG1121 | 254 | ZnuC ABC-type Mn/Zn transport systems, ATPase comp | 87.45 | |
| PF01078 | 206 | Mg_chelatase: Magnesium chelatase, subunit ChlI; I | 87.26 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 87.16 | |
| PF05872 | 502 | DUF853: Bacterial protein of unknown function (DUF | 87.07 | |
| PRK13539 | 207 | cytochrome c biogenesis protein CcmA; Provisional | 86.99 | |
| KOG0478|consensus | 804 | 86.18 | ||
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 86.15 | |
| PRK11361 | 457 | acetoacetate metabolism regulatory protein AtoC; P | 86.14 | |
| COG1131 | 293 | CcmA ABC-type multidrug transport system, ATPase c | 85.87 | |
| PF05621 | 302 | TniB: Bacterial TniB protein; InterPro: IPR008868 | 85.57 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 84.99 | |
| KOG1051|consensus | 898 | 84.76 | ||
| cd03227 | 162 | ABC_Class2 ABC-type Class 2 contains systems invol | 84.67 | |
| KOG0990|consensus | 360 | 83.92 | ||
| TIGR02974 | 329 | phageshock_pspF psp operon transcriptional activat | 83.87 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 83.82 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 83.71 | |
| PF04465 | 1035 | DUF499: Protein of unknown function (DUF499); Inte | 83.53 | |
| COG1241 | 682 | MCM2 Predicted ATPase involved in replication cont | 83.33 | |
| TIGR01818 | 463 | ntrC nitrogen regulation protein NR(I). This model | 82.98 | |
| PF14516 | 331 | AAA_35: AAA-like domain | 82.37 | |
| COG4598 | 256 | HisP ABC-type histidine transport system, ATPase c | 81.76 | |
| PRK11388 | 638 | DNA-binding transcriptional regulator DhaR; Provis | 81.72 | |
| PF13872 | 303 | AAA_34: P-loop containing NTP hydrolase pore-1 | 81.64 | |
| cd03240 | 204 | ABC_Rad50 The catalytic domains of Rad50 are simil | 81.44 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 81.43 | |
| PF03969 | 362 | AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 | 81.34 | |
| TIGR02858 | 270 | spore_III_AA stage III sporulation protein AA. Mem | 81.06 | |
| TIGR02915 | 445 | PEP_resp_reg putative PEP-CTERM system response re | 80.85 | |
| cd03283 | 199 | ABC_MutS-like MutS-like homolog in eukaryotes. The | 80.76 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 80.5 | |
| COG1066 | 456 | Sms Predicted ATP-dependent serine protease [Postt | 80.15 | |
| PRK10263 | 1355 | DNA translocase FtsK; Provisional | 80.12 |
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=8.1e-34 Score=205.61 Aligned_cols=106 Identities=40% Similarity=0.611 Sum_probs=99.7
Q ss_pred cHHHHHHHHHhcCCeEEEEcccccccccCCCCCCCCCCchHHHHHHHHHhhhcCCCCCCEEEEEecCCCCCCCccccCCC
Q psy13774 2 RIATGASMARAAAPCVLFFDELDSIAKSRGGSVGDGGGAADRVINQILTEMDGMGAKKNVFIIGATNRPDIIDPAILRPG 81 (110)
Q Consensus 2 ~l~~~F~~A~~~~P~ii~iDeiD~l~~~r~~~~~~~~~~~~~~~~~ll~~ld~~~~~~~v~vi~ttn~~~~ld~al~r~g 81 (110)
.++++|+.|+.++||||||||||+++.+|..++...+.+.++++-+||++|||+.+.++|-||++||+++.||||++|||
T Consensus 232 lVRelF~lArekaPsIIFiDEIDAIg~kR~d~~t~gDrEVQRTmleLL~qlDGFD~~~nvKVI~ATNR~D~LDPALLRPG 311 (406)
T COG1222 232 LVRELFELAREKAPSIIFIDEIDAIGAKRFDSGTSGDREVQRTMLELLNQLDGFDPRGNVKVIMATNRPDILDPALLRPG 311 (406)
T ss_pred HHHHHHHHHhhcCCeEEEEechhhhhcccccCCCCchHHHHHHHHHHHHhccCCCCCCCeEEEEecCCccccChhhcCCC
Confidence 47899999999999999999999999999887766667889999999999999999999999999999999999999999
Q ss_pred ccceEEEecCCCHHHHHHHHHHHhhc
Q psy13774 82 RLDQLIYIPLPDEIWLILSDKFLYKR 107 (110)
Q Consensus 82 rfd~~i~~~~P~~~~R~~~~~~~~~~ 107 (110)
|||+.|+||+||.++|.+||+.+.++
T Consensus 312 R~DRkIEfplPd~~gR~~Il~IHtrk 337 (406)
T COG1222 312 RFDRKIEFPLPDEEGRAEILKIHTRK 337 (406)
T ss_pred cccceeecCCCCHHHHHHHHHHHhhh
Confidence 99999999999999999999988753
|
|
| >KOG0734|consensus | Back alignment and domain information |
|---|
| >KOG0733|consensus | Back alignment and domain information |
|---|
| >KOG0730|consensus | Back alignment and domain information |
|---|
| >KOG0736|consensus | Back alignment and domain information |
|---|
| >KOG0733|consensus | Back alignment and domain information |
|---|
| >COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0652|consensus | Back alignment and domain information |
|---|
| >KOG0728|consensus | Back alignment and domain information |
|---|
| >KOG0731|consensus | Back alignment and domain information |
|---|
| >KOG0727|consensus | Back alignment and domain information |
|---|
| >KOG0735|consensus | Back alignment and domain information |
|---|
| >KOG0726|consensus | Back alignment and domain information |
|---|
| >KOG0738|consensus | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >CHL00206 ycf2 Ycf2; Provisional | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >PRK10733 hflB ATP-dependent metalloprotease; Reviewed | Back alignment and domain information |
|---|
| >KOG0739|consensus | Back alignment and domain information |
|---|
| >KOG0729|consensus | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >KOG0651|consensus | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >KOG0732|consensus | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0730|consensus | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >KOG0740|consensus | Back alignment and domain information |
|---|
| >KOG0737|consensus | Back alignment and domain information |
|---|
| >KOG0741|consensus | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >KOG0743|consensus | Back alignment and domain information |
|---|
| >KOG0742|consensus | Back alignment and domain information |
|---|
| >KOG0744|consensus | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0735|consensus | Back alignment and domain information |
|---|
| >KOG0736|consensus | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >TIGR00763 lon ATP-dependent protease La | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >PRK07940 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10787 DNA-binding ATP-dependent protease La; Provisional | Back alignment and domain information |
|---|
| >TIGR00678 holB DNA polymerase III, delta' subunit | Back alignment and domain information |
|---|
| >PRK06964 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK05707 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR02902 spore_lonB ATP-dependent protease LonB | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK09112 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK08769 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK04132 replication factor C small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK07993 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK06871 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK06090 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional | Back alignment and domain information |
|---|
| >PRK07471 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG0714 MoxR-like ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >KOG2004|consensus | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PRK14970 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) | Back alignment and domain information |
|---|
| >PRK07133 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK13407 bchI magnesium chelatase subunit I; Provisional | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14959 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14965 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14953 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08058 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >PRK14948 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit | Back alignment and domain information |
|---|
| >PRK06305 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >smart00350 MCM minichromosome maintenance proteins | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08451 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07276 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >PRK05564 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR02903 spore_lon_C ATP-dependent protease, Lon family | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >CHL00081 chlI Mg-protoporyphyrin IX chelatase | Back alignment and domain information |
|---|
| >PRK06647 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK07399 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK06581 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >PRK08699 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK07132 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0741|consensus | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >PRK14971 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12846 AAA_10: AAA-like domain | Back alignment and domain information |
|---|
| >PRK05818 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK05917 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02442 Cob-chelat-sub cobaltochelatase subunit | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK09862 putative ATP-dependent protease; Provisional | Back alignment and domain information |
|---|
| >PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08485 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0989|consensus | Back alignment and domain information |
|---|
| >PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite | Back alignment and domain information |
|---|
| >COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins | Back alignment and domain information |
|---|
| >PRK13531 regulatory ATPase RavA; Provisional | Back alignment and domain information |
|---|
| >TIGR00368 Mg chelatase-related protein | Back alignment and domain information |
|---|
| >COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] | Back alignment and domain information |
|---|
| >KOG0745|consensus | Back alignment and domain information |
|---|
| >KOG2028|consensus | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >KOG1514|consensus | Back alignment and domain information |
|---|
| >KOG1942|consensus | Back alignment and domain information |
|---|
| >COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PTZ00111 DNA replication licensing factor MCM4; Provisional | Back alignment and domain information |
|---|
| >PRK13406 bchD magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A | Back alignment and domain information |
|---|
| >PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals | Back alignment and domain information |
|---|
| >KOG2228|consensus | Back alignment and domain information |
|---|
| >TIGR00764 lon_rel lon-related putative ATP-dependent protease | Back alignment and domain information |
|---|
| >PF13304 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >PHA00012 I assembly protein | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >KOG1051|consensus | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0732|consensus | Back alignment and domain information |
|---|
| >COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK10365 transcriptional regulatory protein ZraR; Provisional | Back alignment and domain information |
|---|
| >PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >TIGR00602 rad24 checkpoint protein rad24 | Back alignment and domain information |
|---|
| >KOG2680|consensus | Back alignment and domain information |
|---|
| >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >PF05872 DUF853: Bacterial protein of unknown function (DUF853); InterPro: IPR008571 Members of this family have a P-loop containing nucleotide triphosphate hydrolases fold | Back alignment and domain information |
|---|
| >PRK13539 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >KOG0478|consensus | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional | Back alignment and domain information |
|---|
| >COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1051|consensus | Back alignment and domain information |
|---|
| >cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport | Back alignment and domain information |
|---|
| >KOG0990|consensus | Back alignment and domain information |
|---|
| >TIGR02974 phageshock_pspF psp operon transcriptional activator PspF | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >PF04465 DUF499: Protein of unknown function (DUF499); InterPro: IPR007555 This is a family of uncharacterised hypothetical prokaryotic proteins | Back alignment and domain information |
|---|
| >COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR01818 ntrC nitrogen regulation protein NR(I) | Back alignment and domain information |
|---|
| >PF14516 AAA_35: AAA-like domain | Back alignment and domain information |
|---|
| >COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11388 DNA-binding transcriptional regulator DhaR; Provisional | Back alignment and domain information |
|---|
| >PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 | Back alignment and domain information |
|---|
| >cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP | Back alignment and domain information |
|---|
| >TIGR02858 spore_III_AA stage III sporulation protein AA | Back alignment and domain information |
|---|
| >TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator | Back alignment and domain information |
|---|
| >cd03283 ABC_MutS-like MutS-like homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10263 DNA translocase FtsK; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 110 | ||||
| 1r7r_A | 816 | The Crystal Structure Of Murine P97VCP AT 3.6A Leng | 9e-32 | ||
| 3cf1_A | 806 | Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len | 9e-32 | ||
| 3cf0_A | 301 | Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH | 1e-31 | ||
| 2x8a_A | 274 | Human Nuclear Valosin Containing Protein Like (Nvl) | 4e-20 | ||
| 3h4m_A | 285 | Aaa Atpase Domain Of The Proteasome- Activating Nuc | 7e-19 | ||
| 1lv7_A | 257 | Crystal Structure Of The Aaa Domain Of Ftsh Length | 4e-18 | ||
| 3kds_E | 465 | Apo-ftsh Crystal Structure Length = 465 | 2e-17 | ||
| 2ce7_A | 476 | Edta Treated Length = 476 | 2e-17 | ||
| 2qz4_A | 262 | Human Paraplegin, Aaa Domain In Complex With Adp Le | 4e-17 | ||
| 1iy2_A | 278 | Crystal Structure Of The Ftsh Atpase Domain From Th | 7e-16 | ||
| 1ixz_A | 254 | Crystal Structure Of The Ftsh Atpase Domain From Th | 8e-16 | ||
| 4eiw_A | 508 | Whole Cytosolic Region Of Atp-Dependent Metalloprot | 1e-15 | ||
| 2dhr_A | 499 | Whole Cytosolic Region Of Atp-Dependent Metalloprot | 1e-15 | ||
| 4b4t_L | 437 | Near-Atomic Resolution Structural Model Of The Yeas | 3e-15 | ||
| 4b4t_J | 405 | Near-Atomic Resolution Structural Model Of The Yeas | 3e-14 | ||
| 2r62_A | 268 | Crystal Structure Of Helicobacter Pylori Atp Depend | 9e-14 | ||
| 4b4t_K | 428 | Near-Atomic Resolution Structural Model Of The Yeas | 1e-13 | ||
| 4b4t_H | 467 | Near-Atomic Resolution Structural Model Of The Yeas | 2e-13 | ||
| 4b4t_M | 434 | Near-Atomic Resolution Structural Model Of The Yeas | 7e-13 | ||
| 3hu3_A | 489 | Structure Of P97 N-D1 R155h Mutant In Complex With | 5e-11 | ||
| 1e32_A | 458 | Structure Of The N-Terminal Domain And The D1 Aaa D | 5e-11 | ||
| 3hu2_A | 489 | Structure Of P97 N-D1 R86a Mutant In Complex With A | 5e-11 | ||
| 3hu1_A | 489 | Structure Of P97 N-D1 R95g Mutant In Complex With A | 5e-11 | ||
| 4b4t_I | 437 | Near-Atomic Resolution Structural Model Of The Yeas | 8e-09 | ||
| 2rko_A | 331 | Crystal Structure Of The Vps4p-Dimer Length = 331 | 3e-07 | ||
| 2zam_A | 444 | Crystal Structure Of Mouse Skd1VPS4B APO-Form Lengt | 4e-07 | ||
| 3eie_A | 322 | Crystal Structure Of S.Cerevisiae Vps4 In The So4-B | 6e-07 | ||
| 1xwi_A | 322 | Crystal Structure Of Vps4b Length = 322 | 6e-07 | ||
| 2qp9_X | 355 | Crystal Structure Of S.Cerevisiae Vps4 Length = 355 | 6e-07 | ||
| 3eih_A | 340 | Crystal Structure Of S.Cerevisiae Vps4 In The Prese | 8e-07 | ||
| 3d8b_A | 357 | Crystal Structure Of Human Fidgetin-Like Protein 1 | 1e-06 | ||
| 3vfd_A | 389 | Human Spastin Aaa Domain Length = 389 | 2e-05 | ||
| 3b9p_A | 297 | Spastin Length = 297 | 7e-05 |
| >pdb|1R7R|A Chain A, The Crystal Structure Of Murine P97VCP AT 3.6A Length = 816 | Back alignment and structure |
|
| >pdb|3CF1|A Chain A, Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Length = 806 | Back alignment and structure |
| >pdb|3CF0|A Chain A, Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH ADP Length = 301 | Back alignment and structure |
| >pdb|2X8A|A Chain A, Human Nuclear Valosin Containing Protein Like (Nvl), C- Terminal Aaa-Atpase Domain Length = 274 | Back alignment and structure |
| >pdb|3H4M|A Chain A, Aaa Atpase Domain Of The Proteasome- Activating Nucleotidase Length = 285 | Back alignment and structure |
| >pdb|1LV7|A Chain A, Crystal Structure Of The Aaa Domain Of Ftsh Length = 257 | Back alignment and structure |
| >pdb|3KDS|E Chain E, Apo-ftsh Crystal Structure Length = 465 | Back alignment and structure |
| >pdb|2CE7|A Chain A, Edta Treated Length = 476 | Back alignment and structure |
| >pdb|2QZ4|A Chain A, Human Paraplegin, Aaa Domain In Complex With Adp Length = 262 | Back alignment and structure |
| >pdb|1IY2|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 278 | Back alignment and structure |
| >pdb|1IXZ|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 254 | Back alignment and structure |
| >pdb|4EIW|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 508 | Back alignment and structure |
| >pdb|2DHR|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 499 | Back alignment and structure |
| >pdb|4B4T|L Chain L, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 | Back alignment and structure |
| >pdb|4B4T|J Chain J, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 405 | Back alignment and structure |
| >pdb|2R62|A Chain A, Crystal Structure Of Helicobacter Pylori Atp Dependent Protease, Ftsh Length = 268 | Back alignment and structure |
| >pdb|4B4T|K Chain K, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 428 | Back alignment and structure |
| >pdb|4B4T|H Chain H, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 467 | Back alignment and structure |
| >pdb|4B4T|M Chain M, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 434 | Back alignment and structure |
| >pdb|3HU3|A Chain A, Structure Of P97 N-D1 R155h Mutant In Complex With Atpgs Length = 489 | Back alignment and structure |
| >pdb|1E32|A Chain A, Structure Of The N-Terminal Domain And The D1 Aaa Domain Of Membrane Fusion Atpase P97 Length = 458 | Back alignment and structure |
| >pdb|3HU2|A Chain A, Structure Of P97 N-D1 R86a Mutant In Complex With Atpgs Length = 489 | Back alignment and structure |
| >pdb|3HU1|A Chain A, Structure Of P97 N-D1 R95g Mutant In Complex With Atpgs Length = 489 | Back alignment and structure |
| >pdb|4B4T|I Chain I, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 | Back alignment and structure |
| >pdb|2RKO|A Chain A, Crystal Structure Of The Vps4p-Dimer Length = 331 | Back alignment and structure |
| >pdb|2ZAM|A Chain A, Crystal Structure Of Mouse Skd1VPS4B APO-Form Length = 444 | Back alignment and structure |
| >pdb|3EIE|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The So4-Bound State Length = 322 | Back alignment and structure |
| >pdb|1XWI|A Chain A, Crystal Structure Of Vps4b Length = 322 | Back alignment and structure |
| >pdb|2QP9|X Chain X, Crystal Structure Of S.Cerevisiae Vps4 Length = 355 | Back alignment and structure |
| >pdb|3EIH|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The Presence Of Atpgammas Length = 340 | Back alignment and structure |
| >pdb|3D8B|A Chain A, Crystal Structure Of Human Fidgetin-Like Protein 1 In Complex With Adp Length = 357 | Back alignment and structure |
| >pdb|3VFD|A Chain A, Human Spastin Aaa Domain Length = 389 | Back alignment and structure |
| >pdb|3B9P|A Chain A, Spastin Length = 297 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 110 | |||
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 1e-58 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 4e-56 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 2e-50 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 3e-28 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 3e-38 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 8e-38 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 8e-37 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 5e-36 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 1e-35 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 4e-35 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 3e-32 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 5e-32 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 5e-30 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 7e-30 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 1e-29 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 3e-29 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 5e-29 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 1e-28 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 1e-28 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 1e-28 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 1e-27 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 2e-18 |
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 | Back alignment and structure |
|---|
Score = 181 bits (461), Expect = 1e-58
Identities = 79/85 (92%), Positives = 82/85 (96%)
Query: 10 ARAAAPCVLFFDELDSIAKSRGGSVGDGGGAADRVINQILTEMDGMGAKKNVFIIGATNR 69
AR AAPCVLFFDELDSIAK+RGG++GDGGGAADRVINQILTEMDGM KKNVFIIGATNR
Sbjct: 104 ARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNR 163
Query: 70 PDIIDPAILRPGRLDQLIYIPLPDE 94
PDIIDPAILRPGRLDQLIYIPLPDE
Sbjct: 164 PDIIDPAILRPGRLDQLIYIPLPDE 188
|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Length = 262 | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Length = 278 | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Length = 476 | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Length = 268 | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Length = 499 | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 110 | |||
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 99.97 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 99.97 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 99.97 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 99.96 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 99.96 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 99.96 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 99.95 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 99.93 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 99.87 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 99.87 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 99.86 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 99.84 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 99.82 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 99.8 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 99.8 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 99.79 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 99.79 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 99.79 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 99.79 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 99.78 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 99.78 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 99.77 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 99.77 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 99.75 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 99.71 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 99.69 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 99.68 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 99.67 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 99.64 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 99.4 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 99.23 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 99.19 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 99.11 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 99.11 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 99.0 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 98.98 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 98.95 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 98.89 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 98.85 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 98.82 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 98.77 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 98.76 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 98.75 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 98.73 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 98.7 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 98.69 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 98.63 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 98.62 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 98.62 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 98.61 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 98.6 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 98.58 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 98.57 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 98.54 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 98.53 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 98.53 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 98.49 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 98.43 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 98.41 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 98.41 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 98.38 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 98.36 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 98.35 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 98.34 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 98.33 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 98.29 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 98.28 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 98.23 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 98.22 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 98.21 | |
| 3f9v_A | 595 | Minichromosome maintenance protein MCM; replicativ | 98.16 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 98.15 | |
| 2gno_A | 305 | DNA polymerase III, gamma subunit-related protein; | 98.13 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 98.03 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 97.99 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 97.99 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 97.96 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 97.92 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 97.88 | |
| 2r2a_A | 199 | Uncharacterized protein; zonular occludens toxin, | 97.83 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 97.67 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 97.64 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 97.51 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 97.32 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 97.31 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 96.64 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 96.59 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 96.04 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 96.03 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 96.0 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 95.99 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 95.87 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 95.74 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 95.69 | |
| 3f8t_A | 506 | Predicted ATPase involved in replication control, | 95.54 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 95.47 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 94.47 | |
| 2iut_A | 574 | DNA translocase FTSK; nucleotide-binding, chromoso | 94.23 | |
| 1jr3_D | 343 | DNA polymerase III, delta subunit; processivity, p | 93.78 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 92.94 | |
| 2ius_A | 512 | DNA translocase FTSK; nucleotide-binding, chromoso | 90.12 | |
| 3dzd_A | 368 | Transcriptional regulator (NTRC family); sigma43 a | 89.81 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 89.73 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 89.73 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 89.27 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 85.92 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 85.46 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 85.33 | |
| 2krk_A | 86 | 26S protease regulatory subunit 8; structural geno | 84.94 | |
| 1e9r_A | 437 | Conjugal transfer protein TRWB; coupling protein, | 84.83 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 84.26 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 82.47 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 82.34 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 80.54 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 80.48 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 80.33 |
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Probab=99.97 E-value=2.2e-31 Score=197.00 Aligned_cols=106 Identities=38% Similarity=0.587 Sum_probs=97.4
Q ss_pred cHHHHHHHHHhcCCeEEEEcccccccccCCCCCCCCCCchHHHHHHHHHhhhcCCCCCCEEEEEecCCCCCCCccccCCC
Q psy13774 2 RIATGASMARAAAPCVLFFDELDSIAKSRGGSVGDGGGAADRVINQILTEMDGMGAKKNVFIIGATNRPDIIDPAILRPG 81 (110)
Q Consensus 2 ~l~~~F~~A~~~~P~ii~iDeiD~l~~~r~~~~~~~~~~~~~~~~~ll~~ld~~~~~~~v~vi~ttn~~~~ld~al~r~g 81 (110)
+++++|..|++++||||||||+|+++++|.......+....+++++||++||++....+|+||||||+|+.||||++|||
T Consensus 229 ~vr~lF~~Ar~~aP~IIFiDEiDai~~~R~~~~~~~~~~~~~~l~~lL~~lDg~~~~~~V~vIaATNrpd~LDpAllRpG 308 (405)
T 4b4t_J 229 MVRELFVMAREHAPSIIFMDEIDSIGSTRVEGSGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPG 308 (405)
T ss_dssp HHHHHHHHHHHTCSEEEEEESSSCCTTSCSCSSSGGGGHHHHHHHHHHHHHHTTTCCCCEEEEEEESCSSSSCHHHHSTT
T ss_pred HHHHHHHHHHHhCCceEeeecchhhccCCCCCCCCCcHHHHHHHHHHHHhhhccCCCCCeEEEeccCChhhCCHhHcCCC
Confidence 58999999999999999999999999988765544444677899999999999988899999999999999999999999
Q ss_pred ccceEEEecCCCHHHHHHHHHHHhhc
Q psy13774 82 RLDQLIYIPLPDEIWLILSDKFLYKR 107 (110)
Q Consensus 82 rfd~~i~~~~P~~~~R~~~~~~~~~~ 107 (110)
|||++|+|++||.++|..||+.++++
T Consensus 309 RfD~~I~i~lPd~~~R~~Il~~~~~~ 334 (405)
T 4b4t_J 309 RIDRKIEFPPPSVAARAEILRIHSRK 334 (405)
T ss_dssp SSCCEEECCCCCHHHHHHHHHHHHTT
T ss_pred cCceEEEcCCcCHHHHHHHHHHHhcC
Confidence 99999999999999999999988764
|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* | Back alignment and structure |
|---|
| >1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A | Back alignment and structure |
|---|
| >2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* | Back alignment and structure |
|---|
| >3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 110 | ||||
| d1ixza_ | 247 | c.37.1.20 (A:) AAA domain of cell division protein | 5e-38 | |
| d1lv7a_ | 256 | c.37.1.20 (A:) AAA domain of cell division protein | 6e-37 | |
| d1r7ra3 | 265 | c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p | 2e-28 | |
| d1w44a_ | 321 | c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta | 4e-24 | |
| d1e32a2 | 258 | c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p | 3e-13 | |
| d1gvnb_ | 273 | c.37.1.21 (B:) Plasmid maintenance system epsilon/ | 6e-09 | |
| d1d2na_ | 246 | c.37.1.20 (A:) Hexamerization domain of N-ethylmal | 9e-09 | |
| d1svma_ | 362 | c.37.1.20 (A:) Papillomavirus large T antigen heli | 3e-08 | |
| d1ofha_ | 309 | c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId | 5e-07 |
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: AAA domain of cell division protein FtsH species: Thermus thermophilus [TaxId: 274]
Score = 126 bits (317), Expect = 5e-38
Identities = 40/87 (45%), Positives = 57/87 (65%)
Query: 8 SMARAAAPCVLFFDELDSIAKSRGGSVGDGGGAADRVINQILTEMDGMGAKKNVFIIGAT 67
A+ APC++F DE+D++ + RG VG G ++ +NQ+L EMDG + ++ AT
Sbjct: 95 ETAKRHAPCIVFIDEIDAVGRKRGSGVGGGNDEREQTLNQLLVEMDGFEKDTAIVVMAAT 154
Query: 68 NRPDIIDPAILRPGRLDQLIYIPLPDE 94
NRPDI+DPA+LRPGR D+ I I PD
Sbjct: 155 NRPDILDPALLRPGRFDRQIAIDAPDV 181
|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 110 | |||
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 99.96 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 99.96 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 99.94 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 99.94 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 99.81 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 99.75 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 99.37 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 98.46 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 98.38 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 98.36 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 98.31 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 98.27 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 98.16 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 98.03 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 97.98 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 97.97 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 97.95 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 97.91 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 97.89 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 97.77 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 97.72 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 97.65 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 97.48 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 97.48 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 97.34 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 97.28 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 97.24 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 96.25 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 95.52 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 93.9 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 93.46 | |
| d1e69a_ | 308 | Smc head domain {Thermotoga maritima [TaxId: 2336] | 89.76 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 86.67 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 85.3 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 84.73 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 84.54 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 81.46 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 80.46 |
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: AAA domain of cell division protein FtsH species: Escherichia coli [TaxId: 562]
Probab=99.96 E-value=1.2e-29 Score=176.82 Aligned_cols=106 Identities=40% Similarity=0.747 Sum_probs=97.0
Q ss_pred cHHHHHHHHHhcCCeEEEEcccccccccCCCCCCCCCCchHHHHHHHHHhhhcCCCCCCEEEEEecCCCCCCCccccCCC
Q psy13774 2 RIATGASMARAAAPCVLFFDELDSIAKSRGGSVGDGGGAADRVINQILTEMDGMGAKKNVFIIGATNRPDIIDPAILRPG 81 (110)
Q Consensus 2 ~l~~~F~~A~~~~P~ii~iDeiD~l~~~r~~~~~~~~~~~~~~~~~ll~~ld~~~~~~~v~vi~ttn~~~~ld~al~r~g 81 (110)
+|+++|+.|++++||||||||+|+++.+|+...........+++++|++++|++....+|+||||||+|+.||++++|||
T Consensus 92 ~l~~~f~~A~~~~P~il~iDeiD~l~~~r~~~~~~~~~~~~~~~~~ll~~~d~~~~~~~v~vIatTn~~~~ld~al~R~g 171 (256)
T d1lv7a_ 92 RVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVEMDGFEGNEGIIVIAATNRPDVLDPALLRPG 171 (256)
T ss_dssp HHHHHHHHHHTTCSEEEEETTHHHHTCCCSTTSCCTTCHHHHHHHHHHHHHHTCCSSSCEEEEEEESCTTTSCGGGGSTT
T ss_pred HHHHHHHHHHHcCCEEEEEEChhhhCccCCCCCCCCcHHHHHHHHHHHHHhhCCCCCCCEEEEEeCCCcccCCHhHcCCC
Confidence 58899999999999999999999999988766655555677899999999999988889999999999999999999999
Q ss_pred ccceEEEecCCCHHHHHHHHHHHhhc
Q psy13774 82 RLDQLIYIPLPDEIWLILSDKFLYKR 107 (110)
Q Consensus 82 rfd~~i~~~~P~~~~R~~~~~~~~~~ 107 (110)
|||++|+|++|+.++|..|++.++++
T Consensus 172 Rfd~~i~i~~P~~~~R~~il~~~l~~ 197 (256)
T d1lv7a_ 172 RFDRQVVVGLPDVRGREQILKVHMRR 197 (256)
T ss_dssp SSCEEEECCCCCHHHHHHHHHHHHTT
T ss_pred CCCEEEECCCcCHHHHHHHHHHhccC
Confidence 99999999999999999999988754
|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|