Psyllid ID: psy13826
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 173 | ||||||
| 47205479 | 702 | unnamed protein product [Tetraodon nigro | 0.658 | 0.162 | 0.75 | 2e-46 | |
| 324505695 | 213 | Ras-related protein Rab-14 [Ascaris suum | 0.554 | 0.450 | 0.885 | 4e-45 | |
| 312085696 | 213 | RAB14 protein [Loa loa] gi|307760054|gb| | 0.549 | 0.446 | 0.894 | 6e-45 | |
| 170581209 | 213 | Ras-related protein Rab-14 [Brugia malay | 0.549 | 0.446 | 0.894 | 6e-45 | |
| 391339468 | 214 | PREDICTED: ras-related protein Rab-14-li | 0.554 | 0.448 | 0.885 | 9e-45 | |
| 301299077 | 217 | Rab14 [Aiptasia pulchella] | 0.554 | 0.442 | 0.864 | 1e-44 | |
| 156390648 | 217 | predicted protein [Nematostella vectensi | 0.554 | 0.442 | 0.864 | 1e-44 | |
| 339238789 | 180 | GTP-binding protein yptV4 [Trichinella s | 0.537 | 0.516 | 0.892 | 1e-44 | |
| 357612414 | 213 | Rab-protein 14 [Danaus plexippus] | 0.543 | 0.441 | 0.893 | 2e-44 | |
| 320168221 | 212 | RAB14 protein [Capsaspora owczarzaki ATC | 0.520 | 0.424 | 0.911 | 2e-44 |
| >gi|47205479|emb|CAG13667.1| unnamed protein product [Tetraodon nigroviridis] | Back alignment and taxonomy information |
|---|
Score = 190 bits (482), Expect = 2e-46, Method: Composition-based stats.
Identities = 87/116 (75%), Positives = 101/116 (87%), Gaps = 2/116 (1%)
Query: 56 VSTSQPITRKNL--LWALVSKMSSSGQYSYSYIFKYIIIGDMGVGKSCLLHQFTEQKFMP 113
+S S P TR++L +V + ++ Y+YSYIFKYIIIGDMGVGKSCLLHQFTE+KFM
Sbjct: 397 MSLSSPHTRRSLGSRGPVVRAIMTAAPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMA 456
Query: 114 DCPHTIGVEFGTRIIEVHGEKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVIDVS 169
DCPHTIGVEFGTRI+EVHG+K+KLQIWDTAGQERFRAVTRSYYRGAAGALMV D++
Sbjct: 457 DCPHTIGVEFGTRIMEVHGQKVKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDIT 512
|
Source: Tetraodon nigroviridis Species: Tetraodon nigroviridis Genus: Tetraodon Family: Tetraodontidae Order: Tetraodontiformes Class: Actinopterygii Phylum: Chordata Superkingdom: Eukaryota |
| >gi|324505695|gb|ADY42443.1| Ras-related protein Rab-14 [Ascaris suum] | Back alignment and taxonomy information |
|---|
| >gi|312085696|ref|XP_003144782.1| RAB14 protein [Loa loa] gi|307760054|gb|EFO19288.1| Ras-like protein Rab-14 [Loa loa] | Back alignment and taxonomy information |
|---|
| >gi|170581209|ref|XP_001895584.1| Ras-related protein Rab-14 [Brugia malayi] gi|158597400|gb|EDP35557.1| Ras-related protein Rab-14, putative [Brugia malayi] | Back alignment and taxonomy information |
|---|
| >gi|391339468|ref|XP_003744071.1| PREDICTED: ras-related protein Rab-14-like [Metaseiulus occidentalis] | Back alignment and taxonomy information |
|---|
| >gi|301299077|gb|ADK66883.1| Rab14 [Aiptasia pulchella] | Back alignment and taxonomy information |
|---|
| >gi|156390648|ref|XP_001635382.1| predicted protein [Nematostella vectensis] gi|156222475|gb|EDO43319.1| predicted protein [Nematostella vectensis] | Back alignment and taxonomy information |
|---|
| >gi|339238789|ref|XP_003380949.1| GTP-binding protein yptV4 [Trichinella spiralis] gi|316976091|gb|EFV59434.1| GTP-binding protein yptV4 [Trichinella spiralis] | Back alignment and taxonomy information |
|---|
| >gi|357612414|gb|EHJ67983.1| Rab-protein 14 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|320168221|gb|EFW45120.1| RAB14 protein [Capsaspora owczarzaki ATCC 30864] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 173 | ||||||
| UNIPROTKB|Q5ZKU5 | 215 | RAB14 "Ras-related protein Rab | 0.445 | 0.358 | 0.909 | 1.1e-34 | |
| UNIPROTKB|Q3ZBG1 | 215 | RAB14 "Uncharacterized protein | 0.445 | 0.358 | 0.909 | 1.1e-34 | |
| UNIPROTKB|E2R0K4 | 215 | RAB14 "Uncharacterized protein | 0.445 | 0.358 | 0.909 | 1.1e-34 | |
| UNIPROTKB|P61106 | 215 | RAB14 "Ras-related protein Rab | 0.445 | 0.358 | 0.909 | 1.1e-34 | |
| UNIPROTKB|F2Z5N8 | 215 | RAB14 "Ras-related protein Rab | 0.445 | 0.358 | 0.909 | 1.1e-34 | |
| UNIPROTKB|Q52NJ6 | 215 | RAB14 "Ras-related protein Rab | 0.445 | 0.358 | 0.909 | 1.1e-34 | |
| UNIPROTKB|Q5R8Z8 | 215 | RAB14 "Ras-related protein Rab | 0.445 | 0.358 | 0.909 | 1.1e-34 | |
| MGI|MGI:1915615 | 215 | Rab14 "RAB14, member RAS oncog | 0.445 | 0.358 | 0.909 | 1.1e-34 | |
| RGD|620881 | 215 | Rab14 "RAB14, member RAS oncog | 0.445 | 0.358 | 0.909 | 1.1e-34 | |
| WB|WBGene00004276 | 210 | rab-14 [Caenorhabditis elegans | 0.445 | 0.366 | 0.909 | 1.1e-34 |
| UNIPROTKB|Q5ZKU5 RAB14 "Ras-related protein Rab-14" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 376 (137.4 bits), Expect = 1.1e-34, P = 1.1e-34
Identities = 70/77 (90%), Positives = 74/77 (96%)
Query: 93 GDMGVGKSCLLHQFTEQKFMPDCPHTIGVEFGTRIIEVHGEKIKLQIWDTAGQERFRAVT 152
GDMGVGKSCLLHQFTE+KFM DCPHTIGVEFGTRIIEV G+KIKLQIWDTAGQERFRAVT
Sbjct: 18 GDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVT 77
Query: 153 RSYYRGAAGALMVIDVS 169
RSYYRGAAGALMV D++
Sbjct: 78 RSYYRGAAGALMVYDIT 94
|
|
| UNIPROTKB|Q3ZBG1 RAB14 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R0K4 RAB14 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P61106 RAB14 "Ras-related protein Rab-14" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F2Z5N8 RAB14 "Ras-related protein Rab-14" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q52NJ6 RAB14 "Ras-related protein Rab-14" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5R8Z8 RAB14 "Ras-related protein Rab-14" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1915615 Rab14 "RAB14, member RAS oncogene family" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|620881 Rab14 "RAB14, member RAS oncogene family" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00004276 rab-14 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 173 | |||
| cd04122 | 166 | cd04122, Rab14, Rab GTPase family 14 (Rab14) | 8e-64 | |
| smart00175 | 164 | smart00175, RAB, Rab subfamily of small GTPases | 4e-52 | |
| cd01866 | 168 | cd01866, Rab2, Rab GTPase family 2 (Rab2) | 3e-50 | |
| cd04113 | 161 | cd04113, Rab4, Rab GTPase family 4 (Rab4) | 2e-48 | |
| cd00154 | 159 | cd00154, Rab, Ras-related in brain (Rab) family of | 6e-47 | |
| PLN03108 | 210 | PLN03108, PLN03108, Rab family protein; Provisiona | 8e-44 | |
| cd01868 | 165 | cd01868, Rab11_like, Rab GTPase family 11 (Rab11)- | 1e-43 | |
| pfam00071 | 162 | pfam00071, Ras, Ras family | 3e-43 | |
| cd01867 | 167 | cd01867, Rab8_Rab10_Rab13_like, Rab GTPase familie | 2e-38 | |
| PLN03110 | 216 | PLN03110, PLN03110, Rab GTPase; Provisional | 8e-36 | |
| cd01869 | 166 | cd01869, Rab1_Ypt1, Rab GTPase family 1 includes t | 2e-35 | |
| cd01863 | 161 | cd01863, Rab18, Rab GTPase family 18 (Rab18) | 2e-35 | |
| cd04111 | 211 | cd04111, Rab39, Rab GTPase family 39 (Rab39) | 5e-35 | |
| cd04114 | 169 | cd04114, Rab30, Rab GTPase family 30 (Rab30) | 2e-33 | |
| cd01864 | 165 | cd01864, Rab19, Rab GTPase family 19 (Rab19) | 3e-33 | |
| cd04110 | 199 | cd04110, Rab35, Rab GTPase family 35 (Rab35) | 6e-33 | |
| cd04107 | 201 | cd04107, Rab32_Rab38, Rab GTPase families 18 (Rab1 | 3e-30 | |
| cd01860 | 163 | cd01860, Rab5_related, Rab-related GTPase family i | 1e-29 | |
| cd04115 | 170 | cd04115, Rab33B_Rab33A, Rab GTPase family 33 inclu | 3e-29 | |
| cd01862 | 172 | cd01862, Rab7, Rab GTPase family 7 (Rab7) | 1e-28 | |
| cd04117 | 164 | cd04117, Rab15, Rab GTPase family 15 (Rab15) | 1e-27 | |
| COG1100 | 219 | COG1100, COG1100, GTPase SAR1 and related small G | 2e-27 | |
| cd04120 | 202 | cd04120, Rab12, Rab GTPase family 12 (Rab12) | 6e-27 | |
| PLN03118 | 211 | PLN03118, PLN03118, Rab family protein; Provisiona | 1e-26 | |
| cd04116 | 170 | cd04116, Rab9, Rab GTPase family 9 (Rab9) | 3e-26 | |
| cd04112 | 191 | cd04112, Rab26, Rab GTPase family 26 (Rab26) | 7e-26 | |
| cd04127 | 180 | cd04127, Rab27A, Rab GTPase family 27a (Rab27a) | 8e-24 | |
| cd01865 | 165 | cd01865, Rab3, Rab GTPase family 3 contains Rab3A, | 3e-23 | |
| cd01861 | 161 | cd01861, Rab6, Rab GTPase family 6 (Rab6) | 2e-22 | |
| TIGR00231 | 162 | TIGR00231, small_GTP, small GTP-binding protein do | 3e-22 | |
| cd04106 | 162 | cd04106, Rab23_like, Rab GTPase family 23 (Rab23)- | 6e-22 | |
| cd04123 | 162 | cd04123, Rab21, Rab GTPase family 21 (Rab21) | 2e-21 | |
| cd04108 | 170 | cd04108, Rab36_Rab34, Rab GTPase families 34 (Rab3 | 3e-21 | |
| cd04119 | 168 | cd04119, RJL, Rab GTPase family J-like (RabJ-like) | 9e-18 | |
| cd04121 | 189 | cd04121, Rab40, Rab GTPase family 40 (Rab40) conta | 2e-17 | |
| cd04118 | 193 | cd04118, Rab24, Rab GTPase family 24 (Rab24) | 8e-17 | |
| cd00876 | 160 | cd00876, Ras, Rat sarcoma (Ras) family of small gu | 6e-15 | |
| cd04122 | 166 | cd04122, Rab14, Rab GTPase family 14 (Rab14) | 2e-14 | |
| cd04124 | 161 | cd04124, RabL2, Rab GTPase-like family 2 (Rab-like | 2e-14 | |
| cd04126 | 220 | cd04126, Rab20, Rab GTPase family 20 (Rab20) | 2e-14 | |
| cd00882 | 161 | cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s | 2e-14 | |
| cd04145 | 164 | cd04145, M_R_Ras_like, R-Ras2/TC21, M-Ras/R-Ras3 | 2e-13 | |
| cd00877 | 166 | cd00877, Ran, Ras-related nuclear proteins (Ran)/T | 8e-13 | |
| PTZ00132 | 215 | PTZ00132, PTZ00132, GTP-binding nuclear protein Ra | 8e-13 | |
| smart00173 | 164 | smart00173, RAS, Ras subfamily of RAS small GTPase | 5e-12 | |
| smart00010 | 166 | smart00010, small_GTPase, Small GTPase of the Ras | 6e-12 | |
| cd01866 | 168 | cd01866, Rab2, Rab GTPase family 2 (Rab2) | 1e-11 | |
| cd04139 | 163 | cd04139, RalA_RalB, Ral (Ras-like) family containi | 2e-11 | |
| PTZ00099 | 176 | PTZ00099, PTZ00099, rab6; Provisional | 3e-11 | |
| cd00157 | 171 | cd00157, Rho, Ras homology family (Rho) of small g | 1e-10 | |
| PLN03108 | 210 | PLN03108, PLN03108, Rab family protein; Provisiona | 2e-10 | |
| pfam08477 | 116 | pfam08477, Miro, Miro-like protein | 2e-10 | |
| PLN03071 | 219 | PLN03071, PLN03071, GTP-binding nuclear protein Ra | 2e-10 | |
| cd04109 | 213 | cd04109, Rab28, Rab GTPase family 28 (Rab28) | 6e-10 | |
| cd04133 | 173 | cd04133, Rop_like, Rho-related protein from plants | 1e-09 | |
| cd04138 | 162 | cd04138, H_N_K_Ras_like, Ras GTPase family contain | 1e-09 | |
| smart00174 | 174 | smart00174, RHO, Rho (Ras homology) subfamily of R | 1e-09 | |
| cd00878 | 158 | cd00878, Arf_Arl, ADP-ribosylation factor(Arf)/Arf | 2e-09 | |
| cd04137 | 180 | cd04137, RheB, Ras Homolog Enriched in Brain (RheB | 3e-09 | |
| cd04177 | 168 | cd04177, RSR1, RSR1/Bud1p family GTPase | 5e-09 | |
| smart00176 | 200 | smart00176, RAN, Ran (Ras-related nuclear proteins | 6e-09 | |
| cd09914 | 161 | cd09914, RocCOR, Ras of complex proteins (Roc) C-t | 6e-09 | |
| cd04141 | 172 | cd04141, Rit_Rin_Ric, Ras-like protein in all tiss | 8e-09 | |
| smart00175 | 164 | smart00175, RAB, Rab subfamily of small GTPases | 1e-08 | |
| cd04132 | 197 | cd04132, Rho4_like, Ras homology family 4 (Rho4) o | 1e-08 | |
| cd04176 | 163 | cd04176, Rap2, Rap2 family GTPase consists of Rap2 | 4e-08 | |
| cd04113 | 161 | cd04113, Rab4, Rab GTPase family 4 (Rab4) | 5e-08 | |
| cd04136 | 164 | cd04136, Rap_like, Rap-like family consists of Rap | 5e-08 | |
| cd01875 | 191 | cd01875, RhoG, Ras homolog family, member G (RhoG) | 8e-08 | |
| cd04134 | 185 | cd04134, Rho3, Ras homology family 3 (Rho3) of sma | 8e-08 | |
| cd00154 | 159 | cd00154, Rab, Ras-related in brain (Rab) family of | 1e-07 | |
| PTZ00369 | 189 | PTZ00369, PTZ00369, Ras-like protein; Provisional | 1e-07 | |
| cd01870 | 175 | cd01870, RhoA_like, Ras homology family A (RhoA)-l | 1e-07 | |
| cd04128 | 182 | cd04128, Spg1, Septum-promoting GTPase (Spg1) | 2e-07 | |
| cd01871 | 174 | cd01871, Rac1_like, Ras-related C3 botulinum toxin | 3e-07 | |
| cd04156 | 160 | cd04156, ARLTS1, Arf-like tumor suppressor gene 1 | 3e-07 | |
| cd04158 | 169 | cd04158, ARD1, (ADP-ribosylation factor domain pro | 3e-07 | |
| cd04129 | 190 | cd04129, Rho2, Ras homology family 2 (Rho2) of sma | 4e-07 | |
| cd04153 | 174 | cd04153, Arl5_Arl8, Arf-like 5 (Arl5) and 8 (Arl8) | 4e-07 | |
| pfam00071 | 162 | pfam00071, Ras, Ras family | 5e-07 | |
| cd04159 | 159 | cd04159, Arl10_like, Arf-like 9 (Arl9) and 10 (Arl | 6e-07 | |
| smart00177 | 175 | smart00177, ARF, ARF-like small GTPases; ARF, ADP- | 9e-07 | |
| pfam00025 | 174 | pfam00025, Arf, ADP-ribosylation factor family | 9e-07 | |
| cd04152 | 183 | cd04152, Arl4_Arl7, Arf-like 4 (Arl4) and 7 (Arl7) | 1e-06 | |
| COG2229 | 187 | COG2229, COG2229, Predicted GTPase [General functi | 1e-06 | |
| cd04175 | 164 | cd04175, Rap1, Rap1 family GTPase consists of Rap1 | 1e-06 | |
| cd04130 | 173 | cd04130, Wrch_1, Wnt-1 responsive Cdc42 homolog (W | 3e-06 | |
| cd04131 | 176 | cd04131, Rnd, Rho family GTPase subfamily Rnd incl | 4e-06 | |
| cd04172 | 182 | cd04172, Rnd3_RhoE_Rho8, Rnd3/RhoE/Rho8 GTPases | 5e-06 | |
| cd01862 | 172 | cd01862, Rab7, Rab GTPase family 7 (Rab7) | 6e-06 | |
| cd04144 | 190 | cd04144, Ras2, Rat sarcoma (Ras) family 2 of small | 6e-06 | |
| cd01874 | 175 | cd01874, Cdc42, cell division cycle 42 (Cdc42) is | 7e-06 | |
| cd04148 | 219 | cd04148, RGK, Rem, Rem2, Rad, Gem/Kir (RGK) subfam | 8e-06 | |
| cd04111 | 211 | cd04111, Rab39, Rab GTPase family 39 (Rab39) | 9e-06 | |
| cd01869 | 166 | cd01869, Rab1_Ypt1, Rab GTPase family 1 includes t | 1e-05 | |
| cd04102 | 204 | cd04102, RabL3, Rab GTPase-like family 3 (Rab-like | 1e-05 | |
| PLN00023 | 334 | PLN00023, PLN00023, GTP-binding protein; Provision | 1e-05 | |
| cd01867 | 167 | cd01867, Rab8_Rab10_Rab13_like, Rab GTPase familie | 2e-05 | |
| PLN03110 | 216 | PLN03110, PLN03110, Rab GTPase; Provisional | 2e-05 | |
| cd04149 | 168 | cd04149, Arf6, ADP ribosylation factor 6 (Arf6) | 2e-05 | |
| cd04146 | 166 | cd04146, RERG_RasL11_like, Ras-related and Estroge | 2e-05 | |
| cd01868 | 165 | cd01868, Rab11_like, Rab GTPase family 11 (Rab11)- | 3e-05 | |
| cd04127 | 180 | cd04127, Rab27A, Rab GTPase family 27a (Rab27a) | 4e-05 | |
| cd04160 | 168 | cd04160, Arfrp1, Arf-related protein 1 (Arfrp1) | 4e-05 | |
| cd04173 | 221 | cd04173, Rnd2_Rho7, Rnd2/Rho7 GTPases | 8e-05 | |
| cd04114 | 169 | cd04114, Rab30, Rab GTPase family 30 (Rab30) | 2e-04 | |
| cd04115 | 170 | cd04115, Rab33B_Rab33A, Rab GTPase family 33 inclu | 2e-04 | |
| PTZ00133 | 182 | PTZ00133, PTZ00133, ADP-ribosylation factor; Provi | 2e-04 | |
| cd04147 | 197 | cd04147, Ras_dva, Ras - dorsal-ventral anterior lo | 2e-04 | |
| cd04101 | 167 | cd04101, RabL4, Rab GTPase-like family 4 (Rab-like | 2e-04 | |
| cd04135 | 174 | cd04135, Tc10, Rho GTPase TC10 (Tc10) | 4e-04 | |
| cd01864 | 165 | cd01864, Rab19, Rab GTPase family 19 (Rab19) | 5e-04 | |
| PLN00223 | 181 | PLN00223, PLN00223, ADP-ribosylation factor; Provi | 5e-04 | |
| cd04110 | 199 | cd04110, Rab35, Rab GTPase family 35 (Rab35) | 6e-04 | |
| cd04151 | 158 | cd04151, Arl1, ADP ribosylation factor 1 (Arf1) | 7e-04 | |
| cd04107 | 201 | cd04107, Rab32_Rab38, Rab GTPase families 18 (Rab1 | 8e-04 | |
| cd04155 | 174 | cd04155, Arl3, Arf-like 3 (Arl3) GTPase | 0.001 | |
| cd04150 | 159 | cd04150, Arf1_5_like, ADP-ribosylation factor-1 (A | 0.001 | |
| cd01863 | 161 | cd01863, Rab18, Rab GTPase family 18 (Rab18) | 0.002 | |
| COG1100 | 219 | COG1100, COG1100, GTPase SAR1 and related small G | 0.002 | |
| cd04140 | 165 | cd04140, ARHI_like, A Ras homolog member I (ARHI) | 0.002 | |
| PLN03118 | 211 | PLN03118, PLN03118, Rab family protein; Provisiona | 0.003 | |
| cd04174 | 232 | cd04174, Rnd1_Rho6, Rnd1/Rho6 GTPases | 0.003 | |
| cd04112 | 191 | cd04112, Rab26, Rab GTPase family 26 (Rab26) | 0.004 |
| >gnl|CDD|133322 cd04122, Rab14, Rab GTPase family 14 (Rab14) | Back alignment and domain information |
|---|
Score = 193 bits (491), Expect = 8e-64
Identities = 78/85 (91%), Positives = 83/85 (97%)
Query: 85 YIFKYIIIGDMGVGKSCLLHQFTEQKFMPDCPHTIGVEFGTRIIEVHGEKIKLQIWDTAG 144
YIFKYIIIGDMGVGKSCLLHQFTE+KFM DCPHTIGVEFGTRIIEV+G+KIKLQIWDTAG
Sbjct: 1 YIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVNGQKIKLQIWDTAG 60
Query: 145 QERFRAVTRSYYRGAAGALMVIDVS 169
QERFRAVTRSYYRGAAGALMV D++
Sbjct: 61 QERFRAVTRSYYRGAAGALMVYDIT 85
|
Rab14 GTPases are localized to biosynthetic compartments, including the rough ER, the Golgi complex, and the trans-Golgi network, and to endosomal compartments, including early endosomal vacuoles and associated vesicles. Rab14 is believed to function in both the biosynthetic and recycling pathways between the Golgi and endosomal compartments. Rab14 has also been identified on GLUT4 vesicles, and has been suggested to help regulate GLUT4 translocation. In addition, Rab14 is believed to play a role in the regulation of phagocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation. Length = 166 |
| >gnl|CDD|197555 smart00175, RAB, Rab subfamily of small GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|206658 cd01866, Rab2, Rab GTPase family 2 (Rab2) | Back alignment and domain information |
|---|
| >gnl|CDD|206696 cd04113, Rab4, Rab GTPase family 4 (Rab4) | Back alignment and domain information |
|---|
| >gnl|CDD|206640 cd00154, Rab, Ras-related in brain (Rab) family of small guanosine triphosphatases (GTPases) | Back alignment and domain information |
|---|
| >gnl|CDD|178655 PLN03108, PLN03108, Rab family protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206660 cd01868, Rab11_like, Rab GTPase family 11 (Rab11)-like includes Rab11a, Rab11b, and Rab25 | Back alignment and domain information |
|---|
| >gnl|CDD|215692 pfam00071, Ras, Ras family | Back alignment and domain information |
|---|
| >gnl|CDD|206659 cd01867, Rab8_Rab10_Rab13_like, Rab GTPase families 8, 10, 13 (Rab8, Rab10, Rab13) | Back alignment and domain information |
|---|
| >gnl|CDD|178657 PLN03110, PLN03110, Rab GTPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206661 cd01869, Rab1_Ypt1, Rab GTPase family 1 includes the yeast homolog Ypt1 | Back alignment and domain information |
|---|
| >gnl|CDD|206656 cd01863, Rab18, Rab GTPase family 18 (Rab18) | Back alignment and domain information |
|---|
| >gnl|CDD|133311 cd04111, Rab39, Rab GTPase family 39 (Rab39) | Back alignment and domain information |
|---|
| >gnl|CDD|133314 cd04114, Rab30, Rab GTPase family 30 (Rab30) | Back alignment and domain information |
|---|
| >gnl|CDD|133267 cd01864, Rab19, Rab GTPase family 19 (Rab19) | Back alignment and domain information |
|---|
| >gnl|CDD|133310 cd04110, Rab35, Rab GTPase family 35 (Rab35) | Back alignment and domain information |
|---|
| >gnl|CDD|206692 cd04107, Rab32_Rab38, Rab GTPase families 18 (Rab18) and 32 (Rab32) | Back alignment and domain information |
|---|
| >gnl|CDD|206653 cd01860, Rab5_related, Rab-related GTPase family includes Rab5 and Rab22; regulates early endosome fusion | Back alignment and domain information |
|---|
| >gnl|CDD|133315 cd04115, Rab33B_Rab33A, Rab GTPase family 33 includes Rab33A and Rab33B | Back alignment and domain information |
|---|
| >gnl|CDD|206655 cd01862, Rab7, Rab GTPase family 7 (Rab7) | Back alignment and domain information |
|---|
| >gnl|CDD|206698 cd04117, Rab15, Rab GTPase family 15 (Rab15) | Back alignment and domain information |
|---|
| >gnl|CDD|224025 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|206699 cd04120, Rab12, Rab GTPase family 12 (Rab12) | Back alignment and domain information |
|---|
| >gnl|CDD|215587 PLN03118, PLN03118, Rab family protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206697 cd04116, Rab9, Rab GTPase family 9 (Rab9) | Back alignment and domain information |
|---|
| >gnl|CDD|206695 cd04112, Rab26, Rab GTPase family 26 (Rab26) | Back alignment and domain information |
|---|
| >gnl|CDD|206700 cd04127, Rab27A, Rab GTPase family 27a (Rab27a) | Back alignment and domain information |
|---|
| >gnl|CDD|206657 cd01865, Rab3, Rab GTPase family 3 contains Rab3A, Rab3B, Rab3C and Rab3D | Back alignment and domain information |
|---|
| >gnl|CDD|206654 cd01861, Rab6, Rab GTPase family 6 (Rab6) | Back alignment and domain information |
|---|
| >gnl|CDD|232886 TIGR00231, small_GTP, small GTP-binding protein domain | Back alignment and domain information |
|---|
| >gnl|CDD|133306 cd04106, Rab23_like, Rab GTPase family 23 (Rab23)-like | Back alignment and domain information |
|---|
| >gnl|CDD|133323 cd04123, Rab21, Rab GTPase family 21 (Rab21) | Back alignment and domain information |
|---|
| >gnl|CDD|206693 cd04108, Rab36_Rab34, Rab GTPase families 34 (Rab34) and 36 (Rab36) | Back alignment and domain information |
|---|
| >gnl|CDD|133319 cd04119, RJL, Rab GTPase family J-like (RabJ-like) | Back alignment and domain information |
|---|
| >gnl|CDD|133321 cd04121, Rab40, Rab GTPase family 40 (Rab40) contains Rab40a, Rab40b and Rab40c | Back alignment and domain information |
|---|
| >gnl|CDD|133318 cd04118, Rab24, Rab GTPase family 24 (Rab24) | Back alignment and domain information |
|---|
| >gnl|CDD|206642 cd00876, Ras, Rat sarcoma (Ras) family of small guanosine triphosphatases (GTPases) | Back alignment and domain information |
|---|
| >gnl|CDD|133322 cd04122, Rab14, Rab GTPase family 14 (Rab14) | Back alignment and domain information |
|---|
| >gnl|CDD|133324 cd04124, RabL2, Rab GTPase-like family 2 (Rab-like2) | Back alignment and domain information |
|---|
| >gnl|CDD|133326 cd04126, Rab20, Rab GTPase family 20 (Rab20) | Back alignment and domain information |
|---|
| >gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) | Back alignment and domain information |
|---|
| >gnl|CDD|133345 cd04145, M_R_Ras_like, R-Ras2/TC21, M-Ras/R-Ras3 | Back alignment and domain information |
|---|
| >gnl|CDD|206643 cd00877, Ran, Ras-related nuclear proteins (Ran)/TC4 family of small GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|240284 PTZ00132, PTZ00132, GTP-binding nuclear protein Ran; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214541 smart00173, RAS, Ras subfamily of RAS small GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|197466 smart00010, small_GTPase, Small GTPase of the Ras superfamily; ill-defined subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|206658 cd01866, Rab2, Rab GTPase family 2 (Rab2) | Back alignment and domain information |
|---|
| >gnl|CDD|206710 cd04139, RalA_RalB, Ral (Ras-like) family containing highly homologous RalA and RalB | Back alignment and domain information |
|---|
| >gnl|CDD|185444 PTZ00099, PTZ00099, rab6; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206641 cd00157, Rho, Ras homology family (Rho) of small guanosine triphosphatases (GTPases) | Back alignment and domain information |
|---|
| >gnl|CDD|178655 PLN03108, PLN03108, Rab family protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219856 pfam08477, Miro, Miro-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|178620 PLN03071, PLN03071, GTP-binding nuclear protein Ran; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206694 cd04109, Rab28, Rab GTPase family 28 (Rab28) | Back alignment and domain information |
|---|
| >gnl|CDD|206705 cd04133, Rop_like, Rho-related protein from plants (Rop)-like | Back alignment and domain information |
|---|
| >gnl|CDD|133338 cd04138, H_N_K_Ras_like, Ras GTPase family containing H-Ras,N-Ras and K-Ras4A/4B | Back alignment and domain information |
|---|
| >gnl|CDD|197554 smart00174, RHO, Rho (Ras homology) subfamily of Ras-like small GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|206644 cd00878, Arf_Arl, ADP-ribosylation factor(Arf)/Arf-like (Arl) small GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|206709 cd04137, RheB, Ras Homolog Enriched in Brain (RheB) is a small GTPase | Back alignment and domain information |
|---|
| >gnl|CDD|133377 cd04177, RSR1, RSR1/Bud1p family GTPase | Back alignment and domain information |
|---|
| >gnl|CDD|128473 smart00176, RAN, Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|206741 cd09914, RocCOR, Ras of complex proteins (Roc) C-terminal of Roc (COR) domain family | Back alignment and domain information |
|---|
| >gnl|CDD|206712 cd04141, Rit_Rin_Ric, Ras-like protein in all tissues (Rit), Ras-like protein in neurons (Rin) and Ras-related protein which interacts with calmodulin (Ric) | Back alignment and domain information |
|---|
| >gnl|CDD|197555 smart00175, RAB, Rab subfamily of small GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|206704 cd04132, Rho4_like, Ras homology family 4 (Rho4) of small guanosine triphosphatases (GTPases)-like | Back alignment and domain information |
|---|
| >gnl|CDD|133376 cd04176, Rap2, Rap2 family GTPase consists of Rap2a, Rap2b, and Rap2c | Back alignment and domain information |
|---|
| >gnl|CDD|206696 cd04113, Rab4, Rab GTPase family 4 (Rab4) | Back alignment and domain information |
|---|
| >gnl|CDD|206708 cd04136, Rap_like, Rap-like family consists of Rap1, Rap2 and RSR1 | Back alignment and domain information |
|---|
| >gnl|CDD|133277 cd01875, RhoG, Ras homolog family, member G (RhoG) of small guanosine triphosphatases (GTPases) | Back alignment and domain information |
|---|
| >gnl|CDD|206706 cd04134, Rho3, Ras homology family 3 (Rho3) of small guanosine triphosphatases (GTPases) | Back alignment and domain information |
|---|
| >gnl|CDD|206640 cd00154, Rab, Ras-related in brain (Rab) family of small guanosine triphosphatases (GTPases) | Back alignment and domain information |
|---|
| >gnl|CDD|240385 PTZ00369, PTZ00369, Ras-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206662 cd01870, RhoA_like, Ras homology family A (RhoA)-like includes RhoA, RhoB and RhoC | Back alignment and domain information |
|---|
| >gnl|CDD|206701 cd04128, Spg1, Septum-promoting GTPase (Spg1) | Back alignment and domain information |
|---|
| >gnl|CDD|206663 cd01871, Rac1_like, Ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)-like consists of Rac1, Rac2 and Rac3 | Back alignment and domain information |
|---|
| >gnl|CDD|133356 cd04156, ARLTS1, Arf-like tumor suppressor gene 1 (ARLTS1 or Arl11) | Back alignment and domain information |
|---|
| >gnl|CDD|206723 cd04158, ARD1, (ADP-ribosylation factor domain protein 1 (ARD1) | Back alignment and domain information |
|---|
| >gnl|CDD|206702 cd04129, Rho2, Ras homology family 2 (Rho2) of small guanosine triphosphatases (GTPases) | Back alignment and domain information |
|---|
| >gnl|CDD|133353 cd04153, Arl5_Arl8, Arf-like 5 (Arl5) and 8 (Arl8) GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|215692 pfam00071, Ras, Ras family | Back alignment and domain information |
|---|
| >gnl|CDD|206724 cd04159, Arl10_like, Arf-like 9 (Arl9) and 10 (Arl10) GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|128474 smart00177, ARF, ARF-like small GTPases; ARF, ADP-ribosylation factor | Back alignment and domain information |
|---|
| >gnl|CDD|200938 pfam00025, Arf, ADP-ribosylation factor family | Back alignment and domain information |
|---|
| >gnl|CDD|206719 cd04152, Arl4_Arl7, Arf-like 4 (Arl4) and 7 (Arl7) GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|225138 COG2229, COG2229, Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|133375 cd04175, Rap1, Rap1 family GTPase consists of Rap1a and Rap1b isoforms | Back alignment and domain information |
|---|
| >gnl|CDD|133330 cd04130, Wrch_1, Wnt-1 responsive Cdc42 homolog (Wrch-1) is a Rho family GTPase similar to Cdc42 | Back alignment and domain information |
|---|
| >gnl|CDD|206703 cd04131, Rnd, Rho family GTPase subfamily Rnd includes Rnd1/Rho6, Rnd2/Rho7, and Rnd3/RhoE/Rho8 | Back alignment and domain information |
|---|
| >gnl|CDD|206735 cd04172, Rnd3_RhoE_Rho8, Rnd3/RhoE/Rho8 GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|206655 cd01862, Rab7, Rab GTPase family 7 (Rab7) | Back alignment and domain information |
|---|
| >gnl|CDD|133344 cd04144, Ras2, Rat sarcoma (Ras) family 2 of small guanosine triphosphatases (GTPases) | Back alignment and domain information |
|---|
| >gnl|CDD|206664 cd01874, Cdc42, cell division cycle 42 (Cdc42) is a small GTPase of the Rho family | Back alignment and domain information |
|---|
| >gnl|CDD|206715 cd04148, RGK, Rem, Rem2, Rad, Gem/Kir (RGK) subfamily of Ras GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|133311 cd04111, Rab39, Rab GTPase family 39 (Rab39) | Back alignment and domain information |
|---|
| >gnl|CDD|206661 cd01869, Rab1_Ypt1, Rab GTPase family 1 includes the yeast homolog Ypt1 | Back alignment and domain information |
|---|
| >gnl|CDD|206689 cd04102, RabL3, Rab GTPase-like family 3 (Rab-like3) | Back alignment and domain information |
|---|
| >gnl|CDD|177661 PLN00023, PLN00023, GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206659 cd01867, Rab8_Rab10_Rab13_like, Rab GTPase families 8, 10, 13 (Rab8, Rab10, Rab13) | Back alignment and domain information |
|---|
| >gnl|CDD|178657 PLN03110, PLN03110, Rab GTPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206716 cd04149, Arf6, ADP ribosylation factor 6 (Arf6) | Back alignment and domain information |
|---|
| >gnl|CDD|206713 cd04146, RERG_RasL11_like, Ras-related and Estrogen-Regulated Growth inhibitor (RERG) and Ras-like 11 (RasL11)-like families | Back alignment and domain information |
|---|
| >gnl|CDD|206660 cd01868, Rab11_like, Rab GTPase family 11 (Rab11)-like includes Rab11a, Rab11b, and Rab25 | Back alignment and domain information |
|---|
| >gnl|CDD|206700 cd04127, Rab27A, Rab GTPase family 27a (Rab27a) | Back alignment and domain information |
|---|
| >gnl|CDD|206725 cd04160, Arfrp1, Arf-related protein 1 (Arfrp1) | Back alignment and domain information |
|---|
| >gnl|CDD|206736 cd04173, Rnd2_Rho7, Rnd2/Rho7 GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|133314 cd04114, Rab30, Rab GTPase family 30 (Rab30) | Back alignment and domain information |
|---|
| >gnl|CDD|133315 cd04115, Rab33B_Rab33A, Rab GTPase family 33 includes Rab33A and Rab33B | Back alignment and domain information |
|---|
| >gnl|CDD|173423 PTZ00133, PTZ00133, ADP-ribosylation factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206714 cd04147, Ras_dva, Ras - dorsal-ventral anterior localization (Ras-dva) family | Back alignment and domain information |
|---|
| >gnl|CDD|206688 cd04101, RabL4, Rab GTPase-like family 4 (Rab-like4) | Back alignment and domain information |
|---|
| >gnl|CDD|206707 cd04135, Tc10, Rho GTPase TC10 (Tc10) | Back alignment and domain information |
|---|
| >gnl|CDD|133267 cd01864, Rab19, Rab GTPase family 19 (Rab19) | Back alignment and domain information |
|---|
| >gnl|CDD|165788 PLN00223, PLN00223, ADP-ribosylation factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133310 cd04110, Rab35, Rab GTPase family 35 (Rab35) | Back alignment and domain information |
|---|
| >gnl|CDD|206718 cd04151, Arl1, ADP ribosylation factor 1 (Arf1) | Back alignment and domain information |
|---|
| >gnl|CDD|206692 cd04107, Rab32_Rab38, Rab GTPase families 18 (Rab18) and 32 (Rab32) | Back alignment and domain information |
|---|
| >gnl|CDD|206721 cd04155, Arl3, Arf-like 3 (Arl3) GTPase | Back alignment and domain information |
|---|
| >gnl|CDD|206717 cd04150, Arf1_5_like, ADP-ribosylation factor-1 (Arf1) and ADP-ribosylation factor-5 (Arf5) | Back alignment and domain information |
|---|
| >gnl|CDD|206656 cd01863, Rab18, Rab GTPase family 18 (Rab18) | Back alignment and domain information |
|---|
| >gnl|CDD|224025 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|206711 cd04140, ARHI_like, A Ras homolog member I (ARHI) | Back alignment and domain information |
|---|
| >gnl|CDD|215587 PLN03118, PLN03118, Rab family protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206737 cd04174, Rnd1_Rho6, Rnd1/Rho6 GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|206695 cd04112, Rab26, Rab GTPase family 26 (Rab26) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 173 | |||
| KOG0084|consensus | 205 | 99.97 | ||
| KOG0094|consensus | 221 | 99.95 | ||
| KOG0080|consensus | 209 | 99.95 | ||
| KOG0092|consensus | 200 | 99.95 | ||
| KOG0078|consensus | 207 | 99.94 | ||
| KOG0098|consensus | 216 | 99.93 | ||
| KOG0086|consensus | 214 | 99.93 | ||
| KOG0095|consensus | 213 | 99.93 | ||
| KOG0079|consensus | 198 | 99.93 | ||
| KOG0087|consensus | 222 | 99.93 | ||
| KOG0394|consensus | 210 | 99.92 | ||
| KOG0093|consensus | 193 | 99.92 | ||
| cd04120 | 202 | Rab12 Rab12 subfamily. Rab12 was first identified | 99.91 | |
| cd04172 | 182 | Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE | 99.9 | |
| cd04131 | 178 | Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 | 99.9 | |
| cd04121 | 189 | Rab40 Rab40 subfamily. This subfamily contains Rab | 99.9 | |
| cd04133 | 176 | Rop_like Rop subfamily. The Rop (Rho-related prote | 99.9 | |
| cd01875 | 191 | RhoG RhoG subfamily. RhoG is a GTPase with high se | 99.9 | |
| KOG0091|consensus | 213 | 99.9 | ||
| cd04174 | 232 | Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb | 99.9 | |
| cd04128 | 182 | Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi | 99.89 | |
| KOG0088|consensus | 218 | 99.89 | ||
| cd04122 | 166 | Rab14 Rab14 subfamily. Rab14 GTPases are localized | 99.89 | |
| cd04102 | 202 | RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove | 99.89 | |
| cd01874 | 175 | Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas | 99.89 | |
| cd04173 | 222 | Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb | 99.89 | |
| cd04107 | 201 | Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 | 99.88 | |
| cd04108 | 170 | Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr | 99.88 | |
| PLN03071 | 219 | GTP-binding nuclear protein Ran; Provisional | 99.88 | |
| KOG0097|consensus | 215 | 99.88 | ||
| cd04119 | 168 | RJL RJL (RabJ-Like) subfamily. RJLs are found in m | 99.87 | |
| cd01867 | 167 | Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp | 99.87 | |
| cd04117 | 161 | Rab15 Rab15 subfamily. Rab15 colocalizes with the | 99.87 | |
| cd01871 | 174 | Rac1_like Rac1-like subfamily. The Rac1-like subfa | 99.87 | |
| cd04141 | 172 | Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p | 99.87 | |
| cd04136 | 163 | Rap_like Rap-like subfamily. The Rap subfamily con | 99.87 | |
| cd04110 | 199 | Rab35 Rab35 subfamily. Rab35 is one of several Rab | 99.87 | |
| cd01869 | 166 | Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev | 99.87 | |
| PLN03110 | 216 | Rab GTPase; Provisional | 99.86 | |
| PLN00023 | 334 | GTP-binding protein; Provisional | 99.86 | |
| cd04176 | 163 | Rap2 Rap2 subgroup. The Rap2 subgroup is part of t | 99.86 | |
| cd04116 | 170 | Rab9 Rab9 subfamily. Rab9 is found in late endosom | 99.86 | |
| cd01865 | 165 | Rab3 Rab3 subfamily. The Rab3 subfamily contains R | 99.86 | |
| cd04127 | 180 | Rab27A Rab27a subfamily. The Rab27a subfamily cons | 99.86 | |
| cd04109 | 215 | Rab28 Rab28 subfamily. First identified in maize, | 99.86 | |
| cd04124 | 161 | RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily | 99.86 | |
| cd01892 | 169 | Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr | 99.86 | |
| cd00877 | 166 | Ran Ran (Ras-related nuclear proteins) /TC4 subfam | 99.86 | |
| PF00071 | 162 | Ras: Ras family; InterPro: IPR001806 Small GTPases | 99.86 | |
| cd01866 | 168 | Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg | 99.86 | |
| PTZ00369 | 189 | Ras-like protein; Provisional | 99.86 | |
| cd04111 | 211 | Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 | 99.86 | |
| cd04175 | 164 | Rap1 Rap1 subgroup. The Rap1 subgroup is part of t | 99.85 | |
| cd01864 | 165 | Rab19 Rab19 subfamily. Rab19 proteins are associat | 99.85 | |
| cd04106 | 162 | Rab23_lke Rab23-like subfamily. Rab23 is a member | 99.85 | |
| cd04115 | 170 | Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u | 99.85 | |
| cd04134 | 189 | Rho3 Rho3 subfamily. Rho3 is a member of the Rho f | 99.85 | |
| cd01868 | 165 | Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a | 99.85 | |
| cd04125 | 188 | RabA_like RabA-like subfamily. RabA was first iden | 99.85 | |
| cd04132 | 187 | Rho4_like Rho4-like subfamily. Rho4 is a GTPase th | 99.85 | |
| cd04138 | 162 | H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, | 99.85 | |
| cd04113 | 161 | Rab4 Rab4 subfamily. Rab4 has been implicated in n | 99.85 | |
| cd04118 | 193 | Rab24 Rab24 subfamily. Rab24 is distinct from othe | 99.85 | |
| cd04130 | 173 | Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive | 99.84 | |
| cd04144 | 190 | Ras2 Ras2 subfamily. The Ras2 subfamily, found exc | 99.84 | |
| cd04143 | 247 | Rhes_like Rhes_like subfamily. This subfamily incl | 99.84 | |
| smart00176 | 200 | RAN Ran (Ras-related nuclear proteins) /TC4 subfam | 99.84 | |
| PLN03108 | 210 | Rab family protein; Provisional | 99.84 | |
| cd01861 | 161 | Rab6 Rab6 subfamily. Rab6 is involved in microtubu | 99.84 | |
| PLN03118 | 211 | Rab family protein; Provisional | 99.83 | |
| cd01860 | 163 | Rab5_related Rab5-related subfamily. This subfamil | 99.83 | |
| cd04112 | 191 | Rab26 Rab26 subfamily. First identified in rat pan | 99.83 | |
| KOG0393|consensus | 198 | 99.83 | ||
| smart00174 | 174 | RHO Rho (Ras homology) subfamily of Ras-like small | 99.83 | |
| cd04101 | 164 | RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove | 99.83 | |
| smart00173 | 164 | RAS Ras subfamily of RAS small GTPases. Similar in | 99.83 | |
| cd04140 | 165 | ARHI_like ARHI subfamily. ARHI (A Ras homolog memb | 99.83 | |
| KOG0081|consensus | 219 | 99.83 | ||
| PRK03003 | 472 | GTP-binding protein Der; Reviewed | 99.82 | |
| KOG0083|consensus | 192 | 99.82 | ||
| cd04145 | 164 | M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf | 99.82 | |
| smart00175 | 164 | RAB Rab subfamily of small GTPases. Rab GTPases ar | 99.82 | |
| cd01862 | 172 | Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th | 99.82 | |
| cd01863 | 161 | Rab18 Rab18 subfamily. Mammalian Rab18 is implicat | 99.82 | |
| cd04177 | 168 | RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the | 99.82 | |
| cd04135 | 174 | Tc10 TC10 subfamily. TC10 is a Rho family protein | 99.81 | |
| cd04126 | 220 | Rab20 Rab20 subfamily. Rab20 is one of several Rab | 99.81 | |
| cd04142 | 198 | RRP22 RRP22 subfamily. RRP22 (Ras-related protein | 99.81 | |
| cd01870 | 175 | RhoA_like RhoA-like subfamily. The RhoA subfamily | 99.81 | |
| PTZ00132 | 215 | GTP-binding nuclear protein Ran; Provisional | 99.81 | |
| PLN00223 | 181 | ADP-ribosylation factor; Provisional | 99.8 | |
| cd04150 | 159 | Arf1_5_like Arf1-Arf5-like subfamily. This subfami | 99.8 | |
| cd04149 | 168 | Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor | 99.8 | |
| smart00177 | 175 | ARF ARF-like small GTPases; ARF, ADP-ribosylation | 99.8 | |
| cd04103 | 158 | Centaurin_gamma Centaurin gamma. The centaurins (a | 99.8 | |
| cd01873 | 195 | RhoBTB RhoBTB subfamily. Members of the RhoBTB sub | 99.8 | |
| cd04123 | 162 | Rab21 Rab21 subfamily. The localization and functi | 99.8 | |
| cd04162 | 164 | Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 | 99.8 | |
| PTZ00133 | 182 | ADP-ribosylation factor; Provisional | 99.79 | |
| cd04114 | 169 | Rab30 Rab30 subfamily. Rab30 appears to be associa | 99.79 | |
| cd04152 | 183 | Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i | 99.79 | |
| cd00157 | 171 | Rho Rho (Ras homology) family. Members of the Rho | 99.78 | |
| COG1100 | 219 | GTPase SAR1 and related small G proteins [General | 99.78 | |
| cd04146 | 165 | RERG_RasL11_like RERG/RasL11-like subfamily. RERG | 99.78 | |
| cd00154 | 159 | Rab Rab family. Rab GTPases form the largest famil | 99.78 | |
| TIGR03594 | 429 | GTPase_EngA ribosome-associated GTPase EngA. EngA | 99.78 | |
| cd04148 | 221 | RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki | 99.78 | |
| KOG0395|consensus | 196 | 99.77 | ||
| cd04147 | 198 | Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v | 99.77 | |
| COG1160 | 444 | Predicted GTPases [General function prediction onl | 99.76 | |
| cd04139 | 164 | RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) | 99.76 | |
| cd04158 | 169 | ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor | 99.76 | |
| cd01893 | 166 | Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr | 99.76 | |
| cd04161 | 167 | Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( | 99.75 | |
| cd00876 | 160 | Ras Ras family. The Ras family of the Ras superfam | 99.75 | |
| PF08477 | 119 | Miro: Miro-like protein; InterPro: IPR013684 Mitoc | 99.75 | |
| PRK09518 | 712 | bifunctional cytidylate kinase/GTPase Der; Reviewe | 99.75 | |
| cd04157 | 162 | Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub | 99.75 | |
| KOG4252|consensus | 246 | 99.74 | ||
| cd04154 | 173 | Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are | 99.74 | |
| cd04137 | 180 | RheB Rheb (Ras Homolog Enriched in Brain) subfamil | 99.73 | |
| cd04153 | 174 | Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a | 99.73 | |
| PRK00093 | 435 | GTP-binding protein Der; Reviewed | 99.72 | |
| cd04151 | 158 | Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t | 99.72 | |
| cd04129 | 187 | Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that | 99.72 | |
| cd04156 | 160 | ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su | 99.71 | |
| cd00878 | 158 | Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik | 99.7 | |
| KOG0073|consensus | 185 | 99.7 | ||
| cd04159 | 159 | Arl10_like Arl10-like subfamily. Arl9/Arl10 was id | 99.69 | |
| smart00178 | 184 | SAR Sar1p-like members of the Ras-family of small | 99.69 | |
| PF00025 | 175 | Arf: ADP-ribosylation factor family The prints ent | 99.68 | |
| cd04160 | 167 | Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote | 99.68 | |
| KOG0070|consensus | 181 | 99.68 | ||
| cd00879 | 190 | Sar1 Sar1 subfamily. Sar1 is an essential componen | 99.66 | |
| cd01890 | 179 | LepA LepA subfamily. LepA belongs to the GTPase fa | 99.66 | |
| cd01891 | 194 | TypA_BipA TypA (tyrosine phosphorylated protein A) | 99.65 | |
| cd04171 | 164 | SelB SelB subfamily. SelB is an elongation factor | 99.64 | |
| TIGR00231 | 161 | small_GTP small GTP-binding protein domain. This m | 99.64 | |
| TIGR02528 | 142 | EutP ethanolamine utilization protein, EutP. This | 99.61 | |
| KOG1673|consensus | 205 | 99.61 | ||
| cd04155 | 173 | Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f | 99.6 | |
| cd01887 | 168 | IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo | 99.58 | |
| KOG0075|consensus | 186 | 99.58 | ||
| cd04105 | 203 | SR_beta Signal recognition particle receptor, beta | 99.58 | |
| KOG0096|consensus | 216 | 99.58 | ||
| KOG0071|consensus | 180 | 99.55 | ||
| TIGR03598 | 179 | GTPase_YsxC ribosome biogenesis GTP-binding protei | 99.51 | |
| KOG0074|consensus | 185 | 99.49 | ||
| cd01879 | 158 | FeoB Ferrous iron transport protein B (FeoB) subfa | 99.49 | |
| PRK00454 | 196 | engB GTP-binding protein YsxC; Reviewed | 99.49 | |
| TIGR00450 | 442 | mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE | 99.49 | |
| cd01878 | 204 | HflX HflX subfamily. A distinct conserved domain w | 99.48 | |
| cd00882 | 157 | Ras_like_GTPase Ras-like GTPase superfamily. The R | 99.48 | |
| PRK04213 | 201 | GTP-binding protein; Provisional | 99.47 | |
| PRK03003 | 472 | GTP-binding protein Der; Reviewed | 99.47 | |
| cd01898 | 170 | Obg Obg subfamily. The Obg nucleotide binding prot | 99.46 | |
| PTZ00099 | 176 | rab6; Provisional | 99.45 | |
| TIGR03156 | 351 | GTP_HflX GTP-binding protein HflX. This protein fa | 99.44 | |
| cd00881 | 189 | GTP_translation_factor GTP translation factor fami | 99.44 | |
| cd01897 | 168 | NOG NOG1 is a nucleolar GTP-binding protein presen | 99.43 | |
| TIGR01393 | 595 | lepA GTP-binding protein LepA. LepA (GUF1 in Sacca | 99.43 | |
| cd04164 | 157 | trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein | 99.42 | |
| PRK15494 | 339 | era GTPase Era; Provisional | 99.41 | |
| TIGR00487 | 587 | IF-2 translation initiation factor IF-2. This mode | 99.41 | |
| cd04167 | 213 | Snu114p Snu114p subfamily. Snu114p is one of sever | 99.4 | |
| KOG3883|consensus | 198 | 99.4 | ||
| PRK05291 | 449 | trmE tRNA modification GTPase TrmE; Reviewed | 99.4 | |
| PRK00093 | 435 | GTP-binding protein Der; Reviewed | 99.38 | |
| KOG4423|consensus | 229 | 99.38 | ||
| cd01889 | 192 | SelB_euk SelB subfamily. SelB is an elongation fac | 99.37 | |
| KOG0084|consensus | 205 | 99.37 | ||
| PRK10218 | 607 | GTP-binding protein; Provisional | 99.34 | |
| cd01894 | 157 | EngA1 EngA1 subfamily. This CD represents the firs | 99.34 | |
| TIGR00436 | 270 | era GTP-binding protein Era. Era is an essential G | 99.33 | |
| CHL00189 | 742 | infB translation initiation factor 2; Provisional | 99.32 | |
| KOG0076|consensus | 197 | 99.32 | ||
| PRK11058 | 426 | GTPase HflX; Provisional | 99.31 | |
| PRK05306 | 787 | infB translation initiation factor IF-2; Validated | 99.31 | |
| cd01895 | 174 | EngA2 EngA2 subfamily. This CD represents the seco | 99.31 | |
| cd04169 | 267 | RF3 RF3 subfamily. Peptide chain release factor 3 | 99.31 | |
| cd01896 | 233 | DRG The developmentally regulated GTP-binding prot | 99.31 | |
| TIGR00491 | 590 | aIF-2 translation initiation factor aIF-2/yIF-2. T | 99.31 | |
| cd01850 | 276 | CDC_Septin CDC/Septin. Septins are a conserved fam | 99.31 | |
| TIGR00475 | 581 | selB selenocysteine-specific elongation factor Sel | 99.31 | |
| cd04168 | 237 | TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T | 99.3 | |
| TIGR03594 | 429 | GTPase_EngA ribosome-associated GTPase EngA. EngA | 99.3 | |
| PRK15467 | 158 | ethanolamine utilization protein EutP; Provisional | 99.28 | |
| cd04163 | 168 | Era Era subfamily. Era (E. coli Ras-like protein) | 99.27 | |
| PRK09518 | 712 | bifunctional cytidylate kinase/GTPase Der; Reviewe | 99.25 | |
| cd01881 | 176 | Obg_like The Obg-like subfamily consists of five w | 99.25 | |
| cd01899 | 318 | Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg | 99.24 | |
| cd01876 | 170 | YihA_EngB The YihA (EngB) subfamily. This subfamil | 99.23 | |
| KOG0080|consensus | 209 | 99.23 | ||
| PF04670 | 232 | Gtr1_RagA: Gtr1/RagA G protein conserved region; I | 99.22 | |
| cd04166 | 208 | CysN_ATPS CysN_ATPS subfamily. CysN, together with | 99.22 | |
| PF02421 | 156 | FeoB_N: Ferrous iron transport protein B; InterPro | 99.21 | |
| PRK05433 | 600 | GTP-binding protein LepA; Provisional | 99.2 | |
| PRK04004 | 586 | translation initiation factor IF-2; Validated | 99.2 | |
| TIGR00483 | 426 | EF-1_alpha translation elongation factor EF-1 alph | 99.2 | |
| cd04170 | 268 | EF-G_bact Elongation factor G (EF-G) subfamily. Tr | 99.19 | |
| PRK12299 | 335 | obgE GTPase CgtA; Reviewed | 99.19 | |
| PF01926 | 116 | MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I | 99.19 | |
| KOG0072|consensus | 182 | 99.18 | ||
| PRK09554 | 772 | feoB ferrous iron transport protein B; Reviewed | 99.18 | |
| PRK00089 | 292 | era GTPase Era; Reviewed | 99.17 | |
| cd00880 | 163 | Era_like Era (E. coli Ras-like protein)-like. This | 99.17 | |
| PRK12317 | 425 | elongation factor 1-alpha; Reviewed | 99.16 | |
| cd01885 | 222 | EF2 EF2 (for archaea and eukarya). Translocation r | 99.15 | |
| TIGR02729 | 329 | Obg_CgtA Obg family GTPase CgtA. This model descri | 99.15 | |
| KOG0095|consensus | 213 | 99.14 | ||
| TIGR01394 | 594 | TypA_BipA GTP-binding protein TypA/BipA. This bact | 99.14 | |
| KOG0094|consensus | 221 | 99.13 | ||
| TIGR00437 | 591 | feoB ferrous iron transporter FeoB. FeoB (773 amin | 99.12 | |
| COG2229 | 187 | Predicted GTPase [General function prediction only | 99.11 | |
| KOG0092|consensus | 200 | 99.11 | ||
| TIGR00503 | 527 | prfC peptide chain release factor 3. This translat | 99.1 | |
| cd01888 | 203 | eIF2_gamma eIF2-gamma (gamma subunit of initiation | 99.1 | |
| COG0486 | 454 | ThdF Predicted GTPase [General function prediction | 99.1 | |
| PRK13351 | 687 | elongation factor G; Reviewed | 99.09 | |
| cd04104 | 197 | p47_IIGP_like p47 (47-kDa) family. The p47 GTPase | 99.09 | |
| KOG0078|consensus | 207 | 99.09 | ||
| PRK00741 | 526 | prfC peptide chain release factor 3; Provisional | 99.09 | |
| PRK09602 | 396 | translation-associated GTPase; Reviewed | 99.09 | |
| PRK12297 | 424 | obgE GTPase CgtA; Reviewed | 99.07 | |
| cd01886 | 270 | EF-G Elongation factor G (EF-G) subfamily. Translo | 99.06 | |
| KOG0087|consensus | 222 | 99.06 | ||
| PRK12296 | 500 | obgE GTPase CgtA; Reviewed | 99.05 | |
| TIGR00490 | 720 | aEF-2 translation elongation factor aEF-2. This mo | 99.05 | |
| KOG1423|consensus | 379 | 99.0 | ||
| KOG1707|consensus | 625 | 99.0 | ||
| COG3596 | 296 | Predicted GTPase [General function prediction only | 99.0 | |
| COG0218 | 200 | Predicted GTPase [General function prediction only | 98.99 | |
| COG1159 | 298 | Era GTPase [General function prediction only] | 98.99 | |
| PRK12735 | 396 | elongation factor Tu; Reviewed | 98.98 | |
| cd01852 | 196 | AIG1 AIG1 (avrRpt2-induced gene 1). This represent | 98.98 | |
| cd01884 | 195 | EF_Tu EF-Tu subfamily. This subfamily includes ort | 98.98 | |
| KOG0394|consensus | 210 | 98.97 | ||
| TIGR00485 | 394 | EF-Tu translation elongation factor TU. This align | 98.97 | |
| TIGR00991 | 313 | 3a0901s02IAP34 GTP-binding protein (Chloroplast En | 98.96 | |
| cd01883 | 219 | EF1_alpha Eukaryotic elongation factor 1 (EF1) alp | 98.96 | |
| PRK10512 | 614 | selenocysteinyl-tRNA-specific translation factor; | 98.95 | |
| COG1160 | 444 | Predicted GTPases [General function prediction onl | 98.95 | |
| PF00009 | 188 | GTP_EFTU: Elongation factor Tu GTP binding domain; | 98.94 | |
| TIGR00484 | 689 | EF-G translation elongation factor EF-G. After pep | 98.91 | |
| PF09439 | 181 | SRPRB: Signal recognition particle receptor beta s | 98.91 | |
| smart00010 | 124 | small_GTPase Small GTPase of the Ras superfamily; | 98.91 | |
| PF10662 | 143 | PduV-EutP: Ethanolamine utilisation - propanediol | 98.91 | |
| PLN03126 | 478 | Elongation factor Tu; Provisional | 98.9 | |
| PRK12736 | 394 | elongation factor Tu; Reviewed | 98.9 | |
| cd01853 | 249 | Toc34_like Toc34-like (Translocon at the Outer-env | 98.88 | |
| KOG0077|consensus | 193 | 98.88 | ||
| PRK12298 | 390 | obgE GTPase CgtA; Reviewed | 98.88 | |
| KOG0098|consensus | 216 | 98.87 | ||
| TIGR03680 | 406 | eif2g_arch translation initiation factor 2 subunit | 98.86 | |
| CHL00071 | 409 | tufA elongation factor Tu | 98.86 | |
| KOG1191|consensus | 531 | 98.85 | ||
| cd01857 | 141 | HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t | 98.84 | |
| KOG0079|consensus | 198 | 98.84 | ||
| cd01859 | 156 | MJ1464 MJ1464. This family represents archaeal GTP | 98.83 | |
| PRK04000 | 411 | translation initiation factor IF-2 subunit gamma; | 98.81 | |
| KOG0086|consensus | 214 | 98.8 | ||
| PRK05124 | 474 | cysN sulfate adenylyltransferase subunit 1; Provis | 98.8 | |
| cd04172 | 182 | Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE | 98.79 | |
| KOG0088|consensus | 218 | 98.78 | ||
| PRK00049 | 396 | elongation factor Tu; Reviewed | 98.77 | |
| TIGR02034 | 406 | CysN sulfate adenylyltransferase, large subunit. H | 98.77 | |
| PTZ00258 | 390 | GTP-binding protein; Provisional | 98.76 | |
| PF04548 | 212 | AIG1: AIG1 family; InterPro: IPR006703 This entry | 98.76 | |
| cd01856 | 171 | YlqF YlqF. Proteins of the YlqF family contain all | 98.76 | |
| cd04174 | 232 | Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb | 98.75 | |
| PRK05506 | 632 | bifunctional sulfate adenylyltransferase subunit 1 | 98.74 | |
| cd01900 | 274 | YchF YchF subfamily. YchF is a member of the Obg f | 98.74 | |
| cd04128 | 182 | Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi | 98.74 | |
| cd04121 | 189 | Rab40 Rab40 subfamily. This subfamily contains Rab | 98.73 | |
| PRK12739 | 691 | elongation factor G; Reviewed | 98.72 | |
| PRK09601 | 364 | GTP-binding protein YchF; Reviewed | 98.72 | |
| cd04131 | 178 | Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 | 98.71 | |
| cd04133 | 176 | Rop_like Rop subfamily. The Rop (Rho-related prote | 98.71 | |
| COG1163 | 365 | DRG Predicted GTPase [General function prediction | 98.7 | |
| cd01892 | 169 | Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr | 98.69 | |
| cd01875 | 191 | RhoG RhoG subfamily. RhoG is a GTPase with high se | 98.68 | |
| KOG1707|consensus | 625 | 98.68 | ||
| COG0370 | 653 | FeoB Fe2+ transport system protein B [Inorganic io | 98.67 | |
| cd01874 | 175 | Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas | 98.66 | |
| KOG0081|consensus | 219 | 98.64 | ||
| cd01855 | 190 | YqeH YqeH. YqeH is an essential GTP-binding protei | 98.64 | |
| PLN03110 | 216 | Rab GTPase; Provisional | 98.64 | |
| cd04173 | 222 | Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb | 98.63 | |
| cd04108 | 170 | Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr | 98.62 | |
| cd04127 | 180 | Rab27A Rab27a subfamily. The Rab27a subfamily cons | 98.62 | |
| cd04165 | 224 | GTPBP1_like GTPBP1-like. Mammalian GTP binding pro | 98.61 | |
| PLN00043 | 447 | elongation factor 1-alpha; Provisional | 98.6 | |
| cd04110 | 199 | Rab35 Rab35 subfamily. Rab35 is one of several Rab | 98.6 | |
| cd04141 | 172 | Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p | 98.6 | |
| cd04102 | 202 | RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove | 98.6 | |
| cd01867 | 167 | Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp | 98.6 | |
| cd04122 | 166 | Rab14 Rab14 subfamily. Rab14 GTPases are localized | 98.6 | |
| PLN03127 | 447 | Elongation factor Tu; Provisional | 98.6 | |
| cd01858 | 157 | NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei | 98.6 | |
| PTZ00141 | 446 | elongation factor 1- alpha; Provisional | 98.59 | |
| cd04120 | 202 | Rab12 Rab12 subfamily. Rab12 was first identified | 98.59 | |
| cd04138 | 162 | H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, | 98.58 | |
| COG1084 | 346 | Predicted GTPase [General function prediction only | 98.58 | |
| PLN03071 | 219 | GTP-binding nuclear protein Ran; Provisional | 98.58 | |
| KOG0091|consensus | 213 | 98.57 | ||
| PRK00007 | 693 | elongation factor G; Reviewed | 98.56 | |
| cd04136 | 163 | Rap_like Rap-like subfamily. The Rap subfamily con | 98.56 | |
| KOG0097|consensus | 215 | 98.56 | ||
| PF00735 | 281 | Septin: Septin; InterPro: IPR000038 Septins consti | 98.55 | |
| cd04117 | 161 | Rab15 Rab15 subfamily. Rab15 colocalizes with the | 98.55 | |
| TIGR00993 | 763 | 3a0901s04IAP86 chloroplast protein import componen | 98.55 | |
| PF00071 | 162 | Ras: Ras family; InterPro: IPR001806 Small GTPases | 98.55 | |
| cd04119 | 168 | RJL RJL (RabJ-Like) subfamily. RJLs are found in m | 98.54 | |
| cd04107 | 201 | Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 | 98.54 | |
| TIGR03596 | 276 | GTPase_YlqF ribosome biogenesis GTP-binding protei | 98.52 | |
| cd01871 | 174 | Rac1_like Rac1-like subfamily. The Rac1-like subfa | 98.52 | |
| KOG0093|consensus | 193 | 98.52 | ||
| PRK09563 | 287 | rbgA GTPase YlqF; Reviewed | 98.51 | |
| KOG3886|consensus | 295 | 98.51 | ||
| KOG4252|consensus | 246 | 98.51 | ||
| PRK12740 | 668 | elongation factor G; Reviewed | 98.5 | |
| cd04103 | 158 | Centaurin_gamma Centaurin gamma. The centaurins (a | 98.5 | |
| PTZ00369 | 189 | Ras-like protein; Provisional | 98.5 | |
| cd04178 | 172 | Nucleostemin_like Nucleostemin-like. Nucleostemin | 98.49 | |
| cd00877 | 166 | Ran Ran (Ras-related nuclear proteins) /TC4 subfam | 98.49 | |
| cd04140 | 165 | ARHI_like ARHI subfamily. ARHI (A Ras homolog memb | 98.48 | |
| cd04175 | 164 | Rap1 Rap1 subgroup. The Rap1 subgroup is part of t | 98.47 | |
| cd04109 | 215 | Rab28 Rab28 subfamily. First identified in maize, | 98.47 | |
| PLN00023 | 334 | GTP-binding protein; Provisional | 98.47 | |
| cd01864 | 165 | Rab19 Rab19 subfamily. Rab19 proteins are associat | 98.47 | |
| cd04142 | 198 | RRP22 RRP22 subfamily. RRP22 (Ras-related protein | 98.47 | |
| cd04111 | 211 | Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 | 98.47 | |
| PTZ00132 | 215 | GTP-binding nuclear protein Ran; Provisional | 98.47 | |
| cd01866 | 168 | Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg | 98.46 | |
| cd04134 | 189 | Rho3 Rho3 subfamily. Rho3 is a member of the Rho f | 98.46 | |
| cd01865 | 165 | Rab3 Rab3 subfamily. The Rab3 subfamily contains R | 98.46 | |
| PLN03108 | 210 | Rab family protein; Provisional | 98.46 | |
| PF05049 | 376 | IIGP: Interferon-inducible GTPase (IIGP); InterPro | 98.45 | |
| KOG0090|consensus | 238 | 98.45 | ||
| cd00066 | 317 | G-alpha G protein alpha subunit. The alpha subunit | 98.44 | |
| cd04116 | 170 | Rab9 Rab9 subfamily. Rab9 is found in late endosom | 98.44 | |
| cd04124 | 161 | RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily | 98.44 | |
| cd01869 | 166 | Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev | 98.44 | |
| cd04132 | 187 | Rho4_like Rho4-like subfamily. Rho4 is a GTPase th | 98.44 | |
| PF00350 | 168 | Dynamin_N: Dynamin family; InterPro: IPR001401 Mem | 98.44 | |
| cd04176 | 163 | Rap2 Rap2 subgroup. The Rap2 subgroup is part of t | 98.43 | |
| cd04118 | 193 | Rab24 Rab24 subfamily. Rab24 is distinct from othe | 98.43 | |
| cd01868 | 165 | Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a | 98.42 | |
| cd04106 | 162 | Rab23_lke Rab23-like subfamily. Rab23 is a member | 98.42 | |
| cd01870 | 175 | RhoA_like RhoA-like subfamily. The RhoA subfamily | 98.41 | |
| cd04143 | 247 | Rhes_like Rhes_like subfamily. This subfamily incl | 98.41 | |
| cd04115 | 170 | Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u | 98.4 | |
| smart00173 | 164 | RAS Ras subfamily of RAS small GTPases. Similar in | 98.39 | |
| COG1100 | 219 | GTPase SAR1 and related small G proteins [General | 98.39 | |
| PLN00116 | 843 | translation elongation factor EF-2 subunit; Provis | 98.39 | |
| cd04125 | 188 | RabA_like RabA-like subfamily. RabA was first iden | 98.38 | |
| cd04135 | 174 | Tc10 TC10 subfamily. TC10 is a Rho family protein | 98.38 | |
| KOG0395|consensus | 196 | 98.36 | ||
| PTZ00416 | 836 | elongation factor 2; Provisional | 98.36 | |
| cd04144 | 190 | Ras2 Ras2 subfamily. The Ras2 subfamily, found exc | 98.35 | |
| cd04130 | 173 | Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive | 98.35 | |
| cd04145 | 164 | M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf | 98.35 | |
| COG1161 | 322 | Predicted GTPases [General function prediction onl | 98.34 | |
| cd04101 | 164 | RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove | 98.34 | |
| cd04177 | 168 | RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the | 98.33 | |
| PRK07560 | 731 | elongation factor EF-2; Reviewed | 98.32 | |
| cd04113 | 161 | Rab4 Rab4 subfamily. Rab4 has been implicated in n | 98.31 | |
| PF05783 | 472 | DLIC: Dynein light intermediate chain (DLIC); Inte | 98.3 | |
| cd04162 | 164 | Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 | 98.28 | |
| cd04139 | 164 | RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) | 98.27 | |
| KOG0393|consensus | 198 | 98.27 | ||
| smart00010 | 124 | small_GTPase Small GTPase of the Ras superfamily; | 98.27 | |
| cd01860 | 163 | Rab5_related Rab5-related subfamily. This subfamil | 98.27 | |
| cd04146 | 165 | RERG_RasL11_like RERG/RasL11-like subfamily. RERG | 98.26 | |
| cd04148 | 221 | RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki | 98.26 | |
| cd04114 | 169 | Rab30 Rab30 subfamily. Rab30 appears to be associa | 98.25 | |
| COG5256 | 428 | TEF1 Translation elongation factor EF-1alpha (GTPa | 98.24 | |
| cd04112 | 191 | Rab26 Rab26 subfamily. First identified in rat pan | 98.23 | |
| cd01862 | 172 | Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th | 98.23 | |
| cd04150 | 159 | Arf1_5_like Arf1-Arf5-like subfamily. This subfami | 98.22 | |
| cd01893 | 166 | Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr | 98.21 | |
| PTZ00133 | 182 | ADP-ribosylation factor; Provisional | 98.21 | |
| cd04126 | 220 | Rab20 Rab20 subfamily. Rab20 is one of several Rab | 98.21 | |
| TIGR02528 | 142 | EutP ethanolamine utilization protein, EutP. This | 98.2 | |
| smart00177 | 175 | ARF ARF-like small GTPases; ARF, ADP-ribosylation | 98.2 | |
| TIGR00092 | 368 | GTP-binding protein YchF. This predicted GTP-bindi | 98.19 | |
| cd01861 | 161 | Rab6 Rab6 subfamily. Rab6 is involved in microtubu | 98.18 | |
| smart00175 | 164 | RAB Rab subfamily of small GTPases. Rab GTPases ar | 98.18 | |
| smart00174 | 174 | RHO Rho (Ras homology) subfamily of Ras-like small | 98.17 | |
| cd00157 | 171 | Rho Rho (Ras homology) family. Members of the Rho | 98.16 | |
| PLN00223 | 181 | ADP-ribosylation factor; Provisional | 98.16 | |
| cd01882 | 225 | BMS1 Bms1. Bms1 is an essential, evolutionarily co | 98.15 | |
| COG0532 | 509 | InfB Translation initiation factor 2 (IF-2; GTPase | 98.15 | |
| cd04137 | 180 | RheB Rheb (Ras Homolog Enriched in Brain) subfamil | 98.14 | |
| cd01873 | 195 | RhoBTB RhoBTB subfamily. Members of the RhoBTB sub | 98.14 | |
| cd04152 | 183 | Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i | 98.13 | |
| cd04158 | 169 | ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor | 98.13 | |
| PLN03118 | 211 | Rab family protein; Provisional | 98.12 | |
| PF03193 | 161 | DUF258: Protein of unknown function, DUF258; Inter | 98.12 | |
| cd04123 | 162 | Rab21 Rab21 subfamily. The localization and functi | 98.12 | |
| cd04129 | 187 | Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that | 98.12 | |
| cd00154 | 159 | Rab Rab family. Rab GTPases form the largest famil | 98.12 | |
| cd04149 | 168 | Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor | 98.11 | |
| cd01863 | 161 | Rab18 Rab18 subfamily. Mammalian Rab18 is implicat | 98.11 | |
| cd04159 | 159 | Arl10_like Arl10-like subfamily. Arl9/Arl10 was id | 98.08 | |
| cd01849 | 155 | YlqF_related_GTPase YlqF-related GTPases. These pr | 98.07 | |
| PRK13796 | 365 | GTPase YqeH; Provisional | 98.07 | |
| COG0012 | 372 | Predicted GTPase, probable translation factor [Tra | 98.07 | |
| cd04147 | 198 | Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v | 98.07 | |
| PF08477 | 119 | Miro: Miro-like protein; InterPro: IPR013684 Mitoc | 98.06 | |
| COG5019 | 373 | CDC3 Septin family protein [Cell division and chro | 98.05 | |
| cd04157 | 162 | Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub | 98.05 | |
| cd04161 | 167 | Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( | 98.03 | |
| PRK12288 | 347 | GTPase RsgA; Reviewed | 98.02 | |
| cd00876 | 160 | Ras Ras family. The Ras family of the Ras superfam | 98.01 | |
| COG4917 | 148 | EutP Ethanolamine utilization protein [Amino acid | 98.01 | |
| PRK12289 | 352 | GTPase RsgA; Reviewed | 98.0 | |
| KOG1547|consensus | 336 | 97.99 | ||
| KOG0705|consensus | 749 | 97.99 | ||
| TIGR03597 | 360 | GTPase_YqeH ribosome biogenesis GTPase YqeH. This | 97.99 | |
| cd04156 | 160 | ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su | 97.98 | |
| COG2262 | 411 | HflX GTPases [General function prediction only] | 97.97 | |
| TIGR00157 | 245 | ribosome small subunit-dependent GTPase A. The Aqu | 97.96 | |
| KOG2655|consensus | 366 | 97.95 | ||
| cd04154 | 173 | Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are | 97.95 | |
| cd00879 | 190 | Sar1 Sar1 subfamily. Sar1 is an essential componen | 97.95 | |
| COG4108 | 528 | PrfC Peptide chain release factor RF-3 [Translatio | 97.95 | |
| TIGR00231 | 161 | small_GTP small GTP-binding protein domain. This m | 97.94 | |
| smart00176 | 200 | RAN Ran (Ras-related nuclear proteins) /TC4 subfam | 97.92 | |
| cd04153 | 174 | Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a | 97.91 | |
| PRK14845 | 1049 | translation initiation factor IF-2; Provisional | 97.9 | |
| KOG0468|consensus | 971 | 97.9 | ||
| PRK04213 | 201 | GTP-binding protein; Provisional | 97.89 | |
| smart00178 | 184 | SAR Sar1p-like members of the Ras-family of small | 97.88 | |
| cd04151 | 158 | Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t | 97.88 | |
| cd01851 | 224 | GBP Guanylate-binding protein (GBP), N-terminal do | 97.88 | |
| KOG1486|consensus | 364 | 97.87 | ||
| PRK00454 | 196 | engB GTP-binding protein YsxC; Reviewed | 97.85 | |
| KOG3905|consensus | 473 | 97.83 | ||
| KOG1673|consensus | 205 | 97.83 | ||
| KOG0462|consensus | 650 | 97.82 | ||
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 97.8 | |
| KOG1489|consensus | 366 | 97.78 | ||
| cd00878 | 158 | Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik | 97.77 | |
| KOG1491|consensus | 391 | 97.77 | ||
| KOG1424|consensus | 562 | 97.77 | ||
| COG1217 | 603 | TypA Predicted membrane GTPase involved in stress | 97.76 | |
| COG1162 | 301 | Predicted GTPases [General function prediction onl | 97.75 | |
| KOG1145|consensus | 683 | 97.75 | ||
| KOG3887|consensus | 347 | 97.74 | ||
| cd01854 | 287 | YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil | 97.73 | |
| cd04155 | 173 | Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f | 97.72 | |
| TIGR03598 | 179 | GTPase_YsxC ribosome biogenesis GTP-binding protei | 97.7 | |
| PF00025 | 175 | Arf: ADP-ribosylation factor family The prints ent | 97.69 | |
| smart00053 | 240 | DYNc Dynamin, GTPase. Large GTPases that mediate v | 97.67 | |
| COG0481 | 603 | LepA Membrane GTPase LepA [Cell envelope biogenesi | 97.67 | |
| PRK00098 | 298 | GTPase RsgA; Reviewed | 97.66 | |
| KOG0082|consensus | 354 | 97.64 | ||
| cd04160 | 167 | Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote | 97.62 | |
| PTZ00327 | 460 | eukaryotic translation initiation factor 2 gamma s | 97.61 | |
| PRK15494 | 339 | era GTPase Era; Provisional | 97.61 | |
| COG0480 | 697 | FusA Translation elongation factors (GTPases) [Tra | 97.59 | |
| smart00275 | 342 | G_alpha G protein alpha subunit. Subunit of G prot | 97.59 | |
| PF03029 | 238 | ATP_bind_1: Conserved hypothetical ATP binding pro | 97.58 | |
| KOG0458|consensus | 603 | 97.57 | ||
| cd04105 | 203 | SR_beta Signal recognition particle receptor, beta | 97.55 | |
| cd01878 | 204 | HflX HflX subfamily. A distinct conserved domain w | 97.53 | |
| cd04104 | 197 | p47_IIGP_like p47 (47-kDa) family. The p47 GTPase | 97.53 | |
| cd01850 | 276 | CDC_Septin CDC/Septin. Septins are a conserved fam | 97.52 | |
| cd01876 | 170 | YihA_EngB The YihA (EngB) subfamily. This subfamil | 97.51 | |
| cd01897 | 168 | NOG NOG1 is a nucleolar GTP-binding protein presen | 97.5 | |
| PRK13768 | 253 | GTPase; Provisional | 97.42 | |
| COG0536 | 369 | Obg Predicted GTPase [General function prediction | 97.41 | |
| KOG0083|consensus | 192 | 97.41 | ||
| KOG4423|consensus | 229 | 97.41 | ||
| KOG3859|consensus | 406 | 97.37 | ||
| cd01887 | 168 | IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo | 97.36 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 97.35 | |
| PF01926 | 116 | MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I | 97.35 | |
| TIGR03156 | 351 | GTP_HflX GTP-binding protein HflX. This protein fa | 97.31 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 97.3 | |
| cd04171 | 164 | SelB SelB subfamily. SelB is an elongation factor | 97.24 | |
| PF02421 | 156 | FeoB_N: Ferrous iron transport protein B; InterPro | 97.23 | |
| cd01891 | 194 | TypA_BipA TypA (tyrosine phosphorylated protein A) | 97.22 | |
| PF03193 | 161 | DUF258: Protein of unknown function, DUF258; Inter | 97.21 | |
| cd01895 | 174 | EngA2 EngA2 subfamily. This CD represents the seco | 97.21 | |
| cd04164 | 157 | trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein | 97.2 | |
| KOG1144|consensus | 1064 | 97.2 | ||
| KOG0096|consensus | 216 | 97.17 | ||
| cd04163 | 168 | Era Era subfamily. Era (E. coli Ras-like protein) | 97.16 | |
| TIGR00450 | 442 | mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE | 97.16 | |
| KOG0410|consensus | 410 | 97.16 | ||
| PRK08118 | 167 | topology modulation protein; Reviewed | 97.15 | |
| PF10662 | 143 | PduV-EutP: Ethanolamine utilisation - propanediol | 97.13 | |
| KOG1954|consensus | 532 | 97.09 | ||
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 97.09 | |
| COG2895 | 431 | CysN GTPases - Sulfate adenylate transferase subun | 97.07 | |
| PRK09866 | 741 | hypothetical protein; Provisional | 97.07 | |
| TIGR00436 | 270 | era GTP-binding protein Era. Era is an essential G | 97.06 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 97.04 |
| >KOG0084|consensus | Back alignment and domain information |
|---|
Probab=99.97 E-value=1.1e-30 Score=182.90 Aligned_cols=94 Identities=53% Similarity=0.981 Sum_probs=90.8
Q ss_pred CCCcceeeEEEEEeCCCCChHHHHHHHHhCCCCCCCCCceeeeeEEEEEEECCeEEEEEEEeCCCccccccchhhhhcCC
Q psy13826 80 QYSYSYIFKYIIIGDMGVGKSCLLHQFTEQKFMPDCPHTIGVEFGTRIIEVHGEKIKLQIWDTAGQERFRAVTRSYYRGA 159 (173)
Q Consensus 80 ~~~~~~~~ki~l~G~~~vGKssl~~~~~~~~~~~~~~~t~~~~~~~~~~~~~~~~~~l~i~D~~g~~~~~~~~~~~~~~~ 159 (173)
.+.+++.|||+++|++|||||+|+.||+++.|.+.|..|+|+++..+.+.++++.++|+||||+|||+|+.+...|||+|
T Consensus 3 ~~~~dylFKiiliGds~VGKtCL~~Rf~~~~f~e~~~sTIGVDf~~rt~e~~gk~iKlQIWDTAGQERFrtit~syYR~a 82 (205)
T KOG0084|consen 3 NPEYDYLFKIILIGDSGVGKTCLLLRFKDDTFTESYISTIGVDFKIRTVELDGKTIKLQIWDTAGQERFRTITSSYYRGA 82 (205)
T ss_pred CcccceEEEEEEECCCCcChhhhhhhhccCCcchhhcceeeeEEEEEEeeecceEEEEEeeeccccHHHhhhhHhhccCC
Confidence 35688999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CEEEEEEeCCCCCC
Q psy13826 160 AGALMVIDVSHVKE 173 (173)
Q Consensus 160 ~~~ilv~d~t~~~S 173 (173)
|++|+|||+|+++|
T Consensus 83 hGii~vyDiT~~~S 96 (205)
T KOG0084|consen 83 HGIIFVYDITKQES 96 (205)
T ss_pred CeEEEEEEcccHHH
Confidence 99999999999876
|
|
| >KOG0094|consensus | Back alignment and domain information |
|---|
| >KOG0080|consensus | Back alignment and domain information |
|---|
| >KOG0092|consensus | Back alignment and domain information |
|---|
| >KOG0078|consensus | Back alignment and domain information |
|---|
| >KOG0098|consensus | Back alignment and domain information |
|---|
| >KOG0086|consensus | Back alignment and domain information |
|---|
| >KOG0095|consensus | Back alignment and domain information |
|---|
| >KOG0079|consensus | Back alignment and domain information |
|---|
| >KOG0087|consensus | Back alignment and domain information |
|---|
| >KOG0394|consensus | Back alignment and domain information |
|---|
| >KOG0093|consensus | Back alignment and domain information |
|---|
| >cd04120 Rab12 Rab12 subfamily | Back alignment and domain information |
|---|
| >cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily | Back alignment and domain information |
|---|
| >cd04131 Rnd Rnd subfamily | Back alignment and domain information |
|---|
| >cd04121 Rab40 Rab40 subfamily | Back alignment and domain information |
|---|
| >cd04133 Rop_like Rop subfamily | Back alignment and domain information |
|---|
| >cd01875 RhoG RhoG subfamily | Back alignment and domain information |
|---|
| >KOG0091|consensus | Back alignment and domain information |
|---|
| >cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily | Back alignment and domain information |
|---|
| >cd04128 Spg1 Spg1p | Back alignment and domain information |
|---|
| >KOG0088|consensus | Back alignment and domain information |
|---|
| >cd04122 Rab14 Rab14 subfamily | Back alignment and domain information |
|---|
| >cd04102 RabL3 RabL3 (Rab-like3) subfamily | Back alignment and domain information |
|---|
| >cd01874 Cdc42 Cdc42 subfamily | Back alignment and domain information |
|---|
| >cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily | Back alignment and domain information |
|---|
| >cd04107 Rab32_Rab38 Rab38/Rab32 subfamily | Back alignment and domain information |
|---|
| >cd04108 Rab36_Rab34 Rab34/Rab36 subfamily | Back alignment and domain information |
|---|
| >PLN03071 GTP-binding nuclear protein Ran; Provisional | Back alignment and domain information |
|---|
| >KOG0097|consensus | Back alignment and domain information |
|---|
| >cd04119 RJL RJL (RabJ-Like) subfamily | Back alignment and domain information |
|---|
| >cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 | Back alignment and domain information |
|---|
| >cd04117 Rab15 Rab15 subfamily | Back alignment and domain information |
|---|
| >cd01871 Rac1_like Rac1-like subfamily | Back alignment and domain information |
|---|
| >cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily | Back alignment and domain information |
|---|
| >cd04136 Rap_like Rap-like subfamily | Back alignment and domain information |
|---|
| >cd04110 Rab35 Rab35 subfamily | Back alignment and domain information |
|---|
| >cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily | Back alignment and domain information |
|---|
| >PLN03110 Rab GTPase; Provisional | Back alignment and domain information |
|---|
| >PLN00023 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd04176 Rap2 Rap2 subgroup | Back alignment and domain information |
|---|
| >cd04116 Rab9 Rab9 subfamily | Back alignment and domain information |
|---|
| >cd01865 Rab3 Rab3 subfamily | Back alignment and domain information |
|---|
| >cd04127 Rab27A Rab27a subfamily | Back alignment and domain information |
|---|
| >cd04109 Rab28 Rab28 subfamily | Back alignment and domain information |
|---|
| >cd04124 RabL2 RabL2 subfamily | Back alignment and domain information |
|---|
| >cd01892 Miro2 Miro2 subfamily | Back alignment and domain information |
|---|
| >cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases | Back alignment and domain information |
|---|
| >PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases | Back alignment and domain information |
|---|
| >cd01866 Rab2 Rab2 subfamily | Back alignment and domain information |
|---|
| >PTZ00369 Ras-like protein; Provisional | Back alignment and domain information |
|---|
| >cd04111 Rab39 Rab39 subfamily | Back alignment and domain information |
|---|
| >cd04175 Rap1 Rap1 subgroup | Back alignment and domain information |
|---|
| >cd01864 Rab19 Rab19 subfamily | Back alignment and domain information |
|---|
| >cd04106 Rab23_lke Rab23-like subfamily | Back alignment and domain information |
|---|
| >cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily | Back alignment and domain information |
|---|
| >cd04134 Rho3 Rho3 subfamily | Back alignment and domain information |
|---|
| >cd01868 Rab11_like Rab11-like | Back alignment and domain information |
|---|
| >cd04125 RabA_like RabA-like subfamily | Back alignment and domain information |
|---|
| >cd04132 Rho4_like Rho4-like subfamily | Back alignment and domain information |
|---|
| >cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily | Back alignment and domain information |
|---|
| >cd04113 Rab4 Rab4 subfamily | Back alignment and domain information |
|---|
| >cd04118 Rab24 Rab24 subfamily | Back alignment and domain information |
|---|
| >cd04130 Wrch_1 Wrch-1 subfamily | Back alignment and domain information |
|---|
| >cd04144 Ras2 Ras2 subfamily | Back alignment and domain information |
|---|
| >cd04143 Rhes_like Rhes_like subfamily | Back alignment and domain information |
|---|
| >smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases | Back alignment and domain information |
|---|
| >PLN03108 Rab family protein; Provisional | Back alignment and domain information |
|---|
| >cd01861 Rab6 Rab6 subfamily | Back alignment and domain information |
|---|
| >PLN03118 Rab family protein; Provisional | Back alignment and domain information |
|---|
| >cd01860 Rab5_related Rab5-related subfamily | Back alignment and domain information |
|---|
| >cd04112 Rab26 Rab26 subfamily | Back alignment and domain information |
|---|
| >KOG0393|consensus | Back alignment and domain information |
|---|
| >smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases | Back alignment and domain information |
|---|
| >cd04101 RabL4 RabL4 (Rab-like4) subfamily | Back alignment and domain information |
|---|
| >smart00173 RAS Ras subfamily of RAS small GTPases | Back alignment and domain information |
|---|
| >cd04140 ARHI_like ARHI subfamily | Back alignment and domain information |
|---|
| >KOG0081|consensus | Back alignment and domain information |
|---|
| >PRK03003 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >KOG0083|consensus | Back alignment and domain information |
|---|
| >cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily | Back alignment and domain information |
|---|
| >smart00175 RAB Rab subfamily of small GTPases | Back alignment and domain information |
|---|
| >cd01862 Rab7 Rab7 subfamily | Back alignment and domain information |
|---|
| >cd01863 Rab18 Rab18 subfamily | Back alignment and domain information |
|---|
| >cd04177 RSR1 RSR1 subgroup | Back alignment and domain information |
|---|
| >cd04135 Tc10 TC10 subfamily | Back alignment and domain information |
|---|
| >cd04126 Rab20 Rab20 subfamily | Back alignment and domain information |
|---|
| >cd04142 RRP22 RRP22 subfamily | Back alignment and domain information |
|---|
| >cd01870 RhoA_like RhoA-like subfamily | Back alignment and domain information |
|---|
| >PTZ00132 GTP-binding nuclear protein Ran; Provisional | Back alignment and domain information |
|---|
| >PLN00223 ADP-ribosylation factor; Provisional | Back alignment and domain information |
|---|
| >cd04150 Arf1_5_like Arf1-Arf5-like subfamily | Back alignment and domain information |
|---|
| >cd04149 Arf6 Arf6 subfamily | Back alignment and domain information |
|---|
| >smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor | Back alignment and domain information |
|---|
| >cd04103 Centaurin_gamma Centaurin gamma | Back alignment and domain information |
|---|
| >cd01873 RhoBTB RhoBTB subfamily | Back alignment and domain information |
|---|
| >cd04123 Rab21 Rab21 subfamily | Back alignment and domain information |
|---|
| >cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily | Back alignment and domain information |
|---|
| >PTZ00133 ADP-ribosylation factor; Provisional | Back alignment and domain information |
|---|
| >cd04114 Rab30 Rab30 subfamily | Back alignment and domain information |
|---|
| >cd04152 Arl4_Arl7 Arl4/Arl7 subfamily | Back alignment and domain information |
|---|
| >cd00157 Rho Rho (Ras homology) family | Back alignment and domain information |
|---|
| >COG1100 GTPase SAR1 and related small G proteins [General function prediction only] | Back alignment and domain information |
|---|
| >cd04146 RERG_RasL11_like RERG/RasL11-like subfamily | Back alignment and domain information |
|---|
| >cd00154 Rab Rab family | Back alignment and domain information |
|---|
| >TIGR03594 GTPase_EngA ribosome-associated GTPase EngA | Back alignment and domain information |
|---|
| >cd04148 RGK RGK subfamily | Back alignment and domain information |
|---|
| >KOG0395|consensus | Back alignment and domain information |
|---|
| >cd04147 Ras_dva Ras-dva subfamily | Back alignment and domain information |
|---|
| >COG1160 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >cd04139 RalA_RalB RalA/RalB subfamily | Back alignment and domain information |
|---|
| >cd04158 ARD1 ARD1 subfamily | Back alignment and domain information |
|---|
| >cd01893 Miro1 Miro1 subfamily | Back alignment and domain information |
|---|
| >cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily | Back alignment and domain information |
|---|
| >cd00876 Ras Ras family | Back alignment and domain information |
|---|
| >PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases | Back alignment and domain information |
|---|
| >PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed | Back alignment and domain information |
|---|
| >cd04157 Arl6 Arl6 subfamily | Back alignment and domain information |
|---|
| >KOG4252|consensus | Back alignment and domain information |
|---|
| >cd04154 Arl2 Arl2 subfamily | Back alignment and domain information |
|---|
| >cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily | Back alignment and domain information |
|---|
| >cd04153 Arl5_Arl8 Arl5/Arl8 subfamily | Back alignment and domain information |
|---|
| >PRK00093 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >cd04151 Arl1 Arl1 subfamily | Back alignment and domain information |
|---|
| >cd04129 Rho2 Rho2 subfamily | Back alignment and domain information |
|---|
| >cd04156 ARLTS1 ARLTS1 subfamily | Back alignment and domain information |
|---|
| >cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases | Back alignment and domain information |
|---|
| >KOG0073|consensus | Back alignment and domain information |
|---|
| >cd04159 Arl10_like Arl10-like subfamily | Back alignment and domain information |
|---|
| >smart00178 SAR Sar1p-like members of the Ras-family of small GTPases | Back alignment and domain information |
|---|
| >PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases | Back alignment and domain information |
|---|
| >cd04160 Arfrp1 Arfrp1 subfamily | Back alignment and domain information |
|---|
| >KOG0070|consensus | Back alignment and domain information |
|---|
| >cd00879 Sar1 Sar1 subfamily | Back alignment and domain information |
|---|
| >cd01890 LepA LepA subfamily | Back alignment and domain information |
|---|
| >cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily | Back alignment and domain information |
|---|
| >cd04171 SelB SelB subfamily | Back alignment and domain information |
|---|
| >TIGR00231 small_GTP small GTP-binding protein domain | Back alignment and domain information |
|---|
| >TIGR02528 EutP ethanolamine utilization protein, EutP | Back alignment and domain information |
|---|
| >KOG1673|consensus | Back alignment and domain information |
|---|
| >cd04155 Arl3 Arl3 subfamily | Back alignment and domain information |
|---|
| >cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily | Back alignment and domain information |
|---|
| >KOG0075|consensus | Back alignment and domain information |
|---|
| >cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) | Back alignment and domain information |
|---|
| >KOG0096|consensus | Back alignment and domain information |
|---|
| >KOG0071|consensus | Back alignment and domain information |
|---|
| >TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB | Back alignment and domain information |
|---|
| >KOG0074|consensus | Back alignment and domain information |
|---|
| >cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily | Back alignment and domain information |
|---|
| >PRK00454 engB GTP-binding protein YsxC; Reviewed | Back alignment and domain information |
|---|
| >TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE | Back alignment and domain information |
|---|
| >cd01878 HflX HflX subfamily | Back alignment and domain information |
|---|
| >cd00882 Ras_like_GTPase Ras-like GTPase superfamily | Back alignment and domain information |
|---|
| >PRK04213 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK03003 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >cd01898 Obg Obg subfamily | Back alignment and domain information |
|---|
| >PTZ00099 rab6; Provisional | Back alignment and domain information |
|---|
| >TIGR03156 GTP_HflX GTP-binding protein HflX | Back alignment and domain information |
|---|
| >cd00881 GTP_translation_factor GTP translation factor family | Back alignment and domain information |
|---|
| >cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans | Back alignment and domain information |
|---|
| >TIGR01393 lepA GTP-binding protein LepA | Back alignment and domain information |
|---|
| >cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >PRK15494 era GTPase Era; Provisional | Back alignment and domain information |
|---|
| >TIGR00487 IF-2 translation initiation factor IF-2 | Back alignment and domain information |
|---|
| >cd04167 Snu114p Snu114p subfamily | Back alignment and domain information |
|---|
| >KOG3883|consensus | Back alignment and domain information |
|---|
| >PRK05291 trmE tRNA modification GTPase TrmE; Reviewed | Back alignment and domain information |
|---|
| >PRK00093 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >KOG4423|consensus | Back alignment and domain information |
|---|
| >cd01889 SelB_euk SelB subfamily | Back alignment and domain information |
|---|
| >KOG0084|consensus | Back alignment and domain information |
|---|
| >PRK10218 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd01894 EngA1 EngA1 subfamily | Back alignment and domain information |
|---|
| >TIGR00436 era GTP-binding protein Era | Back alignment and domain information |
|---|
| >CHL00189 infB translation initiation factor 2; Provisional | Back alignment and domain information |
|---|
| >KOG0076|consensus | Back alignment and domain information |
|---|
| >PRK11058 GTPase HflX; Provisional | Back alignment and domain information |
|---|
| >PRK05306 infB translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >cd01895 EngA2 EngA2 subfamily | Back alignment and domain information |
|---|
| >cd04169 RF3 RF3 subfamily | Back alignment and domain information |
|---|
| >cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins | Back alignment and domain information |
|---|
| >TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 | Back alignment and domain information |
|---|
| >cd01850 CDC_Septin CDC/Septin | Back alignment and domain information |
|---|
| >TIGR00475 selB selenocysteine-specific elongation factor SelB | Back alignment and domain information |
|---|
| >cd04168 TetM_like Tet(M)-like subfamily | Back alignment and domain information |
|---|
| >TIGR03594 GTPase_EngA ribosome-associated GTPase EngA | Back alignment and domain information |
|---|
| >PRK15467 ethanolamine utilization protein EutP; Provisional | Back alignment and domain information |
|---|
| >cd04163 Era Era subfamily | Back alignment and domain information |
|---|
| >PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed | Back alignment and domain information |
|---|
| >cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 | Back alignment and domain information |
|---|
| >cd01899 Ygr210 Ygr210 subfamily | Back alignment and domain information |
|---|
| >cd01876 YihA_EngB The YihA (EngB) subfamily | Back alignment and domain information |
|---|
| >KOG0080|consensus | Back alignment and domain information |
|---|
| >PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 | Back alignment and domain information |
|---|
| >cd04166 CysN_ATPS CysN_ATPS subfamily | Back alignment and domain information |
|---|
| >PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions | Back alignment and domain information |
|---|
| >PRK05433 GTP-binding protein LepA; Provisional | Back alignment and domain information |
|---|
| >PRK04004 translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha | Back alignment and domain information |
|---|
| >cd04170 EF-G_bact Elongation factor G (EF-G) subfamily | Back alignment and domain information |
|---|
| >PRK12299 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse | Back alignment and domain information |
|---|
| >KOG0072|consensus | Back alignment and domain information |
|---|
| >PRK09554 feoB ferrous iron transport protein B; Reviewed | Back alignment and domain information |
|---|
| >PRK00089 era GTPase Era; Reviewed | Back alignment and domain information |
|---|
| >cd00880 Era_like Era (E | Back alignment and domain information |
|---|
| >PRK12317 elongation factor 1-alpha; Reviewed | Back alignment and domain information |
|---|
| >cd01885 EF2 EF2 (for archaea and eukarya) | Back alignment and domain information |
|---|
| >TIGR02729 Obg_CgtA Obg family GTPase CgtA | Back alignment and domain information |
|---|
| >KOG0095|consensus | Back alignment and domain information |
|---|
| >TIGR01394 TypA_BipA GTP-binding protein TypA/BipA | Back alignment and domain information |
|---|
| >KOG0094|consensus | Back alignment and domain information |
|---|
| >TIGR00437 feoB ferrous iron transporter FeoB | Back alignment and domain information |
|---|
| >COG2229 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0092|consensus | Back alignment and domain information |
|---|
| >TIGR00503 prfC peptide chain release factor 3 | Back alignment and domain information |
|---|
| >cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) | Back alignment and domain information |
|---|
| >COG0486 ThdF Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13351 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >cd04104 p47_IIGP_like p47 (47-kDa) family | Back alignment and domain information |
|---|
| >KOG0078|consensus | Back alignment and domain information |
|---|
| >PRK00741 prfC peptide chain release factor 3; Provisional | Back alignment and domain information |
|---|
| >PRK09602 translation-associated GTPase; Reviewed | Back alignment and domain information |
|---|
| >PRK12297 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >cd01886 EF-G Elongation factor G (EF-G) subfamily | Back alignment and domain information |
|---|
| >KOG0087|consensus | Back alignment and domain information |
|---|
| >PRK12296 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >TIGR00490 aEF-2 translation elongation factor aEF-2 | Back alignment and domain information |
|---|
| >KOG1423|consensus | Back alignment and domain information |
|---|
| >KOG1707|consensus | Back alignment and domain information |
|---|
| >COG3596 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >COG0218 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1159 Era GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12735 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) | Back alignment and domain information |
|---|
| >cd01884 EF_Tu EF-Tu subfamily | Back alignment and domain information |
|---|
| >KOG0394|consensus | Back alignment and domain information |
|---|
| >TIGR00485 EF-Tu translation elongation factor TU | Back alignment and domain information |
|---|
| >TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) | Back alignment and domain information |
|---|
| >cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily | Back alignment and domain information |
|---|
| >PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional | Back alignment and domain information |
|---|
| >COG1160 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site | Back alignment and domain information |
|---|
| >TIGR00484 EF-G translation elongation factor EF-G | Back alignment and domain information |
|---|
| >PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >smart00010 small_GTPase Small GTPase of the Ras superfamily; ill-defined subfamily | Back alignment and domain information |
|---|
| >PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways | Back alignment and domain information |
|---|
| >PLN03126 Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >PRK12736 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) | Back alignment and domain information |
|---|
| >KOG0077|consensus | Back alignment and domain information |
|---|
| >PRK12298 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >KOG0098|consensus | Back alignment and domain information |
|---|
| >TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma | Back alignment and domain information |
|---|
| >CHL00071 tufA elongation factor Tu | Back alignment and domain information |
|---|
| >KOG1191|consensus | Back alignment and domain information |
|---|
| >cd01857 HSR1_MMR1 HSR1/MMR1 | Back alignment and domain information |
|---|
| >KOG0079|consensus | Back alignment and domain information |
|---|
| >cd01859 MJ1464 MJ1464 | Back alignment and domain information |
|---|
| >PRK04000 translation initiation factor IF-2 subunit gamma; Validated | Back alignment and domain information |
|---|
| >KOG0086|consensus | Back alignment and domain information |
|---|
| >PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional | Back alignment and domain information |
|---|
| >cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily | Back alignment and domain information |
|---|
| >KOG0088|consensus | Back alignment and domain information |
|---|
| >PRK00049 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >TIGR02034 CysN sulfate adenylyltransferase, large subunit | Back alignment and domain information |
|---|
| >PTZ00258 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria | Back alignment and domain information |
|---|
| >cd01856 YlqF YlqF | Back alignment and domain information |
|---|
| >cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily | Back alignment and domain information |
|---|
| >PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional | Back alignment and domain information |
|---|
| >cd01900 YchF YchF subfamily | Back alignment and domain information |
|---|
| >cd04128 Spg1 Spg1p | Back alignment and domain information |
|---|
| >cd04121 Rab40 Rab40 subfamily | Back alignment and domain information |
|---|
| >PRK12739 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >PRK09601 GTP-binding protein YchF; Reviewed | Back alignment and domain information |
|---|
| >cd04131 Rnd Rnd subfamily | Back alignment and domain information |
|---|
| >cd04133 Rop_like Rop subfamily | Back alignment and domain information |
|---|
| >COG1163 DRG Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd01892 Miro2 Miro2 subfamily | Back alignment and domain information |
|---|
| >cd01875 RhoG RhoG subfamily | Back alignment and domain information |
|---|
| >KOG1707|consensus | Back alignment and domain information |
|---|
| >COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd01874 Cdc42 Cdc42 subfamily | Back alignment and domain information |
|---|
| >KOG0081|consensus | Back alignment and domain information |
|---|
| >cd01855 YqeH YqeH | Back alignment and domain information |
|---|
| >PLN03110 Rab GTPase; Provisional | Back alignment and domain information |
|---|
| >cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily | Back alignment and domain information |
|---|
| >cd04108 Rab36_Rab34 Rab34/Rab36 subfamily | Back alignment and domain information |
|---|
| >cd04127 Rab27A Rab27a subfamily | Back alignment and domain information |
|---|
| >cd04165 GTPBP1_like GTPBP1-like | Back alignment and domain information |
|---|
| >PLN00043 elongation factor 1-alpha; Provisional | Back alignment and domain information |
|---|
| >cd04110 Rab35 Rab35 subfamily | Back alignment and domain information |
|---|
| >cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily | Back alignment and domain information |
|---|
| >cd04102 RabL3 RabL3 (Rab-like3) subfamily | Back alignment and domain information |
|---|
| >cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 | Back alignment and domain information |
|---|
| >cd04122 Rab14 Rab14 subfamily | Back alignment and domain information |
|---|
| >PLN03127 Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >cd01858 NGP_1 NGP-1 | Back alignment and domain information |
|---|
| >PTZ00141 elongation factor 1- alpha; Provisional | Back alignment and domain information |
|---|
| >cd04120 Rab12 Rab12 subfamily | Back alignment and domain information |
|---|
| >cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily | Back alignment and domain information |
|---|
| >COG1084 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03071 GTP-binding nuclear protein Ran; Provisional | Back alignment and domain information |
|---|
| >KOG0091|consensus | Back alignment and domain information |
|---|
| >PRK00007 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >cd04136 Rap_like Rap-like subfamily | Back alignment and domain information |
|---|
| >KOG0097|consensus | Back alignment and domain information |
|---|
| >PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] | Back alignment and domain information |
|---|
| >cd04117 Rab15 Rab15 subfamily | Back alignment and domain information |
|---|
| >TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains | Back alignment and domain information |
|---|
| >PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases | Back alignment and domain information |
|---|
| >cd04119 RJL RJL (RabJ-Like) subfamily | Back alignment and domain information |
|---|
| >cd04107 Rab32_Rab38 Rab38/Rab32 subfamily | Back alignment and domain information |
|---|
| >TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF | Back alignment and domain information |
|---|
| >cd01871 Rac1_like Rac1-like subfamily | Back alignment and domain information |
|---|
| >KOG0093|consensus | Back alignment and domain information |
|---|
| >PRK09563 rbgA GTPase YlqF; Reviewed | Back alignment and domain information |
|---|
| >KOG3886|consensus | Back alignment and domain information |
|---|
| >KOG4252|consensus | Back alignment and domain information |
|---|
| >PRK12740 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >cd04103 Centaurin_gamma Centaurin gamma | Back alignment and domain information |
|---|
| >PTZ00369 Ras-like protein; Provisional | Back alignment and domain information |
|---|
| >cd04178 Nucleostemin_like Nucleostemin-like | Back alignment and domain information |
|---|
| >cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases | Back alignment and domain information |
|---|
| >cd04140 ARHI_like ARHI subfamily | Back alignment and domain information |
|---|
| >cd04175 Rap1 Rap1 subgroup | Back alignment and domain information |
|---|
| >cd04109 Rab28 Rab28 subfamily | Back alignment and domain information |
|---|
| >PLN00023 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd01864 Rab19 Rab19 subfamily | Back alignment and domain information |
|---|
| >cd04142 RRP22 RRP22 subfamily | Back alignment and domain information |
|---|
| >cd04111 Rab39 Rab39 subfamily | Back alignment and domain information |
|---|
| >PTZ00132 GTP-binding nuclear protein Ran; Provisional | Back alignment and domain information |
|---|
| >cd01866 Rab2 Rab2 subfamily | Back alignment and domain information |
|---|
| >cd04134 Rho3 Rho3 subfamily | Back alignment and domain information |
|---|
| >cd01865 Rab3 Rab3 subfamily | Back alignment and domain information |
|---|
| >PLN03108 Rab family protein; Provisional | Back alignment and domain information |
|---|
| >PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence | Back alignment and domain information |
|---|
| >KOG0090|consensus | Back alignment and domain information |
|---|
| >cd00066 G-alpha G protein alpha subunit | Back alignment and domain information |
|---|
| >cd04116 Rab9 Rab9 subfamily | Back alignment and domain information |
|---|
| >cd04124 RabL2 RabL2 subfamily | Back alignment and domain information |
|---|
| >cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily | Back alignment and domain information |
|---|
| >cd04132 Rho4_like Rho4-like subfamily | Back alignment and domain information |
|---|
| >PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another | Back alignment and domain information |
|---|
| >cd04176 Rap2 Rap2 subgroup | Back alignment and domain information |
|---|
| >cd04118 Rab24 Rab24 subfamily | Back alignment and domain information |
|---|
| >cd01868 Rab11_like Rab11-like | Back alignment and domain information |
|---|
| >cd04106 Rab23_lke Rab23-like subfamily | Back alignment and domain information |
|---|
| >cd01870 RhoA_like RhoA-like subfamily | Back alignment and domain information |
|---|
| >cd04143 Rhes_like Rhes_like subfamily | Back alignment and domain information |
|---|
| >cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily | Back alignment and domain information |
|---|
| >smart00173 RAS Ras subfamily of RAS small GTPases | Back alignment and domain information |
|---|
| >COG1100 GTPase SAR1 and related small G proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PLN00116 translation elongation factor EF-2 subunit; Provisional | Back alignment and domain information |
|---|
| >cd04125 RabA_like RabA-like subfamily | Back alignment and domain information |
|---|
| >cd04135 Tc10 TC10 subfamily | Back alignment and domain information |
|---|
| >KOG0395|consensus | Back alignment and domain information |
|---|
| >PTZ00416 elongation factor 2; Provisional | Back alignment and domain information |
|---|
| >cd04144 Ras2 Ras2 subfamily | Back alignment and domain information |
|---|
| >cd04130 Wrch_1 Wrch-1 subfamily | Back alignment and domain information |
|---|
| >cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily | Back alignment and domain information |
|---|
| >COG1161 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >cd04101 RabL4 RabL4 (Rab-like4) subfamily | Back alignment and domain information |
|---|
| >cd04177 RSR1 RSR1 subgroup | Back alignment and domain information |
|---|
| >PRK07560 elongation factor EF-2; Reviewed | Back alignment and domain information |
|---|
| >cd04113 Rab4 Rab4 subfamily | Back alignment and domain information |
|---|
| >PF05783 DLIC: Dynein light intermediate chain (DLIC); InterPro: IPR022780 This entry consists of several eukaryotic dynein light intermediate chain proteins | Back alignment and domain information |
|---|
| >cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily | Back alignment and domain information |
|---|
| >cd04139 RalA_RalB RalA/RalB subfamily | Back alignment and domain information |
|---|
| >KOG0393|consensus | Back alignment and domain information |
|---|
| >smart00010 small_GTPase Small GTPase of the Ras superfamily; ill-defined subfamily | Back alignment and domain information |
|---|
| >cd01860 Rab5_related Rab5-related subfamily | Back alignment and domain information |
|---|
| >cd04146 RERG_RasL11_like RERG/RasL11-like subfamily | Back alignment and domain information |
|---|
| >cd04148 RGK RGK subfamily | Back alignment and domain information |
|---|
| >cd04114 Rab30 Rab30 subfamily | Back alignment and domain information |
|---|
| >COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd04112 Rab26 Rab26 subfamily | Back alignment and domain information |
|---|
| >cd01862 Rab7 Rab7 subfamily | Back alignment and domain information |
|---|
| >cd04150 Arf1_5_like Arf1-Arf5-like subfamily | Back alignment and domain information |
|---|
| >cd01893 Miro1 Miro1 subfamily | Back alignment and domain information |
|---|
| >PTZ00133 ADP-ribosylation factor; Provisional | Back alignment and domain information |
|---|
| >cd04126 Rab20 Rab20 subfamily | Back alignment and domain information |
|---|
| >TIGR02528 EutP ethanolamine utilization protein, EutP | Back alignment and domain information |
|---|
| >smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor | Back alignment and domain information |
|---|
| >TIGR00092 GTP-binding protein YchF | Back alignment and domain information |
|---|
| >cd01861 Rab6 Rab6 subfamily | Back alignment and domain information |
|---|
| >smart00175 RAB Rab subfamily of small GTPases | Back alignment and domain information |
|---|
| >smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases | Back alignment and domain information |
|---|
| >cd00157 Rho Rho (Ras homology) family | Back alignment and domain information |
|---|
| >PLN00223 ADP-ribosylation factor; Provisional | Back alignment and domain information |
|---|
| >cd01882 BMS1 Bms1 | Back alignment and domain information |
|---|
| >COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily | Back alignment and domain information |
|---|
| >cd01873 RhoBTB RhoBTB subfamily | Back alignment and domain information |
|---|
| >cd04152 Arl4_Arl7 Arl4/Arl7 subfamily | Back alignment and domain information |
|---|
| >cd04158 ARD1 ARD1 subfamily | Back alignment and domain information |
|---|
| >PLN03118 Rab family protein; Provisional | Back alignment and domain information |
|---|
| >PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis | Back alignment and domain information |
|---|
| >cd04123 Rab21 Rab21 subfamily | Back alignment and domain information |
|---|
| >cd04129 Rho2 Rho2 subfamily | Back alignment and domain information |
|---|
| >cd00154 Rab Rab family | Back alignment and domain information |
|---|
| >cd04149 Arf6 Arf6 subfamily | Back alignment and domain information |
|---|
| >cd01863 Rab18 Rab18 subfamily | Back alignment and domain information |
|---|
| >cd04159 Arl10_like Arl10-like subfamily | Back alignment and domain information |
|---|
| >cd01849 YlqF_related_GTPase YlqF-related GTPases | Back alignment and domain information |
|---|
| >PRK13796 GTPase YqeH; Provisional | Back alignment and domain information |
|---|
| >COG0012 Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd04147 Ras_dva Ras-dva subfamily | Back alignment and domain information |
|---|
| >PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases | Back alignment and domain information |
|---|
| >COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton] | Back alignment and domain information |
|---|
| >cd04157 Arl6 Arl6 subfamily | Back alignment and domain information |
|---|
| >cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily | Back alignment and domain information |
|---|
| >PRK12288 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >cd00876 Ras Ras family | Back alignment and domain information |
|---|
| >COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12289 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >KOG1547|consensus | Back alignment and domain information |
|---|
| >KOG0705|consensus | Back alignment and domain information |
|---|
| >TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH | Back alignment and domain information |
|---|
| >cd04156 ARLTS1 ARLTS1 subfamily | Back alignment and domain information |
|---|
| >COG2262 HflX GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00157 ribosome small subunit-dependent GTPase A | Back alignment and domain information |
|---|
| >KOG2655|consensus | Back alignment and domain information |
|---|
| >cd04154 Arl2 Arl2 subfamily | Back alignment and domain information |
|---|
| >cd00879 Sar1 Sar1 subfamily | Back alignment and domain information |
|---|
| >COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00231 small_GTP small GTP-binding protein domain | Back alignment and domain information |
|---|
| >smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases | Back alignment and domain information |
|---|
| >cd04153 Arl5_Arl8 Arl5/Arl8 subfamily | Back alignment and domain information |
|---|
| >PRK14845 translation initiation factor IF-2; Provisional | Back alignment and domain information |
|---|
| >KOG0468|consensus | Back alignment and domain information |
|---|
| >PRK04213 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >smart00178 SAR Sar1p-like members of the Ras-family of small GTPases | Back alignment and domain information |
|---|
| >cd04151 Arl1 Arl1 subfamily | Back alignment and domain information |
|---|
| >cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain | Back alignment and domain information |
|---|
| >KOG1486|consensus | Back alignment and domain information |
|---|
| >PRK00454 engB GTP-binding protein YsxC; Reviewed | Back alignment and domain information |
|---|
| >KOG3905|consensus | Back alignment and domain information |
|---|
| >KOG1673|consensus | Back alignment and domain information |
|---|
| >KOG0462|consensus | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1489|consensus | Back alignment and domain information |
|---|
| >cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases | Back alignment and domain information |
|---|
| >KOG1491|consensus | Back alignment and domain information |
|---|
| >KOG1424|consensus | Back alignment and domain information |
|---|
| >COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG1162 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1145|consensus | Back alignment and domain information |
|---|
| >KOG3887|consensus | Back alignment and domain information |
|---|
| >cd01854 YjeQ_engC YjeQ/EngC | Back alignment and domain information |
|---|
| >cd04155 Arl3 Arl3 subfamily | Back alignment and domain information |
|---|
| >TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB | Back alignment and domain information |
|---|
| >PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases | Back alignment and domain information |
|---|
| >smart00053 DYNc Dynamin, GTPase | Back alignment and domain information |
|---|
| >COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK00098 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >KOG0082|consensus | Back alignment and domain information |
|---|
| >cd04160 Arfrp1 Arfrp1 subfamily | Back alignment and domain information |
|---|
| >PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15494 era GTPase Era; Provisional | Back alignment and domain information |
|---|
| >COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >smart00275 G_alpha G protein alpha subunit | Back alignment and domain information |
|---|
| >PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity | Back alignment and domain information |
|---|
| >KOG0458|consensus | Back alignment and domain information |
|---|
| >cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) | Back alignment and domain information |
|---|
| >cd01878 HflX HflX subfamily | Back alignment and domain information |
|---|
| >cd04104 p47_IIGP_like p47 (47-kDa) family | Back alignment and domain information |
|---|
| >cd01850 CDC_Septin CDC/Septin | Back alignment and domain information |
|---|
| >cd01876 YihA_EngB The YihA (EngB) subfamily | Back alignment and domain information |
|---|
| >cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans | Back alignment and domain information |
|---|
| >PRK13768 GTPase; Provisional | Back alignment and domain information |
|---|
| >COG0536 Obg Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0083|consensus | Back alignment and domain information |
|---|
| >KOG4423|consensus | Back alignment and domain information |
|---|
| >KOG3859|consensus | Back alignment and domain information |
|---|
| >cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse | Back alignment and domain information |
|---|
| >TIGR03156 GTP_HflX GTP-binding protein HflX | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >cd04171 SelB SelB subfamily | Back alignment and domain information |
|---|
| >PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions | Back alignment and domain information |
|---|
| >cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily | Back alignment and domain information |
|---|
| >PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis | Back alignment and domain information |
|---|
| >cd01895 EngA2 EngA2 subfamily | Back alignment and domain information |
|---|
| >cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >KOG1144|consensus | Back alignment and domain information |
|---|
| >KOG0096|consensus | Back alignment and domain information |
|---|
| >cd04163 Era Era subfamily | Back alignment and domain information |
|---|
| >TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE | Back alignment and domain information |
|---|
| >KOG0410|consensus | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways | Back alignment and domain information |
|---|
| >KOG1954|consensus | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09866 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00436 era GTP-binding protein Era | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 173 | ||||
| 1z0f_A | 179 | Gdp-Bound Rab14 Gtpase Length = 179 | 9e-39 | ||
| 4drz_A | 196 | Crystal Structure Of Human Rab14 Length = 196 | 9e-38 | ||
| 1yu9_A | 175 | Gppnhp-Bound Rab4a Length = 175 | 6e-30 | ||
| 2bmd_A | 186 | High Resolution Structure Of Gdp-Bound Human Rab4a | 7e-30 | ||
| 2o52_A | 200 | Crystal Structure Of Human Rab4b In Complex With Gd | 2e-29 | ||
| 1z0k_A | 172 | Structure Of Gtp-Bound Rab4q67l Gtpase In Complex W | 3e-29 | ||
| 1z0a_A | 174 | Gdp-Bound Rab2a Gtpase Length = 174 | 3e-27 | ||
| 2a5j_A | 191 | Crystal Structure Of Human Rab2b Length = 191 | 5e-27 | ||
| 3cpj_B | 223 | Crystal Structure Of Ypt31 In Complex With Yeast Ra | 2e-25 | ||
| 1g16_A | 170 | Crystal Structure Of Sec4-Gdp Length = 170 | 6e-24 | ||
| 1g17_A | 170 | Crystal Structure Of Sec4-Guanosine-5'-(Beta,Gamma) | 7e-24 | ||
| 3rwm_B | 185 | Crystal Structure Of Ypt32 In Complex With Gppnhp L | 7e-24 | ||
| 2ocy_C | 170 | Complex Of The Guanine Exchange Factor Sec2p And Th | 8e-24 | ||
| 1yzk_A | 184 | Gppnhp Bound Rab11 Gtpase Length = 184 | 1e-23 | ||
| 3cph_A | 213 | Crystal Structure Of Sec4 In Complex With Rab-Gdi L | 1e-23 | ||
| 2eqb_A | 174 | Crystal Structure Of The Rab Gtpase Sec4p, The Sec2 | 1e-23 | ||
| 1oiv_A | 191 | X-Ray Structure Of The Small G Protein Rab11a In Co | 1e-23 | ||
| 2f9l_A | 199 | 3d Structure Of Inactive Human Rab11b Gtpase Length | 5e-23 | ||
| 2d7c_A | 167 | Crystal Structure Of Human Rab11 In Complex With Fi | 6e-23 | ||
| 2hv8_A | 172 | Crystal Structure Of Gtp-Bound Rab11 In Complex Wit | 6e-23 | ||
| 2gzd_A | 173 | Crystal Structure Of Rab11 In Complex With Rab11-Fi | 7e-23 | ||
| 2fu5_C | 183 | Structure Of Rab8 In Complex With Mss4 Length = 183 | 9e-23 | ||
| 1oiw_A | 191 | X-ray Structure Of The Small G Protein Rab11a In Co | 1e-22 | ||
| 3qbt_A | 174 | Crystal Structure Of Ocrl1 540-678 In Complex With | 1e-22 | ||
| 3bfk_A | 181 | Crystal Structure Of Plasmodium Falciparum Rab11a I | 4e-22 | ||
| 4fmd_F | 164 | Espg-Rab1 Complex Structure At 3.05 A Length = 164 | 4e-22 | ||
| 4fmb_B | 171 | Vira-Rab1 Complex Structure Length = 171 | 5e-22 | ||
| 4fmc_B | 171 | Espg-Rab1 Complex Length = 171 | 5e-22 | ||
| 3jza_A | 175 | Crystal Structure Of Human Rab1b In Complex With Th | 5e-22 | ||
| 4i1o_A | 181 | Crystal Structure Of The Legionella Pneumophila Gap | 6e-22 | ||
| 4fmc_F | 117 | Espg-Rab1 Complex Length = 117 | 6e-22 | ||
| 3tkl_A | 196 | Crystal Structure Of The Gtp-Bound Rab1a In Complex | 7e-22 | ||
| 2wwx_A | 175 | Crystal Structure Of The SidmDRRA(GEFGDF DOMAIN)-Ra | 7e-22 | ||
| 3l0i_B | 199 | Complex Structure Of Sidm/drra With The Wild Type R | 7e-22 | ||
| 2fol_A | 191 | Crystal Structure Of Human Rab1a In Complex With Gd | 8e-22 | ||
| 3sfv_A | 181 | Crystal Structure Of The Gdp-Bound Rab1a S25n Mutan | 1e-21 | ||
| 1ukv_Y | 206 | Structure Of Rabgdp-Dissociation Inhibitor In Compl | 2e-21 | ||
| 2bcg_Y | 206 | Structure Of Doubly Prenylated Ypt1:gdi Complex Len | 2e-21 | ||
| 3tw8_B | 181 | Gef Domain Of Dennd 1b In Complex With Rab Gtpase R | 3e-21 | ||
| 1yzn_A | 185 | Gppnhp-Bound Ypt1p Gtpase Length = 185 | 3e-21 | ||
| 2ew1_A | 201 | Crystal Structure Of Rab30 In Complex With A Gtp An | 4e-21 | ||
| 1x3s_A | 195 | Crystal Structure Of Human Rab18 In Complex With Gp | 5e-21 | ||
| 2rhd_A | 175 | Crystal Structure Of Cryptosporidium Parvum Small G | 2e-20 | ||
| 3tso_A | 178 | Structure Of The Cancer Associated Rab25 Protein In | 6e-20 | ||
| 2oil_A | 193 | Crystal Structure Of Human Rab25 In Complex With Gd | 7e-20 | ||
| 2il1_A | 192 | Crystal Structure Of A Predicted Human Gtpase In Co | 8e-20 | ||
| 2hup_A | 201 | Crystal Structure Of Human Rab43 In Complex With Gd | 4e-19 | ||
| 2g6b_A | 180 | Crystal Structure Of Human Rab26 In Complex With A | 3e-18 | ||
| 2gf9_A | 189 | Crystal Structure Of Human Rab3d In Complex With Gd | 1e-17 | ||
| 1yvd_A | 169 | Gppnhp-Bound Rab22 Gtpase Length = 169 | 2e-17 | ||
| 3dz8_A | 191 | Crystal Structure Of Human Rab3b Gtpase Bound With | 4e-17 | ||
| 3rab_A | 169 | Gppnhp-bound Rab3a At 2.0 A Resolution Length = 169 | 5e-17 | ||
| 1z0j_A | 170 | Structure Of Gtp-Bound Rab22q64l Gtpase In Complex | 1e-16 | ||
| 2ocb_A | 180 | Crystal Structure Of Human Rab9b In Complex With A | 1e-16 | ||
| 2p5s_A | 199 | Rab Domain Of Human Rasef In Complex With Gdp Lengt | 7e-16 | ||
| 1yzl_A | 179 | Gppnhp-Bound Rab9 Gtpase Length = 179 | 9e-16 | ||
| 1wms_A | 177 | High Resolution Crystal Structure Of Human Rab9 Gtp | 9e-16 | ||
| 1s8f_A | 177 | Crystal Structure Of Rab9 Complexed To Gdp Reveals | 1e-15 | ||
| 1zbd_A | 203 | Structural Basis Of Rab Effector Specificity: Cryst | 1e-15 | ||
| 2efc_B | 181 | Ara7-GdpATVPS9A Length = 181 | 1e-15 | ||
| 1z06_A | 189 | Gppnhp-Bound Rab33 Gtpase Length = 189 | 2e-15 | ||
| 2g77_B | 198 | Crystal Structure Of Gyp1 Tbc Domain In Complex Wit | 3e-15 | ||
| 1ky2_A | 182 | Gppnhp-Bound Ypt7p At 1.6 A Resolution Length = 182 | 5e-15 | ||
| 1z22_A | 168 | Gdp-Bound Rab23 Gtpase Crystallized In C222(1) Spac | 1e-14 | ||
| 1vg1_A | 185 | Gdp-bound Rab7 Length = 185 | 1e-14 | ||
| 1vg0_B | 207 | The Crystal Structures Of The Rep-1 Protein In Comp | 1e-14 | ||
| 3law_A | 207 | Structure Of Gtp-Bound L129f Mutant Rab7 Length = 2 | 1e-14 | ||
| 2f7s_A | 217 | The Crystal Structure Of Human Rab27b Bound To Gdp | 2e-14 | ||
| 1yzq_A | 170 | Gppnhp-Bound Rab6 Gtpase Length = 170 | 8e-14 | ||
| 1t91_A | 207 | Crystal Structure Of Human Small Gtpase Rab7(Gtp) L | 1e-13 | ||
| 2fg5_A | 192 | Crystal Structure Of Human Rab31 In Complex With A | 2e-13 | ||
| 2if0_A | 200 | Crystal Structure Of Mouse Rab27b Bound To Gdp In M | 2e-13 | ||
| 2iey_A | 195 | Crystal Structure Of Mouse Rab27b Bound To Gdp In H | 3e-13 | ||
| 1ek0_A | 170 | Gppnhp-Bound Ypt51 At 1.48 A Resolution Length = 17 | 3e-13 | ||
| 2zet_A | 203 | Crystal Structure Of The Small Gtpase Rab27b Comple | 3e-13 | ||
| 3bc1_A | 195 | Crystal Structure Of The Complex Rab27a-slp2a Lengt | 4e-13 | ||
| 2iez_A | 220 | Crystal Structure Of Mouse Rab27b Bound To Gdp In M | 4e-13 | ||
| 1d5c_A | 162 | Crystal Structure Of Plasmodium Falciparum Rab6 Com | 6e-13 | ||
| 2gil_A | 162 | Structure Of The Extremely Slow Gtpase Rab6a In The | 8e-13 | ||
| 1z08_A | 170 | Gppnhp-Bound Rab21 Q53g Mutant Gtpase Length = 170 | 9e-13 | ||
| 4dkx_A | 216 | Crystal Structure Of The Rab 6a'(Q72l) Length = 216 | 1e-12 | ||
| 2fe4_A | 171 | The Crystal Structure Of Human Neuronal Rab6b In It | 2e-12 | ||
| 1tu4_A | 171 | Crystal Structure Of Rab5-Gdp Complex Length = 171 | 2e-12 | ||
| 1huq_A | 164 | 1.8a Crystal Structure Of The Monomeric Gtpase Rab5 | 3e-12 | ||
| 1tu3_A | 171 | Crystal Structure Of Rab5 Complex With Rabaptin5 C- | 4e-12 | ||
| 1n6h_A | 170 | Crystal Structure Of Human Rab5a Length = 170 | 4e-12 | ||
| 2y8e_A | 179 | Crystal Structure Of D. Melanogaster Rab6 Gtpase Bo | 4e-12 | ||
| 2hei_A | 179 | Crystal Structure Of Human Rab5b In Complex With Gd | 5e-12 | ||
| 1n6o_A | 170 | Crystal Structure Of Human Rab5a A30k Mutant Comple | 6e-12 | ||
| 1n6i_A | 170 | Crystal Structure Of Human Rab5a A30p Mutant Comple | 7e-12 | ||
| 1yzu_A | 170 | Gppnhp-Bound Rab21 Gtpase At 2.50 A Resolution Leng | 7e-12 | ||
| 1yzt_A | 184 | Gppnhp-Bound Rab21 Gtpase At 2.05 A Resolution Leng | 7e-12 | ||
| 1n6p_A | 170 | Crystal Structure Of Human Rab5a A30e Mutant Comple | 7e-12 | ||
| 1n6n_A | 170 | Crystal Structure Of Human Rab5a A30r Mutant Comple | 8e-12 | ||
| 3cwz_A | 188 | Strucure Of Rab6(Gtp)-R6ip1 Complex Length = 188 | 9e-12 | ||
| 1n6r_A | 170 | Crystal Structure Of Human Rab5a A30l Mutant Comple | 1e-11 | ||
| 3bbp_A | 211 | Rab6-Gtp:gcc185 Rab Binding Domain Complex Length = | 2e-11 | ||
| 1z07_A | 166 | Gppnhp-Bound Rab5c G55q Mutant Gtpase Length = 166 | 2e-11 | ||
| 1z0d_A | 167 | Gdp-bound Rab5c Gtpase Length = 167 | 3e-11 | ||
| 3mjh_A | 168 | Crystal Structure Of Human Rab5a In Complex With Th | 3e-11 | ||
| 4djt_A | 218 | Crystal Structure Of A Nuclear Gtp-Binding Protein | 6e-09 | ||
| 3clv_A | 208 | Crystal Structure Of Rab5a From Plasmodium Falcipar | 9e-09 | ||
| 3bwd_D | 182 | Crystal Structure Of The Plant Rho Protein Rop5 Len | 2e-08 | ||
| 2a78_A | 187 | Crystal Structure Of The C3bot-Rala Complex Reveals | 3e-08 | ||
| 1uad_A | 175 | Crystal Structure Of The Rala-gppnhp-sec5 Ral-bindi | 3e-08 | ||
| 1u8y_A | 168 | Crystal Structures Of Ral-Gppnhp And Ral-Gdp Reveal | 3e-08 | ||
| 2bov_A | 206 | Molecular Recognition Of An Adp-Ribosylating Clostr | 4e-08 | ||
| 2nty_C | 180 | Rop4-Gdp-Prone8 Length = 180 | 6e-08 | ||
| 2kwi_A | 178 | Ralb-Rlip76 (Ralbp1) Complex Length = 178 | 1e-07 | ||
| 2ke5_A | 174 | Solution Structure And Dynamics Of The Small Gtpase | 1e-07 | ||
| 2wbl_C | 180 | Three-Dimensional Structure Of A Binary Rop-Prone C | 1e-07 | ||
| 2j0v_A | 212 | The Crystal Structure Of Arabidopsis Thaliana Rac7- | 2e-07 | ||
| 1zc3_A | 175 | Crystal Structure Of The Ral-Binding Domain Of Exo8 | 3e-07 | ||
| 1byu_A | 216 | Canine Gdp-Ran Length = 216 | 5e-07 | ||
| 2bku_A | 177 | Kap95p:rangtp Complex Length = 177 | 5e-07 | ||
| 3sea_A | 167 | Structure Of Rheb-Y35a Mutant In Gdp- And Gmppnp-Bo | 5e-07 | ||
| 1wa5_A | 176 | Crystal Structure Of The Exportin Cse1p Complexed W | 5e-07 | ||
| 1rrp_A | 204 | Structure Of The Ran-Gppnhp-Ranbd1 Complex Length = | 7e-07 | ||
| 1qg2_A | 216 | Canine Gdp-Ran R76e Mutant Length = 216 | 7e-07 | ||
| 3ea5_A | 216 | Kap95p Binding Induces The Switch Loops Of Rangdp T | 7e-07 | ||
| 1a2k_C | 216 | Gdpran-Ntf2 Complex Length = 216 | 7e-07 | ||
| 3gj0_A | 221 | Crystal Structure Of Human Rangdp Length = 221 | 8e-07 | ||
| 3t5g_A | 181 | Structure Of Fully Modified Farnesylated Rheb In Co | 9e-07 | ||
| 1xtq_A | 177 | Structure Of Small Gtpase Human Rheb In Complex Wit | 9e-07 | ||
| 2l0x_A | 169 | Solution Structure Of The 21 Kda Gtpase Rheb Bound | 1e-06 | ||
| 1qbk_C | 216 | Structure Of The Karyopherin Beta2-ran Gppnhp Nucle | 1e-06 | ||
| 1qg4_A | 216 | Canine Gdp-Ran F72y Mutant Length = 216 | 2e-06 | ||
| 1mr3_F | 181 | Saccharomyces Cerevisiae Adp-Ribosylation Factor 2 | 2e-06 | ||
| 2hxs_A | 178 | Crystal Structure Of Rab28a Gtpase In The Inactive | 2e-06 | ||
| 3gj4_A | 221 | Crystal Structure Of Human Rangdp-Nup153znf3 Comple | 3e-06 | ||
| 2k5u_A | 181 | Solution Structure Of Myirstoylated Yeast Arf1 Prot | 4e-06 | ||
| 3tjz_A | 164 | Crystal Structure Of Arf1 Bound To The GammaZETA-Co | 4e-06 | ||
| 3nc1_C | 182 | Crystal Structure Of The Crm1-Rangtp Complex Length | 4e-06 | ||
| 3nby_C | 176 | Crystal Structure Of The Pki Nes-Crm1-Rangtp Nuclea | 4e-06 | ||
| 421p_A | 166 | Three-Dimensional Structures Of H-Ras P21 Mutants: | 5e-06 | ||
| 3ran_A | 216 | Canine Gdp-Ran Q69l Mutant Length = 216 | 6e-06 | ||
| 2x19_A | 172 | Crystal Structure Of Importin13 - Rangtp Complex Le | 6e-06 | ||
| 1clu_A | 166 | H-Ras Complexed With Diaminobenzophenone-Beta,Gamma | 6e-06 | ||
| 1jah_A | 166 | H-Ras P21 Protein Mutant G12p, Complexed With Guano | 6e-06 | ||
| 3icq_B | 171 | Karyopherin Nuclear State Length = 171 | 6e-06 | ||
| 1agp_A | 166 | Three-Dimensional Structures And Properties Of A Tr | 6e-06 | ||
| 4dso_A | 189 | Small-Molecule Ligands Bind To A Distinct Pocket In | 7e-06 | ||
| 4epr_A | 170 | Discovery Of Small Molecules That Bind To K-Ras And | 8e-06 | ||
| 3m1i_A | 219 | Crystal Structure Of Yeast Crm1 (Xpo1p) In Complex | 9e-06 | ||
| 1dpf_A | 180 | Crystal Structure Of A Mg-Free Form Of Rhoa Complex | 1e-05 | ||
| 1cxz_A | 182 | Crystal Structure Of Human Rhoa Complexed With The | 1e-05 | ||
| 2yc2_C | 208 | Intraflagellar Transport Complex 25-27 From Chlamyd | 1e-05 | ||
| 2fn4_A | 181 | The Crystal Structure Of Human Ras-Related Protein, | 2e-05 | ||
| 2fv8_A | 207 | The Crystal Structure Of Rhob In The Gdp-Bound Stat | 2e-05 | ||
| 2cl0_X | 166 | Crystal Structure Analysis Of A Fluorescent Form Of | 2e-05 | ||
| 2j1l_A | 214 | Crystal Structure Of Human Rho-Related Gtp-Binding | 3e-05 | ||
| 3kz1_E | 182 | Crystal Structure Of The Complex Of Pdz-Rhogef DhPH | 4e-05 | ||
| 3tvd_A | 193 | Crystal Structure Of Mouse Rhoa-Gtp Complex Length | 5e-05 | ||
| 1s1c_A | 183 | Crystal Structure Of The Complex Between The Human | 5e-05 | ||
| 3lw8_A | 185 | Shigella Ipgb2 In Complex With Human Rhoa, Gdp And | 5e-05 | ||
| 1x86_B | 196 | Crystal Structure Of The DhPH DOMAINS OF LEUKEMIA-A | 5e-05 | ||
| 3b13_B | 184 | Crystal Structure Of The Dhr-2 Domain Of Dock2 In C | 5e-05 | ||
| 4f38_A | 195 | Crystal Structure Of Geranylgeranylated Rhoa In Com | 5e-05 | ||
| 2yin_C | 196 | Structure Of The Complex Between Dock2 And Rac1. Le | 5e-05 | ||
| 2gcn_A | 201 | Crystal Structure Of The Human Rhoc-Gdp Complex Len | 5e-05 | ||
| 3sbd_A | 187 | Crystal Structure Of Rac1 P29s Mutant Length = 187 | 6e-05 | ||
| 1foe_B | 177 | Crystal Structure Of Rac1 In Complex With The Guani | 6e-05 | ||
| 2fju_A | 178 | Activated Rac1 Bound To Its Effector Phospholipase | 6e-05 | ||
| 2ic5_A | 180 | Crystal Structure Of Human Rac3 Grown In The Presen | 6e-05 | ||
| 1lb1_B | 192 | Crystal Structure Of The Dbl And Pleckstrin Homolog | 6e-05 | ||
| 2g0n_A | 179 | The Crystal Structure Of The Human Rac3 In Complex | 6e-05 | ||
| 2gco_A | 201 | Crystal Structure Of The Human Rhoc-gppnhp Complex | 6e-05 | ||
| 1m7b_A | 184 | Crystal Structure Of Rnd3RHOE: FUNCTIONAL IMPLICATI | 6e-05 | ||
| 3sua_A | 184 | Crystal Structure Of The Intracellular Domain Of Pl | 6e-05 | ||
| 1ryf_A | 203 | Alternative Splicing Of Rac1 Generates Rac1b, A Sel | 6e-05 | ||
| 2h7v_A | 188 | Co-crystal Structure Of Ypka-rac1 Length = 188 | 6e-05 | ||
| 3th5_A | 204 | Crystal Structure Of Wild-Type Rac1 Length = 204 | 6e-05 | ||
| 1he1_C | 176 | Crystal Structure Of The Complex Between The Gap Do | 6e-05 | ||
| 1mh1_A | 186 | Small G-Protein Length = 186 | 6e-05 | ||
| 4dxa_A | 169 | Co-Crystal Structure Of Rap1 In Complex With Krit1 | 7e-05 | ||
| 1gwn_A | 205 | The Crystal Structure Of The Core Domain Of RhoeRND | 7e-05 | ||
| 2c2h_A | 192 | Crystal Structure Of The Human Rac3 In Complex With | 7e-05 | ||
| 2v55_B | 200 | Mechanism Of Multi-site Phosphorylation From A Rock | 7e-05 | ||
| 1g4u_R | 184 | Crystal Structure Of The Salmonella Tyrosine Phosph | 7e-05 | ||
| 2vrw_A | 184 | Critical Structural Role For The Ph And C1 Domains | 7e-05 | ||
| 1hh4_A | 192 | Rac1-Rhogdi Complex Involved In Nadph Oxidase Activ | 7e-05 | ||
| 2w2v_A | 184 | Rac2 (G12v) In Complex With Gtpgs Length = 184 | 8e-05 | ||
| 1i4d_D | 192 | Crystal Structure Analysis Of Rac1-Gdp Complexed Wi | 8e-05 | ||
| 2w2t_A | 185 | Rac2 (G12v) In Complex With Gdp Length = 185 | 9e-05 | ||
| 1x1r_A | 178 | Crystal Structure Of M-Ras In Complex With Gdp Leng | 1e-04 | ||
| 1a4r_B | 191 | G12v Mutant Of Human Placental Cdc42 Gtpase In The | 2e-04 | ||
| 3brw_D | 167 | Structure Of The Rap-Rapgap Complex Length = 167 | 2e-04 | ||
| 2a5d_A | 175 | Structural Basis For The Activation Of Cholera Toxi | 2e-04 | ||
| 3n5c_A | 162 | Crystal Structure Of Arf6delta13 Complexed With Gdp | 2e-04 | ||
| 3doe_A | 192 | Complex Of Arl2 And Bart, Crystal Form 1 Length = 1 | 2e-04 | ||
| 1e0s_A | 174 | Small G Protein Arf6-Gdp Length = 174 | 2e-04 | ||
| 4fme_C | 160 | Espg-Rab1-Arf6 Complex Length = 160 | 2e-04 | ||
| 1gua_A | 167 | Human Rap1a, Residues 1-167, Double Mutant (E30d,K3 | 2e-04 | ||
| 3pcr_B | 162 | Structure Of Espg-Arf6 Complex Length = 162 | 3e-04 | ||
| 1ksh_A | 186 | Complex Of Arl2 And Pde Delta, Crystal Form 2 (Nati | 3e-04 | ||
| 1ksj_A | 186 | Complex Of Arl2 And Pde Delta, Crystal Form 2 (Seme | 3e-04 | ||
| 4gzm_A | 204 | Crystal Structure Of Rac1 F28l Mutant Length = 204 | 3e-04 | ||
| 1ksg_A | 186 | Complex Of Arl2 And Pde Delta, Crystal Form 1 Lengt | 3e-04 | ||
| 1ds6_A | 192 | Crystal Structure Of A Rac-Rhogdi Complex Length = | 3e-04 | ||
| 2ery_A | 172 | The Crystal Structure Of The Ras Related Protein Rr | 3e-04 | ||
| 3lvr_E | 497 | The Crystal Structure Of Asap3 In Complex With Arf6 | 4e-04 | ||
| 4gzl_A | 204 | Crystal Structure Of Rac1 Q61l Mutant Length = 204 | 4e-04 | ||
| 3gcg_A | 182 | Crystal Structure Of Map And Cdc42 Complex Length = | 4e-04 | ||
| 1gzs_A | 180 | Crystal Structure Of The Complex Between The Gef Do | 4e-04 | ||
| 3eg5_A | 178 | Crystal Structure Of Mdia1-Tsh Gbd-Fh3 In Complex W | 5e-04 | ||
| 3msx_A | 180 | Crystal Structure Of Rhoa.Gdp.Mgf3 In Complex With | 5e-04 | ||
| 1am4_D | 177 | Complex Between Cdc42hs.Gmppnp And P50 Rhogap (H. S | 5e-04 | ||
| 1ees_A | 178 | Solution Structure Of Cdc42hs Complexed With A Pept | 5e-04 | ||
| 1fzq_A | 181 | Crystal Structure Of Murine Arl3-Gdp Length = 181 | 5e-04 | ||
| 2c5l_A | 173 | Structure Of Plc Epsilon Ras Association Domain Wit | 5e-04 | ||
| 4goj_A | 189 | The Crystal Structure Of Full Length Arl3gppnhp In | 5e-04 | ||
| 1xcg_B | 178 | Crystal Structure Of Human Rhoa In Complex With DhP | 5e-04 | ||
| 3ryt_C | 180 | The Plexin A1 Intracellular Region In Complex With | 5e-04 | ||
| 1tx4_B | 177 | RhoRHOGAPGDP(DOT)ALF4 COMPLEX Length = 177 | 5e-04 | ||
| 1cee_A | 179 | Solution Structure Of Cdc42 In Complex With The Gtp | 5e-04 | ||
| 3v4f_A | 166 | H-Ras Peg 400CACL2, ORDERED OFF Length = 166 | 5e-04 | ||
| 3vhl_B | 195 | Crystal Structure Of The Dhr-2 Domain Of Dock8 In C | 5e-04 | ||
| 1ow3_B | 193 | Crystal Structure Of Rhoa.Gdp.Mgf3-In Complex With | 5e-04 | ||
| 3pir_A | 183 | Crystal Structure Of M-Rasd41e In Complex With Gppn | 5e-04 | ||
| 1c1y_A | 167 | Crystal Structure Of Rap.Gmppnp In Complex With The | 5e-04 | ||
| 4did_A | 193 | Crystal Structure Of Salmonella Effector N-Terminal | 5e-04 | ||
| 4q21_A | 189 | Molecular Switch For Signal Transduction: Structura | 5e-04 | ||
| 221p_A | 166 | Three-Dimensional Structures Of H-Ras P21 Mutants: | 5e-04 | ||
| 1aje_A | 194 | Cdc42 From Human, Nmr, 20 Structures Length = 194 | 5e-04 | ||
| 4efm_A | 171 | Crystal Structure Of H-Ras G12v In Complex With Gpp | 5e-04 | ||
| 4efl_A | 171 | Crystal Structure Of H-Ras Wt In Complex With Gppnh | 5e-04 | ||
| 1i4t_D | 192 | Crystal Structure Analysis Of Rac1-Gmppnp In Comple | 5e-04 | ||
| 2odb_A | 192 | The Crystal Structure Of Human Cdc42 In Complex Wit | 6e-04 | ||
| 1cc0_A | 190 | Crystal Structure Of The Rhoa.Gdp-Rhogdi Complex Le | 6e-04 | ||
| 1kz7_B | 188 | Crystal Structure Of The DhPH FRAGMENT OF MURINE DB | 6e-04 | ||
| 1wq1_R | 166 | Ras-Rasgap Complex Length = 166 | 6e-04 | ||
| 1grn_A | 191 | Crystal Structure Of The Cdc42CDC42GAPALF3 COMPLEX. | 6e-04 | ||
| 1rvd_A | 166 | H-Ras Complexed With Diaminobenzophenone-Beta,Gamma | 6e-04 | ||
| 2x1v_A | 166 | Crystal Structure Of The Activating H-Ras I163f Mut | 6e-04 | ||
| 2dfk_B | 194 | Crystal Structure Of The Cdc42-Collybistin Ii Compl | 6e-04 | ||
| 1doa_A | 191 | Structure Of The Rho Family Gtp-Binding Protein Cdc | 6e-04 | ||
| 6q21_A | 171 | Molecular Switch For Signal Transduction: Structura | 6e-04 | ||
| 2q21_A | 171 | Crystal Structures At 2.2 Angstroms Resolution Of T | 6e-04 | ||
| 1e96_A | 192 | Structure Of The RacP67PHOX COMPLEX Length = 192 | 6e-04 | ||
| 3ref_B | 194 | Crystal Structure Of Ehrho1 Bound To Gdp And Magnes | 6e-04 | ||
| 4dvg_A | 188 | Crystal Structure Of E. Histolytica Formin1 Bound T | 6e-04 | ||
| 3k9n_A | 166 | Allosteric Modulation Of H-Ras Gtpase Length = 166 | 6e-04 | ||
| 3bh7_A | 164 | Crystal Structure Of The Rp2-Arl3 Complex Bound To | 6e-04 | ||
| 2qrz_A | 189 | Cdc42 Bound To Gmp-Pcp: Induced Fit By Effector Is | 6e-04 | ||
| 3con_A | 190 | Crystal Structure Of The Human Nras Gtpase Bound Wi | 6e-04 | ||
| 2quz_A | 166 | Crystal Structure Of The Activating H-Rask117r Muta | 6e-04 | ||
| 2al7_A | 186 | Structure Of Human Adp-Ribosylation Factor-Like 10c | 6e-04 | ||
| 2wm9_B | 190 | Structure Of The Complex Between Dock9 And Cdc42. L | 6e-04 | ||
| 2cld_X | 166 | Crystal Structure Analysis Of A Fluorescent Form Of | 6e-04 | ||
| 1z2c_A | 193 | Crystal Structure Of Mdia1 Gbd-Fh3 In Complex With | 7e-04 | ||
| 3oes_A | 201 | Crystal Structure Of The Small Gtpase Rhebl1 Length | 7e-04 | ||
| 4epx_A | 170 | Discovery Of Small Molecules That Bind To K-Ras And | 7e-04 | ||
| 4ept_A | 170 | Discovery Of Small Molecules That Bind To K-Ras And | 7e-04 | ||
| 2wkq_A | 332 | Structure Of A Photoactivatable Rac1 Containing The | 7e-04 | ||
| 2ksq_A | 181 | The Myristoylated Yeast Arf1 In A Gtp And Bicelle B | 7e-04 | ||
| 2wkr_A | 332 | Structure Of A Photoactivatable Rac1 Containing The | 7e-04 | ||
| 2wkp_A | 332 | Structure Of A Photoactivatable Rac1 Containing Lov | 7e-04 | ||
| 1z6y_A | 179 | Structure Of Human Adp-Ribosylation Factor-Like 5 L | 8e-04 | ||
| 2h17_A | 181 | Structure Of Human Adp-Ribosylation Factor-Like 5 ( | 8e-04 | ||
| 1zj6_A | 187 | Crystal Structure Of Human Arl5 Length = 187 | 8e-04 | ||
| 2h16_A | 183 | Structure Of Human Adp-Ribosylation Factor-Like 5 ( | 9e-04 |
| >pdb|1Z0F|A Chain A, Gdp-Bound Rab14 Gtpase Length = 179 | Back alignment and structure |
|
| >pdb|4DRZ|A Chain A, Crystal Structure Of Human Rab14 Length = 196 | Back alignment and structure |
| >pdb|1YU9|A Chain A, Gppnhp-Bound Rab4a Length = 175 | Back alignment and structure |
| >pdb|2BMD|A Chain A, High Resolution Structure Of Gdp-Bound Human Rab4a Length = 186 | Back alignment and structure |
| >pdb|2O52|A Chain A, Crystal Structure Of Human Rab4b In Complex With Gdp Length = 200 | Back alignment and structure |
| >pdb|1Z0K|A Chain A, Structure Of Gtp-Bound Rab4q67l Gtpase In Complex With The Central Rab Binding Domain Of Rabenosyn-5 Length = 172 | Back alignment and structure |
| >pdb|1Z0A|A Chain A, Gdp-Bound Rab2a Gtpase Length = 174 | Back alignment and structure |
| >pdb|2A5J|A Chain A, Crystal Structure Of Human Rab2b Length = 191 | Back alignment and structure |
| >pdb|3CPJ|B Chain B, Crystal Structure Of Ypt31 In Complex With Yeast Rab-Gdi Length = 223 | Back alignment and structure |
| >pdb|1G16|A Chain A, Crystal Structure Of Sec4-Gdp Length = 170 | Back alignment and structure |
| >pdb|1G17|A Chain A, Crystal Structure Of Sec4-Guanosine-5'-(Beta,Gamma)- Imidotriphosphate Length = 170 | Back alignment and structure |
| >pdb|3RWM|B Chain B, Crystal Structure Of Ypt32 In Complex With Gppnhp Length = 185 | Back alignment and structure |
| >pdb|2OCY|C Chain C, Complex Of The Guanine Exchange Factor Sec2p And The Rab Gtpase Sec4p Length = 170 | Back alignment and structure |
| >pdb|1YZK|A Chain A, Gppnhp Bound Rab11 Gtpase Length = 184 | Back alignment and structure |
| >pdb|3CPH|A Chain A, Crystal Structure Of Sec4 In Complex With Rab-Gdi Length = 213 | Back alignment and structure |
| >pdb|2EQB|A Chain A, Crystal Structure Of The Rab Gtpase Sec4p, The Sec2p Gef Domain, And Phosphate Complex Length = 174 | Back alignment and structure |
| >pdb|1OIV|A Chain A, X-Ray Structure Of The Small G Protein Rab11a In Complex With Gdp Length = 191 | Back alignment and structure |
| >pdb|2F9L|A Chain A, 3d Structure Of Inactive Human Rab11b Gtpase Length = 199 | Back alignment and structure |
| >pdb|2D7C|A Chain A, Crystal Structure Of Human Rab11 In Complex With Fip3 Rab- Binding Domain Length = 167 | Back alignment and structure |
| >pdb|2HV8|A Chain A, Crystal Structure Of Gtp-Bound Rab11 In Complex With Fip3 Length = 172 | Back alignment and structure |
| >pdb|2GZD|A Chain A, Crystal Structure Of Rab11 In Complex With Rab11-Fip2 Length = 173 | Back alignment and structure |
| >pdb|2FU5|C Chain C, Structure Of Rab8 In Complex With Mss4 Length = 183 | Back alignment and structure |
| >pdb|1OIW|A Chain A, X-ray Structure Of The Small G Protein Rab11a In Complex With Gtpgammas Length = 191 | Back alignment and structure |
| >pdb|3QBT|A Chain A, Crystal Structure Of Ocrl1 540-678 In Complex With Rab8a:gppnhp Length = 174 | Back alignment and structure |
| >pdb|3BFK|A Chain A, Crystal Structure Of Plasmodium Falciparum Rab11a In Complex With Gdp Length = 181 | Back alignment and structure |
| >pdb|4FMD|F Chain F, Espg-Rab1 Complex Structure At 3.05 A Length = 164 | Back alignment and structure |
| >pdb|4FMB|B Chain B, Vira-Rab1 Complex Structure Length = 171 | Back alignment and structure |
| >pdb|4FMC|B Chain B, Espg-Rab1 Complex Length = 171 | Back alignment and structure |
| >pdb|3JZA|A Chain A, Crystal Structure Of Human Rab1b In Complex With The Gef Domain Of DrraSIDM FROM LEGIONELLA PNEUMOPHILA Length = 175 | Back alignment and structure |
| >pdb|4I1O|A Chain A, Crystal Structure Of The Legionella Pneumophila Gap Domain Of Lepb In Complex With Rab1b Bound To Gdp And Bef3 Length = 181 | Back alignment and structure |
| >pdb|4FMC|F Chain F, Espg-Rab1 Complex Length = 117 | Back alignment and structure |
| >pdb|3TKL|A Chain A, Crystal Structure Of The Gtp-Bound Rab1a In Complex With The Coiled- Coil Domain Of Lida From Legionella Pneumophila Length = 196 | Back alignment and structure |
| >pdb|2WWX|A Chain A, Crystal Structure Of The SidmDRRA(GEFGDF DOMAIN)-Rab1 (Gtpase Domain) Complex Length = 175 | Back alignment and structure |
| >pdb|3L0I|B Chain B, Complex Structure Of Sidm/drra With The Wild Type Rab1 Length = 199 | Back alignment and structure |
| >pdb|2FOL|A Chain A, Crystal Structure Of Human Rab1a In Complex With Gdp Length = 191 | Back alignment and structure |
| >pdb|3SFV|A Chain A, Crystal Structure Of The Gdp-Bound Rab1a S25n Mutant In Complex With The Coiled-Coil Domain Of Lida From Legionella Pneumophila Length = 181 | Back alignment and structure |
| >pdb|1UKV|Y Chain Y, Structure Of Rabgdp-Dissociation Inhibitor In Complex With Prenylated Ypt1 Gtpase Length = 206 | Back alignment and structure |
| >pdb|2BCG|Y Chain Y, Structure Of Doubly Prenylated Ypt1:gdi Complex Length = 206 | Back alignment and structure |
| >pdb|3TW8|B Chain B, Gef Domain Of Dennd 1b In Complex With Rab Gtpase Rab35 Length = 181 | Back alignment and structure |
| >pdb|1YZN|A Chain A, Gppnhp-Bound Ypt1p Gtpase Length = 185 | Back alignment and structure |
| >pdb|2EW1|A Chain A, Crystal Structure Of Rab30 In Complex With A Gtp Analogue Length = 201 | Back alignment and structure |
| >pdb|1X3S|A Chain A, Crystal Structure Of Human Rab18 In Complex With Gppnhp Length = 195 | Back alignment and structure |
| >pdb|2RHD|A Chain A, Crystal Structure Of Cryptosporidium Parvum Small Gtpase Rab1a Length = 175 | Back alignment and structure |
| >pdb|3TSO|A Chain A, Structure Of The Cancer Associated Rab25 Protein In Complex With Fip2 Length = 178 | Back alignment and structure |
| >pdb|2OIL|A Chain A, Crystal Structure Of Human Rab25 In Complex With Gdp Length = 193 | Back alignment and structure |
| >pdb|2IL1|A Chain A, Crystal Structure Of A Predicted Human Gtpase In Complex With Gdp Length = 192 | Back alignment and structure |
| >pdb|2HUP|A Chain A, Crystal Structure Of Human Rab43 In Complex With Gdp Length = 201 | Back alignment and structure |
| >pdb|2G6B|A Chain A, Crystal Structure Of Human Rab26 In Complex With A Gtp Analogue Length = 180 | Back alignment and structure |
| >pdb|2GF9|A Chain A, Crystal Structure Of Human Rab3d In Complex With Gdp Length = 189 | Back alignment and structure |
| >pdb|1YVD|A Chain A, Gppnhp-Bound Rab22 Gtpase Length = 169 | Back alignment and structure |
| >pdb|3DZ8|A Chain A, Crystal Structure Of Human Rab3b Gtpase Bound With Gdp Length = 191 | Back alignment and structure |
| >pdb|3RAB|A Chain A, Gppnhp-bound Rab3a At 2.0 A Resolution Length = 169 | Back alignment and structure |
| >pdb|1Z0J|A Chain A, Structure Of Gtp-Bound Rab22q64l Gtpase In Complex With The Minimal Rab Binding Domain Of Rabenosyn-5 Length = 170 | Back alignment and structure |
| >pdb|2OCB|A Chain A, Crystal Structure Of Human Rab9b In Complex With A Gtp Analogue Length = 180 | Back alignment and structure |
| >pdb|2P5S|A Chain A, Rab Domain Of Human Rasef In Complex With Gdp Length = 199 | Back alignment and structure |
| >pdb|1YZL|A Chain A, Gppnhp-Bound Rab9 Gtpase Length = 179 | Back alignment and structure |
| >pdb|1WMS|A Chain A, High Resolution Crystal Structure Of Human Rab9 Gtpase: A Novel Antiviral Drug Target Length = 177 | Back alignment and structure |
| >pdb|1S8F|A Chain A, Crystal Structure Of Rab9 Complexed To Gdp Reveals A Dimer With An Active Conformation Of Switch Ii Length = 177 | Back alignment and structure |
| >pdb|1ZBD|A Chain A, Structural Basis Of Rab Effector Specificity: Crystal Structure Of The Small G Protein Rab3a Complexed With The Effector Domain Of Rabphilin-3a Length = 203 | Back alignment and structure |
| >pdb|2EFC|B Chain B, Ara7-GdpATVPS9A Length = 181 | Back alignment and structure |
| >pdb|1Z06|A Chain A, Gppnhp-Bound Rab33 Gtpase Length = 189 | Back alignment and structure |
| >pdb|2G77|B Chain B, Crystal Structure Of Gyp1 Tbc Domain In Complex With Rab33 Gtpase Bound To Gdp And Alf3 Length = 198 | Back alignment and structure |
| >pdb|1KY2|A Chain A, Gppnhp-Bound Ypt7p At 1.6 A Resolution Length = 182 | Back alignment and structure |
| >pdb|1Z22|A Chain A, Gdp-Bound Rab23 Gtpase Crystallized In C222(1) Space Group Length = 168 | Back alignment and structure |
| >pdb|1VG1|A Chain A, Gdp-bound Rab7 Length = 185 | Back alignment and structure |
| >pdb|1VG0|B Chain B, The Crystal Structures Of The Rep-1 Protein In Complex With Monoprenylated Rab7 Protein Length = 207 | Back alignment and structure |
| >pdb|3LAW|A Chain A, Structure Of Gtp-Bound L129f Mutant Rab7 Length = 207 | Back alignment and structure |
| >pdb|2F7S|A Chain A, The Crystal Structure Of Human Rab27b Bound To Gdp Length = 217 | Back alignment and structure |
| >pdb|1YZQ|A Chain A, Gppnhp-Bound Rab6 Gtpase Length = 170 | Back alignment and structure |
| >pdb|1T91|A Chain A, Crystal Structure Of Human Small Gtpase Rab7(Gtp) Length = 207 | Back alignment and structure |
| >pdb|2FG5|A Chain A, Crystal Structure Of Human Rab31 In Complex With A Gtp Analogue Length = 192 | Back alignment and structure |
| >pdb|2IF0|A Chain A, Crystal Structure Of Mouse Rab27b Bound To Gdp In Monoclinic Space Group Length = 200 | Back alignment and structure |
| >pdb|2IEY|A Chain A, Crystal Structure Of Mouse Rab27b Bound To Gdp In Hexagonal Space Group Length = 195 | Back alignment and structure |
| >pdb|1EK0|A Chain A, Gppnhp-Bound Ypt51 At 1.48 A Resolution Length = 170 | Back alignment and structure |
| >pdb|2ZET|A Chain A, Crystal Structure Of The Small Gtpase Rab27b Complexed With The Slp Homology Domain Of Slac2-AMELANOPHILIN Length = 203 | Back alignment and structure |
| >pdb|3BC1|A Chain A, Crystal Structure Of The Complex Rab27a-slp2a Length = 195 | Back alignment and structure |
| >pdb|2IEZ|A Chain A, Crystal Structure Of Mouse Rab27b Bound To Gdp In Monoclinic Space Group Length = 220 | Back alignment and structure |
| >pdb|1D5C|A Chain A, Crystal Structure Of Plasmodium Falciparum Rab6 Complexed With Gdp Length = 162 | Back alignment and structure |
| >pdb|2GIL|A Chain A, Structure Of The Extremely Slow Gtpase Rab6a In The Gtp Bound Form At 1.8 Resolution Length = 162 | Back alignment and structure |
| >pdb|1Z08|A Chain A, Gppnhp-Bound Rab21 Q53g Mutant Gtpase Length = 170 | Back alignment and structure |
| >pdb|4DKX|A Chain A, Crystal Structure Of The Rab 6a'(Q72l) Length = 216 | Back alignment and structure |
| >pdb|2FE4|A Chain A, The Crystal Structure Of Human Neuronal Rab6b In Its Inactive Gdp-Bound Form Length = 171 | Back alignment and structure |
| >pdb|1TU4|A Chain A, Crystal Structure Of Rab5-Gdp Complex Length = 171 | Back alignment and structure |
| >pdb|1HUQ|A Chain A, 1.8a Crystal Structure Of The Monomeric Gtpase Rab5c (Mouse) Length = 164 | Back alignment and structure |
| >pdb|1TU3|A Chain A, Crystal Structure Of Rab5 Complex With Rabaptin5 C-Terminal Domain Length = 171 | Back alignment and structure |
| >pdb|1N6H|A Chain A, Crystal Structure Of Human Rab5a Length = 170 | Back alignment and structure |
| >pdb|2Y8E|A Chain A, Crystal Structure Of D. Melanogaster Rab6 Gtpase Bound To Gmppnp Length = 179 | Back alignment and structure |
| >pdb|2HEI|A Chain A, Crystal Structure Of Human Rab5b In Complex With Gdp Length = 179 | Back alignment and structure |
| >pdb|1N6O|A Chain A, Crystal Structure Of Human Rab5a A30k Mutant Complex With Gppnhp Length = 170 | Back alignment and structure |
| >pdb|1N6I|A Chain A, Crystal Structure Of Human Rab5a A30p Mutant Complex With Gdp Length = 170 | Back alignment and structure |
| >pdb|1YZU|A Chain A, Gppnhp-Bound Rab21 Gtpase At 2.50 A Resolution Length = 170 | Back alignment and structure |
| >pdb|1YZT|A Chain A, Gppnhp-Bound Rab21 Gtpase At 2.05 A Resolution Length = 184 | Back alignment and structure |
| >pdb|1N6P|A Chain A, Crystal Structure Of Human Rab5a A30e Mutant Complex With Gppnhp Length = 170 | Back alignment and structure |
| >pdb|1N6N|A Chain A, Crystal Structure Of Human Rab5a A30r Mutant Complex With Gppnhp Length = 170 | Back alignment and structure |
| >pdb|3CWZ|A Chain A, Strucure Of Rab6(Gtp)-R6ip1 Complex Length = 188 | Back alignment and structure |
| >pdb|1N6R|A Chain A, Crystal Structure Of Human Rab5a A30l Mutant Complex With Gppnhp Length = 170 | Back alignment and structure |
| >pdb|3BBP|A Chain A, Rab6-Gtp:gcc185 Rab Binding Domain Complex Length = 211 | Back alignment and structure |
| >pdb|1Z07|A Chain A, Gppnhp-Bound Rab5c G55q Mutant Gtpase Length = 166 | Back alignment and structure |
| >pdb|1Z0D|A Chain A, Gdp-bound Rab5c Gtpase Length = 167 | Back alignment and structure |
| >pdb|3MJH|A Chain A, Crystal Structure Of Human Rab5a In Complex With The C2h2 Zinc Finger Of Eea1 Length = 168 | Back alignment and structure |
| >pdb|4DJT|A Chain A, Crystal Structure Of A Nuclear Gtp-Binding Protein From Encephalitozoon Cuniculi Bound To Gdp-Mg2+ Length = 218 | Back alignment and structure |
| >pdb|3CLV|A Chain A, Crystal Structure Of Rab5a From Plasmodium Falciparum, Pfb0500c Length = 208 | Back alignment and structure |
| >pdb|3BWD|D Chain D, Crystal Structure Of The Plant Rho Protein Rop5 Length = 182 | Back alignment and structure |
| >pdb|2A78|A Chain A, Crystal Structure Of The C3bot-Rala Complex Reveals A Novel Type Of Action Of A Bacterial Exoenzyme Length = 187 | Back alignment and structure |
| >pdb|1UAD|A Chain A, Crystal Structure Of The Rala-gppnhp-sec5 Ral-binding Domain Complex Length = 175 | Back alignment and structure |
| >pdb|1U8Y|A Chain A, Crystal Structures Of Ral-Gppnhp And Ral-Gdp Reveal Two Novel Binding Sites That Are Also Present In Ras And Rap Length = 168 | Back alignment and structure |
| >pdb|2BOV|A Chain A, Molecular Recognition Of An Adp-Ribosylating Clostridium Botulinum C3 Exoenzyme By Rala Gtpase Length = 206 | Back alignment and structure |
| >pdb|2NTY|C Chain C, Rop4-Gdp-Prone8 Length = 180 | Back alignment and structure |
| >pdb|2KWI|A Chain A, Ralb-Rlip76 (Ralbp1) Complex Length = 178 | Back alignment and structure |
| >pdb|2KE5|A Chain A, Solution Structure And Dynamics Of The Small Gtpase Ralb In Its Active Conformation: Significance For Effector Protein Binding Length = 174 | Back alignment and structure |
| >pdb|2WBL|C Chain C, Three-Dimensional Structure Of A Binary Rop-Prone Complex Length = 180 | Back alignment and structure |
| >pdb|2J0V|A Chain A, The Crystal Structure Of Arabidopsis Thaliana Rac7-Rop9: The First Ras Superfamily Gtpase From The Plant Kingdom Length = 212 | Back alignment and structure |
| >pdb|1ZC3|A Chain A, Crystal Structure Of The Ral-Binding Domain Of Exo84 In Complex With The Active Rala Length = 175 | Back alignment and structure |
| >pdb|1BYU|A Chain A, Canine Gdp-Ran Length = 216 | Back alignment and structure |
| >pdb|2BKU|A Chain A, Kap95p:rangtp Complex Length = 177 | Back alignment and structure |
| >pdb|3SEA|A Chain A, Structure Of Rheb-Y35a Mutant In Gdp- And Gmppnp-Bound Forms Length = 167 | Back alignment and structure |
| >pdb|1WA5|A Chain A, Crystal Structure Of The Exportin Cse1p Complexed With Its Cargo (Kap60p) And Rangtp Length = 176 | Back alignment and structure |
| >pdb|1RRP|A Chain A, Structure Of The Ran-Gppnhp-Ranbd1 Complex Length = 204 | Back alignment and structure |
| >pdb|1QG2|A Chain A, Canine Gdp-Ran R76e Mutant Length = 216 | Back alignment and structure |
| >pdb|3EA5|A Chain A, Kap95p Binding Induces The Switch Loops Of Rangdp To Adopt The Gtp- Bound Conformation: Implications For Nuclear Import Complex Assembly Dynamics Length = 216 | Back alignment and structure |
| >pdb|1A2K|C Chain C, Gdpran-Ntf2 Complex Length = 216 | Back alignment and structure |
| >pdb|3GJ0|A Chain A, Crystal Structure Of Human Rangdp Length = 221 | Back alignment and structure |
| >pdb|3T5G|A Chain A, Structure Of Fully Modified Farnesylated Rheb In Complex With Pde6d Length = 181 | Back alignment and structure |
| >pdb|1XTQ|A Chain A, Structure Of Small Gtpase Human Rheb In Complex With Gdp Length = 177 | Back alignment and structure |
| >pdb|2L0X|A Chain A, Solution Structure Of The 21 Kda Gtpase Rheb Bound To Gdp Length = 169 | Back alignment and structure |
| >pdb|1QBK|C Chain C, Structure Of The Karyopherin Beta2-ran Gppnhp Nuclear Transport Complex Length = 216 | Back alignment and structure |
| >pdb|1QG4|A Chain A, Canine Gdp-Ran F72y Mutant Length = 216 | Back alignment and structure |
| >pdb|1MR3|F Chain F, Saccharomyces Cerevisiae Adp-Ribosylation Factor 2 (Scarf2) Complexed With Gdp-3'p At 1.6a Resolution Length = 181 | Back alignment and structure |
| >pdb|2HXS|A Chain A, Crystal Structure Of Rab28a Gtpase In The Inactive (Gdp-3'p- Bound) Form Length = 178 | Back alignment and structure |
| >pdb|3GJ4|A Chain A, Crystal Structure Of Human Rangdp-Nup153znf3 Complex Length = 221 | Back alignment and structure |
| >pdb|2K5U|A Chain A, Solution Structure Of Myirstoylated Yeast Arf1 Protein, Gdp- Bound Length = 181 | Back alignment and structure |
| >pdb|3TJZ|A Chain A, Crystal Structure Of Arf1 Bound To The GammaZETA-Cop Core Complex Length = 164 | Back alignment and structure |
| >pdb|3NC1|C Chain C, Crystal Structure Of The Crm1-Rangtp Complex Length = 182 | Back alignment and structure |
| >pdb|3NBY|C Chain C, Crystal Structure Of The Pki Nes-Crm1-Rangtp Nuclear Export Complex Length = 176 | Back alignment and structure |
| >pdb|421P|A Chain A, Three-Dimensional Structures Of H-Ras P21 Mutants: Molecular Basis For Their Inability To Function As Signal Switch Molecules Length = 166 | Back alignment and structure |
| >pdb|3RAN|A Chain A, Canine Gdp-Ran Q69l Mutant Length = 216 | Back alignment and structure |
| >pdb|2X19|A Chain A, Crystal Structure Of Importin13 - Rangtp Complex Length = 172 | Back alignment and structure |
| >pdb|1CLU|A Chain A, H-Ras Complexed With Diaminobenzophenone-Beta,Gamma-Imido- Gtp Length = 166 | Back alignment and structure |
| >pdb|1JAH|A Chain A, H-Ras P21 Protein Mutant G12p, Complexed With Guanosine-5'- [beta,Gamma-Methylene] Triphosphate And Magnesium Length = 166 | Back alignment and structure |
| >pdb|3ICQ|B Chain B, Karyopherin Nuclear State Length = 171 | Back alignment and structure |
| >pdb|1AGP|A Chain A, Three-Dimensional Structures And Properties Of A Transforming And A Nontransforming Gly-12 Mutant Of P21-H-Ras Length = 166 | Back alignment and structure |
| >pdb|4DSO|A Chain A, Small-Molecule Ligands Bind To A Distinct Pocket In Ras And Inhibit Sos-Mediated Nucleotide Exchange Activity Length = 189 | Back alignment and structure |
| >pdb|4EPR|A Chain A, Discovery Of Small Molecules That Bind To K-Ras And Inhibit Sos- Mediated Activation Length = 170 | Back alignment and structure |
| >pdb|3M1I|A Chain A, Crystal Structure Of Yeast Crm1 (Xpo1p) In Complex With Yeas (Yrb1p) And Yeast Rangtp (Gsp1pgtp) Length = 219 | Back alignment and structure |
| >pdb|1DPF|A Chain A, Crystal Structure Of A Mg-Free Form Of Rhoa Complexed With Gdp Length = 180 | Back alignment and structure |
| >pdb|1CXZ|A Chain A, Crystal Structure Of Human Rhoa Complexed With The Effector Domain Of The Protein Kinase PknPRK1 Length = 182 | Back alignment and structure |
| >pdb|2YC2|C Chain C, Intraflagellar Transport Complex 25-27 From Chlamydomonas Length = 208 | Back alignment and structure |
| >pdb|2FN4|A Chain A, The Crystal Structure Of Human Ras-Related Protein, Rras, In The Gdp- Bound State Length = 181 | Back alignment and structure |
| >pdb|2FV8|A Chain A, The Crystal Structure Of Rhob In The Gdp-Bound State Length = 207 | Back alignment and structure |
| >pdb|2CL0|X Chain X, Crystal Structure Analysis Of A Fluorescent Form Of H-Ras P21 In Complex With Gppnhp Length = 166 | Back alignment and structure |
| >pdb|2J1L|A Chain A, Crystal Structure Of Human Rho-Related Gtp-Binding Protein Rhod Length = 214 | Back alignment and structure |
| >pdb|3KZ1|E Chain E, Crystal Structure Of The Complex Of Pdz-Rhogef DhPH DOMAINS WITH GTP- Gamma-S Activated Rhoa Length = 182 | Back alignment and structure |
| >pdb|3TVD|A Chain A, Crystal Structure Of Mouse Rhoa-Gtp Complex Length = 193 | Back alignment and structure |
| >pdb|1S1C|A Chain A, Crystal Structure Of The Complex Between The Human Rhoa And Rho-Binding Domain Of Human Rocki Length = 183 | Back alignment and structure |
| >pdb|3LW8|A Chain A, Shigella Ipgb2 In Complex With Human Rhoa, Gdp And Mg2+ (Complex A) Length = 185 | Back alignment and structure |
| >pdb|1X86|B Chain B, Crystal Structure Of The DhPH DOMAINS OF LEUKEMIA-Associated Rhogef In Complex With Rhoa Length = 196 | Back alignment and structure |
| >pdb|3B13|B Chain B, Crystal Structure Of The Dhr-2 Domain Of Dock2 In Complex With Rac1 (T17n Mutant) Length = 184 | Back alignment and structure |
| >pdb|4F38|A Chain A, Crystal Structure Of Geranylgeranylated Rhoa In Complex With Rhogdi In Its Active Gppnhp-Bound Form Length = 195 | Back alignment and structure |
| >pdb|2YIN|C Chain C, Structure Of The Complex Between Dock2 And Rac1. Length = 196 | Back alignment and structure |
| >pdb|2GCN|A Chain A, Crystal Structure Of The Human Rhoc-Gdp Complex Length = 201 | Back alignment and structure |
| >pdb|3SBD|A Chain A, Crystal Structure Of Rac1 P29s Mutant Length = 187 | Back alignment and structure |
| >pdb|1FOE|B Chain B, Crystal Structure Of Rac1 In Complex With The Guanine Nucleotide Exchange Region Of Tiam1 Length = 177 | Back alignment and structure |
| >pdb|2FJU|A Chain A, Activated Rac1 Bound To Its Effector Phospholipase C Beta 2 Length = 178 | Back alignment and structure |
| >pdb|2IC5|A Chain A, Crystal Structure Of Human Rac3 Grown In The Presence Of Gpp(Nh)p. Length = 180 | Back alignment and structure |
| >pdb|1LB1|B Chain B, Crystal Structure Of The Dbl And Pleckstrin Homology Domains Of Dbs In Complex With Rhoa Length = 192 | Back alignment and structure |
| >pdb|2G0N|A Chain A, The Crystal Structure Of The Human Rac3 In Complex With Gdp And Chloride Length = 179 | Back alignment and structure |
| >pdb|2GCO|A Chain A, Crystal Structure Of The Human Rhoc-gppnhp Complex Length = 201 | Back alignment and structure |
| >pdb|1M7B|A Chain A, Crystal Structure Of Rnd3RHOE: FUNCTIONAL IMPLICATIONS Length = 184 | Back alignment and structure |
| >pdb|3SUA|A Chain A, Crystal Structure Of The Intracellular Domain Of Plexin-B1 In Complex With Rac1 Length = 184 | Back alignment and structure |
| >pdb|1RYF|A Chain A, Alternative Splicing Of Rac1 Generates Rac1b, A Self-Activating Gtpase Length = 203 | Back alignment and structure |
| >pdb|2H7V|A Chain A, Co-crystal Structure Of Ypka-rac1 Length = 188 | Back alignment and structure |
| >pdb|3TH5|A Chain A, Crystal Structure Of Wild-Type Rac1 Length = 204 | Back alignment and structure |
| >pdb|1HE1|C Chain C, Crystal Structure Of The Complex Between The Gap Domain Of The Pseudomonas Aeruginosa Exos Toxin And Human Rac Length = 176 | Back alignment and structure |
| >pdb|1MH1|A Chain A, Small G-Protein Length = 186 | Back alignment and structure |
| >pdb|4DXA|A Chain A, Co-Crystal Structure Of Rap1 In Complex With Krit1 Length = 169 | Back alignment and structure |
| >pdb|1GWN|A Chain A, The Crystal Structure Of The Core Domain Of RhoeRND3 - A Constitutively Activated Small G Protein Length = 205 | Back alignment and structure |
| >pdb|2C2H|A Chain A, Crystal Structure Of The Human Rac3 In Complex With Gdp Length = 192 | Back alignment and structure |
| >pdb|2V55|B Chain B, Mechanism Of Multi-site Phosphorylation From A Rock-i:rhoe Complex Structure Length = 200 | Back alignment and structure |
| >pdb|1G4U|R Chain R, Crystal Structure Of The Salmonella Tyrosine Phosphatase And Gtpase Activating Protein Sptp Bound To Rac1 Length = 184 | Back alignment and structure |
| >pdb|2VRW|A Chain A, Critical Structural Role For The Ph And C1 Domains Of The Vav1 Exchange Factor Length = 184 | Back alignment and structure |
| >pdb|1HH4|A Chain A, Rac1-Rhogdi Complex Involved In Nadph Oxidase Activation Length = 192 | Back alignment and structure |
| >pdb|2W2V|A Chain A, Rac2 (G12v) In Complex With Gtpgs Length = 184 | Back alignment and structure |
| >pdb|1I4D|D Chain D, Crystal Structure Analysis Of Rac1-Gdp Complexed With Arfaptin (P21) Length = 192 | Back alignment and structure |
| >pdb|2W2T|A Chain A, Rac2 (G12v) In Complex With Gdp Length = 185 | Back alignment and structure |
| >pdb|1X1R|A Chain A, Crystal Structure Of M-Ras In Complex With Gdp Length = 178 | Back alignment and structure |
| >pdb|1A4R|B Chain B, G12v Mutant Of Human Placental Cdc42 Gtpase In The Gdp Form Length = 191 | Back alignment and structure |
| >pdb|3BRW|D Chain D, Structure Of The Rap-Rapgap Complex Length = 167 | Back alignment and structure |
| >pdb|2A5D|A Chain A, Structural Basis For The Activation Of Cholera Toxin By Human Arf6-Gtp Length = 175 | Back alignment and structure |
| >pdb|3N5C|A Chain A, Crystal Structure Of Arf6delta13 Complexed With Gdp Length = 162 | Back alignment and structure |
| >pdb|3DOE|A Chain A, Complex Of Arl2 And Bart, Crystal Form 1 Length = 192 | Back alignment and structure |
| >pdb|1E0S|A Chain A, Small G Protein Arf6-Gdp Length = 174 | Back alignment and structure |
| >pdb|4FME|C Chain C, Espg-Rab1-Arf6 Complex Length = 160 | Back alignment and structure |
| >pdb|1GUA|A Chain A, Human Rap1a, Residues 1-167, Double Mutant (E30d,K31e) Complexed With Gppnhp And The Ras-Binding-Domain Of Human C-Raf1, Residues 51-131 Length = 167 | Back alignment and structure |
| >pdb|3PCR|B Chain B, Structure Of Espg-Arf6 Complex Length = 162 | Back alignment and structure |
| >pdb|1KSH|A Chain A, Complex Of Arl2 And Pde Delta, Crystal Form 2 (Native) Length = 186 | Back alignment and structure |
| >pdb|1KSJ|A Chain A, Complex Of Arl2 And Pde Delta, Crystal Form 2 (Semet) Length = 186 | Back alignment and structure |
| >pdb|4GZM|A Chain A, Crystal Structure Of Rac1 F28l Mutant Length = 204 | Back alignment and structure |
| >pdb|1KSG|A Chain A, Complex Of Arl2 And Pde Delta, Crystal Form 1 Length = 186 | Back alignment and structure |
| >pdb|1DS6|A Chain A, Crystal Structure Of A Rac-Rhogdi Complex Length = 192 | Back alignment and structure |
| >pdb|2ERY|A Chain A, The Crystal Structure Of The Ras Related Protein Rras2 (Rras2) In The Gdp Bound State Length = 172 | Back alignment and structure |
| >pdb|3LVR|E Chain E, The Crystal Structure Of Asap3 In Complex With Arf6 In Trans State Soaked With Calcium Length = 497 | Back alignment and structure |
| >pdb|4GZL|A Chain A, Crystal Structure Of Rac1 Q61l Mutant Length = 204 | Back alignment and structure |
| >pdb|3GCG|A Chain A, Crystal Structure Of Map And Cdc42 Complex Length = 182 | Back alignment and structure |
| >pdb|1GZS|A Chain A, Crystal Structure Of The Complex Between The Gef Domain Of The Salmonella Typhimurium Sope Toxin And Human Cdc42 Length = 180 | Back alignment and structure |
| >pdb|3EG5|A Chain A, Crystal Structure Of Mdia1-Tsh Gbd-Fh3 In Complex With Cdc42-Gmppnp Length = 178 | Back alignment and structure |
| >pdb|3MSX|A Chain A, Crystal Structure Of Rhoa.Gdp.Mgf3 In Complex With Gap Domain Of Arhgap20 Length = 180 | Back alignment and structure |
| >pdb|1AM4|D Chain D, Complex Between Cdc42hs.Gmppnp And P50 Rhogap (H. Sapiens) Length = 177 | Back alignment and structure |
| >pdb|1EES|A Chain A, Solution Structure Of Cdc42hs Complexed With A Peptide Derived From P-21 Activated Kinase, Nmr, 20 Structures Length = 178 | Back alignment and structure |
| >pdb|1FZQ|A Chain A, Crystal Structure Of Murine Arl3-Gdp Length = 181 | Back alignment and structure |
| >pdb|2C5L|A Chain A, Structure Of Plc Epsilon Ras Association Domain With Hras Length = 173 | Back alignment and structure |
| >pdb|4GOJ|A Chain A, The Crystal Structure Of Full Length Arl3gppnhp In Complex With Unc119a Length = 189 | Back alignment and structure |
| >pdb|1XCG|B Chain B, Crystal Structure Of Human Rhoa In Complex With DhPH Fragment Of Pdzrhogef Length = 178 | Back alignment and structure |
| >pdb|3RYT|C Chain C, The Plexin A1 Intracellular Region In Complex With Rac1 Length = 180 | Back alignment and structure |
| >pdb|1TX4|B Chain B, RhoRHOGAPGDP(DOT)ALF4 COMPLEX Length = 177 | Back alignment and structure |
| >pdb|1CEE|A Chain A, Solution Structure Of Cdc42 In Complex With The Gtpase Binding Domain Of Wasp Length = 179 | Back alignment and structure |
| >pdb|3V4F|A Chain A, H-Ras Peg 400CACL2, ORDERED OFF Length = 166 | Back alignment and structure |
| >pdb|3VHL|B Chain B, Crystal Structure Of The Dhr-2 Domain Of Dock8 In Complex With Cdc42 (T17n Mutant) Length = 195 | Back alignment and structure |
| >pdb|1OW3|B Chain B, Crystal Structure Of Rhoa.Gdp.Mgf3-In Complex With Rhogap Length = 193 | Back alignment and structure |
| >pdb|3PIR|A Chain A, Crystal Structure Of M-Rasd41e In Complex With Gppnhp (Type 1) Length = 183 | Back alignment and structure |
| >pdb|1C1Y|A Chain A, Crystal Structure Of Rap.Gmppnp In Complex With The Ras- Binding-Domain Of C-Raf1 Kinase (Rafrbd) Length = 167 | Back alignment and structure |
| >pdb|4DID|A Chain A, Crystal Structure Of Salmonella Effector N-Terminal Domain Sopb In Complex With Cdc42 Length = 193 | Back alignment and structure |
| >pdb|4Q21|A Chain A, Molecular Switch For Signal Transduction: Structural Differences Between Active And Inactive Forms Of Protooncogenic Ras Proteins Length = 189 | Back alignment and structure |
| >pdb|221P|A Chain A, Three-Dimensional Structures Of H-Ras P21 Mutants: Molecular Basis For Their Inability To Function As Signal Switch Molecules Length = 166 | Back alignment and structure |
| >pdb|1AJE|A Chain A, Cdc42 From Human, Nmr, 20 Structures Length = 194 | Back alignment and structure |
| >pdb|4EFM|A Chain A, Crystal Structure Of H-Ras G12v In Complex With Gppnhp (State 1) Length = 171 | Back alignment and structure |
| >pdb|4EFL|A Chain A, Crystal Structure Of H-Ras Wt In Complex With Gppnhp (State 1) Length = 171 | Back alignment and structure |
| >pdb|1I4T|D Chain D, Crystal Structure Analysis Of Rac1-Gmppnp In Complex With Arfaptin Length = 192 | Back alignment and structure |
| >pdb|2ODB|A Chain A, The Crystal Structure Of Human Cdc42 In Complex With The Crib Domain Of Human P21-Activated Kinase 6 (Pak6) Length = 192 | Back alignment and structure |
| >pdb|1CC0|A Chain A, Crystal Structure Of The Rhoa.Gdp-Rhogdi Complex Length = 190 | Back alignment and structure |
| >pdb|1KZ7|B Chain B, Crystal Structure Of The DhPH FRAGMENT OF MURINE DBS IN Complex With The Placental Isoform Of Human Cdc42 Length = 188 | Back alignment and structure |
| >pdb|1WQ1|R Chain R, Ras-Rasgap Complex Length = 166 | Back alignment and structure |
| >pdb|1GRN|A Chain A, Crystal Structure Of The Cdc42CDC42GAPALF3 COMPLEX. Length = 191 | Back alignment and structure |
| >pdb|1RVD|A Chain A, H-Ras Complexed With Diaminobenzophenone-Beta,Gamma-Imido- Gtp Length = 166 | Back alignment and structure |
| >pdb|2X1V|A Chain A, Crystal Structure Of The Activating H-Ras I163f Mutant In Costello Syndrome, Bound To Mg-Gdp Length = 166 | Back alignment and structure |
| >pdb|2DFK|B Chain B, Crystal Structure Of The Cdc42-Collybistin Ii Complex Length = 194 | Back alignment and structure |
| >pdb|1DOA|A Chain A, Structure Of The Rho Family Gtp-Binding Protein Cdc42 In Complex With The Multifunctional Regulator Rhogdi Length = 191 | Back alignment and structure |
| >pdb|6Q21|A Chain A, Molecular Switch For Signal Transduction: Structural Differences Between Active And Inactive Forms Of Protooncogenic Ras Proteins Length = 171 | Back alignment and structure |
| >pdb|2Q21|A Chain A, Crystal Structures At 2.2 Angstroms Resolution Of The Catalytic Domains Of Normal Ras Protein And An Oncogenic Mutant Complexed With Gsp Length = 171 | Back alignment and structure |
| >pdb|1E96|A Chain A, Structure Of The RacP67PHOX COMPLEX Length = 192 | Back alignment and structure |
| >pdb|3REF|B Chain B, Crystal Structure Of Ehrho1 Bound To Gdp And Magnesium Length = 194 | Back alignment and structure |
| >pdb|4DVG|A Chain A, Crystal Structure Of E. Histolytica Formin1 Bound To Ehrho1-Gtpgammas Length = 188 | Back alignment and structure |
| >pdb|3K9N|A Chain A, Allosteric Modulation Of H-Ras Gtpase Length = 166 | Back alignment and structure |
| >pdb|3BH7|A Chain A, Crystal Structure Of The Rp2-Arl3 Complex Bound To Gdp-Alf4 Length = 164 | Back alignment and structure |
| >pdb|2QRZ|A Chain A, Cdc42 Bound To Gmp-Pcp: Induced Fit By Effector Is Required Length = 189 | Back alignment and structure |
| >pdb|3CON|A Chain A, Crystal Structure Of The Human Nras Gtpase Bound With Gdp Length = 190 | Back alignment and structure |
| >pdb|2QUZ|A Chain A, Crystal Structure Of The Activating H-Rask117r Mutant In Costello Syndrome, Bound To Mg-Gdp Length = 166 | Back alignment and structure |
| >pdb|2AL7|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 10c Length = 186 | Back alignment and structure |
| >pdb|2WM9|B Chain B, Structure Of The Complex Between Dock9 And Cdc42. Length = 190 | Back alignment and structure |
| >pdb|1Z2C|A Chain A, Crystal Structure Of Mdia1 Gbd-Fh3 In Complex With Rhoc- Gmppnp Length = 193 | Back alignment and structure |
| >pdb|3OES|A Chain A, Crystal Structure Of The Small Gtpase Rhebl1 Length = 201 | Back alignment and structure |
| >pdb|4EPX|A Chain A, Discovery Of Small Molecules That Bind To K-Ras And Inhibit Sos- Mediated Activation Length = 170 | Back alignment and structure |
| >pdb|4EPT|A Chain A, Discovery Of Small Molecules That Bind To K-Ras And Inhibit Sos- Mediated Activation Length = 170 | Back alignment and structure |
| >pdb|2WKQ|A Chain A, Structure Of A Photoactivatable Rac1 Containing The Lov2 C450a Mutant Length = 332 | Back alignment and structure |
| >pdb|2KSQ|A Chain A, The Myristoylated Yeast Arf1 In A Gtp And Bicelle Bound Conformation Length = 181 | Back alignment and structure |
| >pdb|2WKR|A Chain A, Structure Of A Photoactivatable Rac1 Containing The Lov2 C450m Mutant Length = 332 | Back alignment and structure |
| >pdb|2WKP|A Chain A, Structure Of A Photoactivatable Rac1 Containing Lov2 Wildtype Length = 332 | Back alignment and structure |
| >pdb|1Z6Y|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 5 Length = 179 | Back alignment and structure |
| >pdb|2H17|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 5 (Arl5) (Casp Target) Length = 181 | Back alignment and structure |
| >pdb|1ZJ6|A Chain A, Crystal Structure Of Human Arl5 Length = 187 | Back alignment and structure |
| >pdb|2H16|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 5 (Arl5) Length = 183 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 173 | |||
| 2o52_A | 200 | RAS-related protein RAB-4B; G-protein, GDP, struct | 1e-59 | |
| 2o52_A | 200 | RAS-related protein RAB-4B; G-protein, GDP, struct | 1e-13 | |
| 1z0f_A | 179 | RAB14, member RAS oncogene family; RAB GTPase, ves | 2e-59 | |
| 1z0f_A | 179 | RAB14, member RAS oncogene family; RAB GTPase, ves | 6e-14 | |
| 2bme_A | 186 | RAB4A, RAS-related protein RAB4A; GTP-binding prot | 6e-59 | |
| 2bme_A | 186 | RAB4A, RAS-related protein RAB4A; GTP-binding prot | 6e-13 | |
| 2a5j_A | 191 | RAS-related protein RAB-2B; GTPase, signal transdu | 3e-58 | |
| 2a5j_A | 191 | RAS-related protein RAB-2B; GTPase, signal transdu | 5e-14 | |
| 3cpj_B | 223 | GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl | 5e-58 | |
| 3cpj_B | 223 | GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl | 2e-13 | |
| 2oil_A | 193 | CATX-8, RAS-related protein RAB-25; G-protein, GDP | 6e-58 | |
| 2oil_A | 193 | CATX-8, RAS-related protein RAB-25; G-protein, GDP | 3e-13 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 8e-58 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 5e-13 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 4e-57 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 2e-12 | |
| 2hup_A | 201 | RAS-related protein RAB-43; G-protein, GDP, struct | 4e-57 | |
| 2hup_A | 201 | RAS-related protein RAB-43; G-protein, GDP, struct | 4e-12 | |
| 1x3s_A | 195 | RAS-related protein RAB-18; GTPase, GNP, structura | 9e-57 | |
| 1x3s_A | 195 | RAS-related protein RAB-18; GTPase, GNP, structura | 2e-12 | |
| 2ew1_A | 201 | RAS-related protein RAB-30; G-protein, GTP analogu | 1e-56 | |
| 2ew1_A | 201 | RAS-related protein RAB-30; G-protein, GTP analogu | 2e-12 | |
| 3cph_A | 213 | RAS-related protein SEC4; RAB GTPase, prenylation, | 1e-56 | |
| 3cph_A | 213 | RAS-related protein SEC4; RAB GTPase, prenylation, | 3e-13 | |
| 1wms_A | 177 | RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p | 2e-56 | |
| 1wms_A | 177 | RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p | 2e-12 | |
| 2il1_A | 192 | RAB12; G-protein, GDP, GTPase, predicted, structur | 2e-56 | |
| 2il1_A | 192 | RAB12; G-protein, GDP, GTPase, predicted, structur | 6e-12 | |
| 1zbd_A | 203 | Rabphilin-3A; G protein, effector, RABCDR, synapti | 2e-56 | |
| 1zbd_A | 203 | Rabphilin-3A; G protein, effector, RABCDR, synapti | 2e-12 | |
| 3tkl_A | 196 | RAS-related protein RAB-1A; vesicle trafficking, p | 4e-56 | |
| 3tkl_A | 196 | RAS-related protein RAB-1A; vesicle trafficking, p | 6e-13 | |
| 3dz8_A | 191 | RAS-related protein RAB-3B; GDP, GTPase, structura | 7e-56 | |
| 3dz8_A | 191 | RAS-related protein RAB-3B; GDP, GTPase, structura | 5e-12 | |
| 2bcg_Y | 206 | Protein YP2, GTP-binding protein YPT1; RABGTPase, | 8e-56 | |
| 2bcg_Y | 206 | Protein YP2, GTP-binding protein YPT1; RABGTPase, | 9e-12 | |
| 2fu5_C | 183 | RAS-related protein RAB-8A; MSS4:RAB8 protein comp | 2e-55 | |
| 2fu5_C | 183 | RAS-related protein RAB-8A; MSS4:RAB8 protein comp | 1e-11 | |
| 2efe_B | 181 | Small GTP-binding protein-like; GEF, GTPase, VPS9, | 3e-55 | |
| 2efe_B | 181 | Small GTP-binding protein-like; GEF, GTPase, VPS9, | 8e-12 | |
| 1z06_A | 189 | RAS-related protein RAB-33B; RAB GTPase, RAB33B GT | 4e-55 | |
| 1z06_A | 189 | RAS-related protein RAB-33B; RAB GTPase, RAB33B GT | 3e-12 | |
| 2p5s_A | 199 | RAS and EF-hand domain containing; G-protein, RAB, | 5e-55 | |
| 2p5s_A | 199 | RAS and EF-hand domain containing; G-protein, RAB, | 6e-12 | |
| 3l0i_B | 199 | RAS-related protein RAB-1A; GEF-GDF-RAB complex, G | 5e-55 | |
| 3l0i_B | 199 | RAS-related protein RAB-1A; GEF-GDF-RAB complex, G | 2e-11 | |
| 2f7s_A | 217 | C25KG, RAS-related protein RAB-27B; G-protein, str | 6e-55 | |
| 2f7s_A | 217 | C25KG, RAS-related protein RAB-27B; G-protein, str | 1e-13 | |
| 2g6b_A | 180 | RAS-related protein RAB-26; G-protein, GTP analogu | 6e-55 | |
| 2g6b_A | 180 | RAS-related protein RAB-26; G-protein, GTP analogu | 1e-12 | |
| 3tw8_B | 181 | RAS-related protein RAB-35; longin domain, RAB GTP | 6e-55 | |
| 3tw8_B | 181 | RAS-related protein RAB-35; longin domain, RAB GTP | 1e-11 | |
| 2gf9_A | 189 | RAS-related protein RAB-3D; G-protein, structural | 8e-55 | |
| 2gf9_A | 189 | RAS-related protein RAB-3D; G-protein, structural | 2e-11 | |
| 1g16_A | 170 | RAS-related protein SEC4; G protein RAB, signaling | 2e-54 | |
| 1g16_A | 170 | RAS-related protein SEC4; G protein RAB, signaling | 2e-10 | |
| 2y8e_A | 179 | RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti | 8e-54 | |
| 2y8e_A | 179 | RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti | 2e-12 | |
| 1vg8_A | 207 | RAS-related protein RAB-7; GTP-binding protein, pr | 2e-53 | |
| 1vg8_A | 207 | RAS-related protein RAB-7; GTP-binding protein, pr | 2e-11 | |
| 1z08_A | 170 | RAS-related protein RAB-21; RAB GTPase, vesicular | 3e-53 | |
| 1z08_A | 170 | RAS-related protein RAB-21; RAB GTPase, vesicular | 8e-11 | |
| 3bc1_A | 195 | RAS-related protein RAB-27A; RAB27, GTPase, RAB, s | 4e-53 | |
| 3bc1_A | 195 | RAS-related protein RAB-27A; RAB27, GTPase, RAB, s | 3e-12 | |
| 2yc2_C | 208 | IFT27, small RAB-related GTPase; transport protein | 4e-53 | |
| 2yc2_C | 208 | IFT27, small RAB-related GTPase; transport protein | 1e-11 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 1e-52 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 1e-10 | |
| 2hxs_A | 178 | RAB-26, RAS-related protein RAB-28; GTPase, signal | 2e-52 | |
| 2hxs_A | 178 | RAB-26, RAS-related protein RAB-28; GTPase, signal | 3e-11 | |
| 1r2q_A | 170 | RAS-related protein RAB-5A; GTPase, GNP, atomic re | 7e-52 | |
| 1r2q_A | 170 | RAS-related protein RAB-5A; GTPase, GNP, atomic re | 8e-09 | |
| 3gj0_A | 221 | GTP-binding nuclear protein RAN; G protein, GDP, a | 8e-52 | |
| 3gj0_A | 221 | GTP-binding nuclear protein RAN; G protein, GDP, a | 1e-11 | |
| 1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 2e-51 | |
| 1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 3e-11 | |
| 1z0j_A | 170 | RAB-22, RAS-related protein RAB-22A; RAB GTPase, R | 2e-51 | |
| 1z0j_A | 170 | RAB-22, RAS-related protein RAB-22A; RAB GTPase, R | 2e-08 | |
| 2fg5_A | 192 | RAB-22B, RAS-related protein RAB-31; G-protein, GT | 6e-51 | |
| 2fg5_A | 192 | RAB-22B, RAS-related protein RAB-31; G-protein, GT | 4e-09 | |
| 3bbp_A | 211 | RAB-6, RAS-related protein RAB-6A; golgi complex, | 7e-51 | |
| 3bbp_A | 211 | RAB-6, RAS-related protein RAB-6A; golgi complex, | 1e-10 | |
| 4djt_A | 218 | GTP-binding nuclear protein GSP1; structural genom | 5e-49 | |
| 4djt_A | 218 | GTP-binding nuclear protein GSP1; structural genom | 6e-10 | |
| 1ek0_A | 170 | Protein (GTP-binding protein YPT51); vesicular tra | 5e-47 | |
| 1ek0_A | 170 | Protein (GTP-binding protein YPT51); vesicular tra | 2e-08 | |
| 3clv_A | 208 | RAB5 protein, putative; malaria, GTPase, structura | 2e-45 | |
| 2zej_A | 184 | Dardarin, leucine-rich repeat kinase 2; parkinson' | 2e-40 | |
| 2zej_A | 184 | Dardarin, leucine-rich repeat kinase 2; parkinson' | 6e-07 | |
| 3cbq_A | 195 | GTP-binding protein REM 2; FLJ38964A, structural g | 2e-39 | |
| 3cbq_A | 195 | GTP-binding protein REM 2; FLJ38964A, structural g | 2e-08 | |
| 2fn4_A | 181 | P23, RAS-related protein R-RAS; GDP/GTP binding, G | 2e-38 | |
| 2fn4_A | 181 | P23, RAS-related protein R-RAS; GDP/GTP binding, G | 1e-08 | |
| 2a9k_A | 187 | RAS-related protein RAL-A; bacterial ADP-ribosyltr | 2e-37 | |
| 2a9k_A | 187 | RAS-related protein RAL-A; bacterial ADP-ribosyltr | 2e-08 | |
| 3q85_A | 169 | GTP-binding protein REM 2; G-domain, CAV2 beta, si | 8e-37 | |
| 3q85_A | 169 | GTP-binding protein REM 2; G-domain, CAV2 beta, si | 2e-06 | |
| 2bov_A | 206 | RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, | 5e-36 | |
| 2bov_A | 206 | RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, | 4e-07 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 5e-35 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 5e-06 | |
| 3kkq_A | 183 | RAS-related protein M-RAS; GTP-binding, GTPase, si | 1e-33 | |
| 3kkq_A | 183 | RAS-related protein M-RAS; GTP-binding, GTPase, si | 2e-07 | |
| 3t5g_A | 181 | GTP-binding protein RHEB; immunoglobulin-like beta | 5e-33 | |
| 3t5g_A | 181 | GTP-binding protein RHEB; immunoglobulin-like beta | 4e-06 | |
| 3oes_A | 201 | GTPase rhebl1; small GTPase, structural genomics, | 6e-33 | |
| 3oes_A | 201 | GTPase rhebl1; small GTPase, structural genomics, | 6e-06 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 1e-32 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 2e-05 | |
| 2gf0_A | 199 | GTP-binding protein DI-RAS1; GDP/GTP binding, GTP | 2e-32 | |
| 2gf0_A | 199 | GTP-binding protein DI-RAS1; GDP/GTP binding, GTP | 6e-06 | |
| 3q72_A | 166 | GTP-binding protein RAD; G-domain, CAV2 beta, sign | 8e-32 | |
| 3q72_A | 166 | GTP-binding protein RAD; G-domain, CAV2 beta, sign | 5e-05 | |
| 2erx_A | 172 | GTP-binding protein DI-RAS2; GTP hydrolysis, trans | 9e-32 | |
| 2erx_A | 172 | GTP-binding protein DI-RAS2; GTP hydrolysis, trans | 6e-05 | |
| 1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 1e-31 | |
| 1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 4e-05 | |
| 2nzj_A | 175 | GTP-binding protein REM 1; GDP/GTP binding, GTP hy | 2e-31 | |
| 2nzj_A | 175 | GTP-binding protein REM 1; GDP/GTP binding, GTP hy | 3e-05 | |
| 1c1y_A | 167 | RAS-related protein RAP-1A; GTP-binding proteins, | 2e-31 | |
| 1c1y_A | 167 | RAS-related protein RAP-1A; GTP-binding proteins, | 3e-05 | |
| 2atv_A | 196 | RERG, RAS-like estrogen-regulated growth inhibitor | 4e-31 | |
| 2atv_A | 196 | RERG, RAS-like estrogen-regulated growth inhibitor | 8e-07 | |
| 4dsu_A | 189 | GTPase KRAS, isoform 2B; small G-protein, signalin | 2e-30 | |
| 4dsu_A | 189 | GTPase KRAS, isoform 2B; small G-protein, signalin | 4e-05 | |
| 3con_A | 190 | GTPase NRAS; structural genomics consortium, SGC, | 5e-30 | |
| 3con_A | 190 | GTPase NRAS; structural genomics consortium, SGC, | 9e-05 | |
| 3dpu_A | 535 | RAB family protein; roccor, G-domain, COR, GTP-bin | 1e-29 | |
| 3dpu_A | 535 | RAB family protein; roccor, G-domain, COR, GTP-bin | 1e-04 | |
| 2iwr_A | 178 | Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi | 4e-29 | |
| 2iwr_A | 178 | Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi | 2e-06 | |
| 3c5c_A | 187 | RAS-like protein 12; GDP, GTPase, structural genom | 9e-29 | |
| 3c5c_A | 187 | RAS-like protein 12; GDP, GTPase, structural genom | 4e-05 | |
| 2g3y_A | 211 | GTP-binding protein GEM; small GTPase, GDP, inacti | 2e-28 | |
| 2g3y_A | 211 | GTP-binding protein GEM; small GTPase, GDP, inacti | 2e-07 | |
| 2cjw_A | 192 | GTP-binding protein GEM; nucleotide-binding, small | 9e-27 | |
| 2cjw_A | 192 | GTP-binding protein GEM; nucleotide-binding, small | 5e-05 | |
| 3ihw_A | 184 | Centg3; RAS, centaurin, GTPase, structural genomic | 5e-26 | |
| 3ihw_A | 184 | Centg3; RAS, centaurin, GTPase, structural genomic | 6e-06 | |
| 3reg_A | 194 | RHO-like small GTPase; cytoskeleton, nucleotide-bi | 1e-21 | |
| 3reg_A | 194 | RHO-like small GTPase; cytoskeleton, nucleotide-bi | 6e-05 | |
| 3bwd_D | 182 | RAC-like GTP-binding protein ARAC6; G domain, cyto | 2e-20 | |
| 3bwd_D | 182 | RAC-like GTP-binding protein ARAC6; G domain, cyto | 3e-04 | |
| 2j1l_A | 214 | RHO-related GTP-binding protein RHOD; GTPase, memb | 1e-19 | |
| 2j1l_A | 214 | RHO-related GTP-binding protein RHOD; GTPase, memb | 9e-04 | |
| 2fv8_A | 207 | H6, RHO-related GTP-binding protein RHOB; GDP/GTP | 2e-19 | |
| 2gco_A | 201 | H9, RHO-related GTP-binding protein RHOC; GTPase,s | 4e-19 | |
| 3th5_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 6e-19 | |
| 1m7b_A | 184 | RND3/RHOE small GTP-binding protein; small GTPase, | 9e-19 | |
| 1gwn_A | 205 | RHO-related GTP-binding protein RHOE; GTPase, inac | 1e-18 | |
| 1gwn_A | 205 | RHO-related GTP-binding protein RHOE; GTPase, inac | 5e-04 | |
| 3q3j_B | 214 | RHO-related GTP-binding protein RHO6; RAS-binding | 2e-18 | |
| 1mh1_A | 186 | RAC1; GTP-binding, GTPase, small G-protein, RHO fa | 5e-18 | |
| 2q3h_A | 201 | RAS homolog gene family, member U; GTPase, structu | 4e-17 | |
| 2atx_A | 194 | Small GTP binding protein TC10; GTPase, P-loop, al | 6e-17 | |
| 2j0v_A | 212 | RAC-like GTP-binding protein ARAC7; nucleotide-bin | 1e-16 | |
| 2j0v_A | 212 | RAC-like GTP-binding protein ARAC7; nucleotide-bin | 3e-04 | |
| 3t1o_A | 198 | Gliding protein MGLA; G domain containing protein, | 2e-13 | |
| 1upt_A | 171 | ARL1, ADP-ribosylation factor-like protein 1; hydr | 5e-11 | |
| 1moz_A | 183 | ARL1, ADP-ribosylation factor-like protein 1; GTP- | 2e-10 | |
| 2x77_A | 189 | ADP-ribosylation factor; GTP-binding protein, smal | 2e-10 | |
| 1r8s_A | 164 | ADP-ribosylation factor 1; protein transport/excha | 3e-10 | |
| 1ksh_A | 186 | ARF-like protein 2; small GTPase, small GTP-bindin | 4e-10 | |
| 1zj6_A | 187 | ADP-ribosylation factor-like protein 5; ARL, GTP-b | 4e-10 | |
| 2b6h_A | 192 | ADP-ribosylation factor 5; membrane trafficking, G | 5e-10 | |
| 2h17_A | 181 | ADP-ribosylation factor-like protein 5A; GDP, GTPa | 6e-10 | |
| 1fzq_A | 181 | ADP-ribosylation factor-like protein 3; protein-GD | 1e-09 | |
| 2fh5_B | 214 | SR-beta, signal recognition particle receptor beta | 3e-09 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 3e-09 | |
| 1nrj_B | 218 | SR-beta, signal recognition particle receptor beta | 4e-09 | |
| 1zd9_A | 188 | ADP-ribosylation factor-like 10B; transport protei | 5e-09 | |
| 1f6b_A | 198 | SAR1; gtpases, N-terminal helix, Mg-containing com | 5e-09 | |
| 1m2o_B | 190 | GTP-binding protein SAR1, GTP binding protein; zin | 6e-09 | |
| 2h57_A | 190 | ADP-ribosylation factor-like protein 6; GTP, GTPas | 7e-09 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 2e-08 | |
| 3o47_A | 329 | ADP-ribosylation factor GTPase-activating protein | 2e-08 | |
| 2wkq_A | 332 | NPH1-1, RAS-related C3 botulinum toxin substrate 1 | 1e-07 | |
| 3llu_A | 196 | RAS-related GTP-binding protein C; structural geno | 2e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-07 | |
| 3r7w_A | 307 | Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT | 4e-06 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 3e-04 |
| >2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Length = 200 | Back alignment and structure |
|---|
Score = 183 bits (466), Expect = 1e-59
Identities = 60/97 (61%), Positives = 75/97 (77%)
Query: 73 SKMSSSGQYSYSYIFKYIIIGDMGVGKSCLLHQFTEQKFMPDCPHTIGVEFGTRIIEVHG 132
S + G ++FK+++IG G GKSCLLHQF E KF D HTIGVEFG+R++ V G
Sbjct: 12 SGLVPRGSIWSDFLFKFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGVEFGSRVVNVGG 71
Query: 133 EKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVIDVS 169
+ +KLQIWDTAGQERFR+VTRSYYRGAAGAL+V D++
Sbjct: 72 KTVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDIT 108
|
| >2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Length = 200 | Back alignment and structure |
|---|
| >1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Length = 179 | Back alignment and structure |
|---|
| >1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Length = 179 | Back alignment and structure |
|---|
| >2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Length = 186 | Back alignment and structure |
|---|
| >2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Length = 186 | Back alignment and structure |
|---|
| >2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Length = 191 | Back alignment and structure |
|---|
| >2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Length = 191 | Back alignment and structure |
|---|
| >3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Length = 223 | Back alignment and structure |
|---|
| >3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Length = 223 | Back alignment and structure |
|---|
| >2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
| >2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Length = 191 | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Length = 191 | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Length = 199 | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Length = 199 | Back alignment and structure |
|---|
| >2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Length = 195 | Back alignment and structure |
|---|
| >1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Length = 195 | Back alignment and structure |
|---|
| >2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 201 | Back alignment and structure |
|---|
| >2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 201 | Back alignment and structure |
|---|
| >3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 213 | Back alignment and structure |
|---|
| >3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 213 | Back alignment and structure |
|---|
| >1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Length = 177 | Back alignment and structure |
|---|
| >1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Length = 177 | Back alignment and structure |
|---|
| >2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Length = 192 | Back alignment and structure |
|---|
| >2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Length = 192 | Back alignment and structure |
|---|
| >1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Length = 203 | Back alignment and structure |
|---|
| >1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Length = 203 | Back alignment and structure |
|---|
| >3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Length = 196 | Back alignment and structure |
|---|
| >3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Length = 196 | Back alignment and structure |
|---|
| >3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} Length = 191 | Back alignment and structure |
|---|
| >3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} Length = 191 | Back alignment and structure |
|---|
| >2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Length = 206 | Back alignment and structure |
|---|
| >2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Length = 206 | Back alignment and structure |
|---|
| >2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Length = 183 | Back alignment and structure |
|---|
| >2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Length = 183 | Back alignment and structure |
|---|
| >2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Length = 181 | Back alignment and structure |
|---|
| >2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Length = 181 | Back alignment and structure |
|---|
| >1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Length = 189 | Back alignment and structure |
|---|
| >1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Length = 189 | Back alignment and structure |
|---|
| >2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Length = 199 | Back alignment and structure |
|---|
| >2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Length = 199 | Back alignment and structure |
|---|
| >3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Length = 199 | Back alignment and structure |
|---|
| >3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Length = 199 | Back alignment and structure |
|---|
| >2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Length = 217 | Back alignment and structure |
|---|
| >2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Length = 217 | Back alignment and structure |
|---|
| >2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 180 | Back alignment and structure |
|---|
| >2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 180 | Back alignment and structure |
|---|
| >3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Length = 181 | Back alignment and structure |
|---|
| >3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Length = 181 | Back alignment and structure |
|---|
| >2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Length = 189 | Back alignment and structure |
|---|
| >2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Length = 189 | Back alignment and structure |
|---|
| >1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Length = 170 | Back alignment and structure |
|---|
| >1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Length = 170 | Back alignment and structure |
|---|
| >2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Length = 179 | Back alignment and structure |
|---|
| >2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Length = 179 | Back alignment and structure |
|---|
| >1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Length = 207 | Back alignment and structure |
|---|
| >1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Length = 207 | Back alignment and structure |
|---|
| >1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Length = 170 | Back alignment and structure |
|---|
| >1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Length = 170 | Back alignment and structure |
|---|
| >3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Length = 195 | Back alignment and structure |
|---|
| >3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Length = 195 | Back alignment and structure |
|---|
| >2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Length = 208 | Back alignment and structure |
|---|
| >2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Length = 208 | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Length = 168 | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Length = 168 | Back alignment and structure |
|---|
| >2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Length = 178 | Back alignment and structure |
|---|
| >2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Length = 178 | Back alignment and structure |
|---|
| >1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Length = 170 | Back alignment and structure |
|---|
| >1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Length = 170 | Back alignment and structure |
|---|
| >3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 1qg4_A* 3ea5_A* 1qg2_A* 1byu_A* 3ran_A* 3gjx_C* ... Length = 221 | Back alignment and structure |
|---|
| >3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 1qg4_A* 3ea5_A* 1qg2_A* 1byu_A* 3ran_A* 3gjx_C* ... Length = 221 | Back alignment and structure |
|---|
| >1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Length = 182 | Back alignment and structure |
|---|
| >1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Length = 182 | Back alignment and structure |
|---|
| >1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Length = 170 | Back alignment and structure |
|---|
| >1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Length = 170 | Back alignment and structure |
|---|
| >2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Length = 192 | Back alignment and structure |
|---|
| >2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Length = 192 | Back alignment and structure |
|---|
| >3bbp_A RAB-6, RAS-related protein RAB-6A; golgi complex, GRIP domain, RAB GTPase, ARL GTPase, golgin, RAB effector, clAsp protein; HET: GTP; 3.00A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >3bbp_A RAB-6, RAS-related protein RAB-6A; golgi complex, GRIP domain, RAB GTPase, ARL GTPase, golgin, RAB effector, clAsp protein; HET: GTP; 3.00A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Length = 218 | Back alignment and structure |
|---|
| >4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Length = 218 | Back alignment and structure |
|---|
| >1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 170 | Back alignment and structure |
|---|
| >1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 170 | Back alignment and structure |
|---|
| >3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Length = 208 | Back alignment and structure |
|---|
| >2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Length = 184 | Back alignment and structure |
|---|
| >2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Length = 184 | Back alignment and structure |
|---|
| >3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Length = 195 | Back alignment and structure |
|---|
| >3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Length = 195 | Back alignment and structure |
|---|
| >2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Length = 181 | Back alignment and structure |
|---|
| >2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Length = 181 | Back alignment and structure |
|---|
| >2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Length = 187 | Back alignment and structure |
|---|
| >2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Length = 187 | Back alignment and structure |
|---|
| >3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} Length = 169 | Back alignment and structure |
|---|
| >3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} Length = 169 | Back alignment and structure |
|---|
| >2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Length = 206 | Back alignment and structure |
|---|
| >2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Length = 206 | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Length = 168 | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Length = 168 | Back alignment and structure |
|---|
| >3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Length = 183 | Back alignment and structure |
|---|
| >3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Length = 183 | Back alignment and structure |
|---|
| >3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* Length = 181 | Back alignment and structure |
|---|
| >3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* Length = 181 | Back alignment and structure |
|---|
| >3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Length = 166 | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Length = 166 | Back alignment and structure |
|---|
| >2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 199 | Back alignment and structure |
|---|
| >2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 199 | Back alignment and structure |
|---|
| >3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Length = 166 | Back alignment and structure |
|---|
| >3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Length = 166 | Back alignment and structure |
|---|
| >2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Length = 172 | Back alignment and structure |
|---|
| >2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Length = 172 | Back alignment and structure |
|---|
| >1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Length = 167 | Back alignment and structure |
|---|
| >1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Length = 167 | Back alignment and structure |
|---|
| >2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Length = 175 | Back alignment and structure |
|---|
| >2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Length = 175 | Back alignment and structure |
|---|
| >1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Length = 167 | Back alignment and structure |
|---|
| >1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Length = 167 | Back alignment and structure |
|---|
| >2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 196 | Back alignment and structure |
|---|
| >2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 196 | Back alignment and structure |
|---|
| >4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Length = 189 | Back alignment and structure |
|---|
| >4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Length = 189 | Back alignment and structure |
|---|
| >3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Length = 190 | Back alignment and structure |
|---|
| >3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Length = 190 | Back alignment and structure |
|---|
| >3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Length = 535 | Back alignment and structure |
|---|
| >3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Length = 535 | Back alignment and structure |
|---|
| >2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Length = 178 | Back alignment and structure |
|---|
| >2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Length = 178 | Back alignment and structure |
|---|
| >3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Length = 187 | Back alignment and structure |
|---|
| >3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Length = 187 | Back alignment and structure |
|---|
| >2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Length = 211 | Back alignment and structure |
|---|
| >2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Length = 211 | Back alignment and structure |
|---|
| >2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Length = 192 | Back alignment and structure |
|---|
| >2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Length = 192 | Back alignment and structure |
|---|
| >3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} Length = 184 | Back alignment and structure |
|---|
| >3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} Length = 184 | Back alignment and structure |
|---|
| >3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* Length = 194 | Back alignment and structure |
|---|
| >3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* Length = 194 | Back alignment and structure |
|---|
| >3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Length = 182 | Back alignment and structure |
|---|
| >3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Length = 182 | Back alignment and structure |
|---|
| >2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Length = 214 | Back alignment and structure |
|---|
| >2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Length = 214 | Back alignment and structure |
|---|
| >2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 207 | Back alignment and structure |
|---|
| >2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Length = 201 | Back alignment and structure |
|---|
| >3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Length = 204 | Back alignment and structure |
|---|
| >1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Length = 184 | Back alignment and structure |
|---|
| >1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Length = 205 | Back alignment and structure |
|---|
| >1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Length = 205 | Back alignment and structure |
|---|
| >3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Length = 214 | Back alignment and structure |
|---|
| >1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Length = 186 | Back alignment and structure |
|---|
| >2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Length = 194 | Back alignment and structure |
|---|
| >2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Length = 212 | Back alignment and structure |
|---|
| >2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Length = 212 | Back alignment and structure |
|---|
| >3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Length = 198 | Back alignment and structure |
|---|
| >1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Length = 171 | Back alignment and structure |
|---|
| >1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 183 | Back alignment and structure |
|---|
| >2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Length = 189 | Back alignment and structure |
|---|
| >1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Length = 164 | Back alignment and structure |
|---|
| >1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Length = 186 | Back alignment and structure |
|---|
| >1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 187 | Back alignment and structure |
|---|
| >2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Length = 192 | Back alignment and structure |
|---|
| >2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Length = 181 | Back alignment and structure |
|---|
| >1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Length = 181 | Back alignment and structure |
|---|
| >2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Length = 214 | Back alignment and structure |
|---|
| >1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 218 | Back alignment and structure |
|---|
| >1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Length = 188 | Back alignment and structure |
|---|
| >1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Length = 198 | Back alignment and structure |
|---|
| >1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Length = 190 | Back alignment and structure |
|---|
| >2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Length = 190 | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Length = 193 | Back alignment and structure |
|---|
| >3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Length = 329 | Back alignment and structure |
|---|
| >2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Length = 332 | Back alignment and structure |
|---|
| >3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Length = 196 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} Length = 307 | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Length = 427 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 173 | |||
| 4dkx_A | 216 | RAS-related protein RAB-6A; GTP binding fold, memb | 99.92 | |
| 2ew1_A | 201 | RAS-related protein RAB-30; G-protein, GTP analogu | 99.87 | |
| 2hup_A | 201 | RAS-related protein RAB-43; G-protein, GDP, struct | 99.86 | |
| 3q3j_B | 214 | RHO-related GTP-binding protein RHO6; RAS-binding | 99.85 | |
| 2oil_A | 193 | CATX-8, RAS-related protein RAB-25; G-protein, GDP | 99.85 | |
| 2a5j_A | 191 | RAS-related protein RAB-2B; GTPase, signal transdu | 99.85 | |
| 2y8e_A | 179 | RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti | 99.85 | |
| 2hjg_A | 436 | GTP-binding protein ENGA; GTPase ENGA KH-domain, h | 99.85 | |
| 2bme_A | 186 | RAB4A, RAS-related protein RAB4A; GTP-binding prot | 99.85 | |
| 1zbd_A | 203 | Rabphilin-3A; G protein, effector, RABCDR, synapti | 99.85 | |
| 1ek0_A | 170 | Protein (GTP-binding protein YPT51); vesicular tra | 99.85 | |
| 2fg5_A | 192 | RAB-22B, RAS-related protein RAB-31; G-protein, GT | 99.85 | |
| 2gf9_A | 189 | RAS-related protein RAB-3D; G-protein, structural | 99.85 | |
| 3reg_A | 194 | RHO-like small GTPase; cytoskeleton, nucleotide-bi | 99.85 | |
| 3tw8_B | 181 | RAS-related protein RAB-35; longin domain, RAB GTP | 99.84 | |
| 1z0f_A | 179 | RAB14, member RAS oncogene family; RAB GTPase, ves | 99.84 | |
| 2p5s_A | 199 | RAS and EF-hand domain containing; G-protein, RAB, | 99.84 | |
| 1m7b_A | 184 | RND3/RHOE small GTP-binding protein; small GTPase, | 99.84 | |
| 2bcg_Y | 206 | Protein YP2, GTP-binding protein YPT1; RABGTPase, | 99.84 | |
| 2fu5_C | 183 | RAS-related protein RAB-8A; MSS4:RAB8 protein comp | 99.84 | |
| 3tkl_A | 196 | RAS-related protein RAB-1A; vesicle trafficking, p | 99.84 | |
| 1z06_A | 189 | RAS-related protein RAB-33B; RAB GTPase, RAB33B GT | 99.84 | |
| 1r2q_A | 170 | RAS-related protein RAB-5A; GTPase, GNP, atomic re | 99.84 | |
| 3t5g_A | 181 | GTP-binding protein RHEB; immunoglobulin-like beta | 99.84 | |
| 1z08_A | 170 | RAS-related protein RAB-21; RAB GTPase, vesicular | 99.84 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 99.84 | |
| 3kkq_A | 183 | RAS-related protein M-RAS; GTP-binding, GTPase, si | 99.84 | |
| 1wms_A | 177 | RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p | 99.84 | |
| 2o52_A | 200 | RAS-related protein RAB-4B; G-protein, GDP, struct | 99.84 | |
| 1z0j_A | 170 | RAB-22, RAS-related protein RAB-22A; RAB GTPase, R | 99.84 | |
| 1gwn_A | 205 | RHO-related GTP-binding protein RHOE; GTPase, inac | 99.84 | |
| 1x3s_A | 195 | RAS-related protein RAB-18; GTPase, GNP, structura | 99.84 | |
| 3c5c_A | 187 | RAS-like protein 12; GDP, GTPase, structural genom | 99.84 | |
| 2efe_B | 181 | Small GTP-binding protein-like; GEF, GTPase, VPS9, | 99.84 | |
| 2hxs_A | 178 | RAB-26, RAS-related protein RAB-28; GTPase, signal | 99.84 | |
| 3cpj_B | 223 | GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl | 99.84 | |
| 2il1_A | 192 | RAB12; G-protein, GDP, GTPase, predicted, structur | 99.84 | |
| 1g16_A | 170 | RAS-related protein SEC4; G protein RAB, signaling | 99.83 | |
| 2g6b_A | 180 | RAS-related protein RAB-26; G-protein, GTP analogu | 99.83 | |
| 2atx_A | 194 | Small GTP binding protein TC10; GTPase, P-loop, al | 99.83 | |
| 2q3h_A | 201 | RAS homolog gene family, member U; GTPase, structu | 99.83 | |
| 2j1l_A | 214 | RHO-related GTP-binding protein RHOD; GTPase, memb | 99.83 | |
| 2j0v_A | 212 | RAC-like GTP-binding protein ARAC7; nucleotide-bin | 99.83 | |
| 2fn4_A | 181 | P23, RAS-related protein R-RAS; GDP/GTP binding, G | 99.83 | |
| 3bc1_A | 195 | RAS-related protein RAB-27A; RAB27, GTPase, RAB, s | 99.83 | |
| 3cph_A | 213 | RAS-related protein SEC4; RAB GTPase, prenylation, | 99.83 | |
| 1vg8_A | 207 | RAS-related protein RAB-7; GTP-binding protein, pr | 99.82 | |
| 2g3y_A | 211 | GTP-binding protein GEM; small GTPase, GDP, inacti | 99.82 | |
| 3dz8_A | 191 | RAS-related protein RAB-3B; GDP, GTPase, structura | 99.82 | |
| 1mh1_A | 186 | RAC1; GTP-binding, GTPase, small G-protein, RHO fa | 99.82 | |
| 3clv_A | 208 | RAB5 protein, putative; malaria, GTPase, structura | 99.82 | |
| 2f7s_A | 217 | C25KG, RAS-related protein RAB-27B; G-protein, str | 99.82 | |
| 1c1y_A | 167 | RAS-related protein RAP-1A; GTP-binding proteins, | 99.82 | |
| 3cbq_A | 195 | GTP-binding protein REM 2; FLJ38964A, structural g | 99.82 | |
| 3gj0_A | 221 | GTP-binding nuclear protein RAN; G protein, GDP, a | 99.82 | |
| 4dcu_A | 456 | GTP-binding protein ENGA; GTPase, GDP, protein bin | 99.82 | |
| 3oes_A | 201 | GTPase rhebl1; small GTPase, structural genomics, | 99.82 | |
| 2gco_A | 201 | H9, RHO-related GTP-binding protein RHOC; GTPase,s | 99.82 | |
| 3ihw_A | 184 | Centg3; RAS, centaurin, GTPase, structural genomic | 99.82 | |
| 4bas_A | 199 | ADP-ribosylation factor, putative (small GTPase, p | 99.81 | |
| 2yc2_C | 208 | IFT27, small RAB-related GTPase; transport protein | 99.81 | |
| 2iwr_A | 178 | Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi | 99.81 | |
| 1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 99.81 | |
| 4gzl_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 99.81 | |
| 1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 99.81 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 99.81 | |
| 2bov_A | 206 | RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, | 99.81 | |
| 2fv8_A | 207 | H6, RHO-related GTP-binding protein RHOB; GDP/GTP | 99.81 | |
| 3t1o_A | 198 | Gliding protein MGLA; G domain containing protein, | 99.81 | |
| 4dsu_A | 189 | GTPase KRAS, isoform 2B; small G-protein, signalin | 99.81 | |
| 3bwd_D | 182 | RAC-like GTP-binding protein ARAC6; G domain, cyto | 99.8 | |
| 2a9k_A | 187 | RAS-related protein RAL-A; bacterial ADP-ribosyltr | 99.8 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 99.8 | |
| 3l0i_B | 199 | RAS-related protein RAB-1A; GEF-GDF-RAB complex, G | 99.8 | |
| 3q85_A | 169 | GTP-binding protein REM 2; G-domain, CAV2 beta, si | 99.8 | |
| 2erx_A | 172 | GTP-binding protein DI-RAS2; GTP hydrolysis, trans | 99.8 | |
| 1zd9_A | 188 | ADP-ribosylation factor-like 10B; transport protei | 99.8 | |
| 2gf0_A | 199 | GTP-binding protein DI-RAS1; GDP/GTP binding, GTP | 99.8 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 99.8 | |
| 2atv_A | 196 | RERG, RAS-like estrogen-regulated growth inhibitor | 99.79 | |
| 2nzj_A | 175 | GTP-binding protein REM 1; GDP/GTP binding, GTP hy | 99.79 | |
| 3con_A | 190 | GTPase NRAS; structural genomics consortium, SGC, | 99.79 | |
| 2h17_A | 181 | ADP-ribosylation factor-like protein 5A; GDP, GTPa | 99.78 | |
| 3q72_A | 166 | GTP-binding protein RAD; G-domain, CAV2 beta, sign | 99.78 | |
| 1upt_A | 171 | ARL1, ADP-ribosylation factor-like protein 1; hydr | 99.78 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 99.78 | |
| 1zj6_A | 187 | ADP-ribosylation factor-like protein 5; ARL, GTP-b | 99.78 | |
| 1r8s_A | 164 | ADP-ribosylation factor 1; protein transport/excha | 99.78 | |
| 1m2o_B | 190 | GTP-binding protein SAR1, GTP binding protein; zin | 99.78 | |
| 1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 99.78 | |
| 1f6b_A | 198 | SAR1; gtpases, N-terminal helix, Mg-containing com | 99.78 | |
| 1ksh_A | 186 | ARF-like protein 2; small GTPase, small GTP-bindin | 99.78 | |
| 2zej_A | 184 | Dardarin, leucine-rich repeat kinase 2; parkinson' | 99.77 | |
| 2h57_A | 190 | ADP-ribosylation factor-like protein 6; GTP, GTPas | 99.77 | |
| 2cjw_A | 192 | GTP-binding protein GEM; nucleotide-binding, small | 99.77 | |
| 4djt_A | 218 | GTP-binding nuclear protein GSP1; structural genom | 99.77 | |
| 1fzq_A | 181 | ADP-ribosylation factor-like protein 3; protein-GD | 99.76 | |
| 2b6h_A | 192 | ADP-ribosylation factor 5; membrane trafficking, G | 99.76 | |
| 2wkq_A | 332 | NPH1-1, RAS-related C3 botulinum toxin substrate 1 | 99.75 | |
| 3th5_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 99.6 | |
| 2x77_A | 189 | ADP-ribosylation factor; GTP-binding protein, smal | 99.75 | |
| 3r7w_B | 331 | Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT | 99.74 | |
| 3llu_A | 196 | RAS-related GTP-binding protein C; structural geno | 99.74 | |
| 1moz_A | 183 | ARL1, ADP-ribosylation factor-like protein 1; GTP- | 99.74 | |
| 2fh5_B | 214 | SR-beta, signal recognition particle receptor beta | 99.74 | |
| 2lkc_A | 178 | Translation initiation factor IF-2; NMR {Geobacill | 99.73 | |
| 3r7w_A | 307 | Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT | 99.72 | |
| 1svi_A | 195 | GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro | 99.69 | |
| 2wji_A | 165 | Ferrous iron transport protein B homolog; membrane | 99.69 | |
| 3o47_A | 329 | ADP-ribosylation factor GTPase-activating protein | 99.69 | |
| 3c5h_A | 255 | Glucocorticoid receptor DNA-binding factor 1; RAS, | 99.68 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 99.68 | |
| 2gj8_A | 172 | MNME, tRNA modification GTPase TRME; G-domain dime | 99.65 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 99.65 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 99.65 | |
| 1nrj_B | 218 | SR-beta, signal recognition particle receptor beta | 99.64 | |
| 2wjg_A | 188 | FEOB, ferrous iron transport protein B homolog; me | 99.6 | |
| 3dpu_A | 535 | RAB family protein; roccor, G-domain, COR, GTP-bin | 99.59 | |
| 2qu8_A | 228 | Putative nucleolar GTP-binding protein 1; GTPase, | 99.59 | |
| 3lxx_A | 239 | GTPase IMAP family member 4; structural genomics c | 99.58 | |
| 3a1s_A | 258 | Iron(II) transport protein B; FEOB, iron transport | 99.58 | |
| 3pqc_A | 195 | Probable GTP-binding protein ENGB; rossmann fold, | 99.58 | |
| 3b1v_A | 272 | Ferrous iron uptake transporter protein B; G prote | 99.56 | |
| 2cxx_A | 190 | Probable GTP-binding protein ENGB; structural geno | 99.56 | |
| 3iby_A | 256 | Ferrous iron transport protein B; G protein, G dom | 99.56 | |
| 3k53_A | 271 | Ferrous iron transport protein B; GTPase fold, hel | 99.54 | |
| 4dhe_A | 223 | Probable GTP-binding protein ENGB; melioidosis, RA | 99.54 | |
| 3lxw_A | 247 | GTPase IMAP family member 1; immunity, structural | 99.53 | |
| 1wf3_A | 301 | GTP-binding protein; GTPase, riken structural geno | 99.53 | |
| 2xtp_A | 260 | GTPase IMAP family member 2; immune system, G prot | 99.52 | |
| 1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 99.5 | |
| 3def_A | 262 | T7I23.11 protein; chloroplast, TOC33, GTPase, hydr | 99.5 | |
| 3iev_A | 308 | GTP-binding protein ERA; ERA, GTPase, KH domain, a | 99.49 | |
| 3i8s_A | 274 | Ferrous iron transport protein B; GTPase, GPCR, ir | 99.46 | |
| 2hjg_A | 436 | GTP-binding protein ENGA; GTPase ENGA KH-domain, h | 99.46 | |
| 3gee_A | 476 | MNME, tRNA modification GTPase MNME; G protein, cy | 99.45 | |
| 1h65_A | 270 | Chloroplast outer envelope protein OEP34; GTPase, | 99.43 | |
| 3p26_A | 483 | Elongation factor 1 alpha-like protein; GTP/GDP bi | 99.41 | |
| 3j2k_7 | 439 | ERF3, eukaryotic polypeptide chain release factor | 99.4 | |
| 4dcu_A | 456 | GTP-binding protein ENGA; GTPase, GDP, protein bin | 99.4 | |
| 1xzp_A | 482 | Probable tRNA modification GTPase TRME; GTP-bindin | 99.38 | |
| 3t5d_A | 274 | Septin-7; GTP-binding protein, cytoskeleton, signa | 99.38 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 99.36 | |
| 1zun_B | 434 | Sulfate adenylate transferase, subunit 1/adenylyls | 99.36 | |
| 2aka_B | 299 | Dynamin-1; fusion protein, GTPase domain, myosin, | 99.35 | |
| 3geh_A | 462 | MNME, tRNA modification GTPase MNME; G protein, U3 | 99.35 | |
| 3sjy_A | 403 | Translation initiation factor 2 subunit gamma; zin | 99.34 | |
| 3izy_P | 537 | Translation initiation factor IF-2, mitochondrial; | 99.33 | |
| 1jal_A | 363 | YCHF protein; nucleotide-binding fold, structural | 99.33 | |
| 2qag_A | 361 | Septin-2, protein NEDD5; cell cycle, cell division | 99.33 | |
| 1wb1_A | 482 | Translation elongation factor SELB; selenocysteine | 99.33 | |
| 2ohf_A | 396 | Protein OLA1, GTP-binding protein 9; ATPase, GTPas | 99.32 | |
| 2c78_A | 405 | Elongation factor TU-A; hydrolase, GTPase, transla | 99.32 | |
| 1s0u_A | 408 | EIF-2-gamma, translation initiation factor 2 gamma | 99.31 | |
| 3qq5_A | 423 | Small GTP-binding protein; hydrogenase, H-cluster, | 99.31 | |
| 2h5e_A | 529 | Peptide chain release factor RF-3; beta barrel, tr | 99.3 | |
| 1jny_A | 435 | EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- | 99.29 | |
| 1d2e_A | 397 | Elongation factor TU (EF-TU); G-protein, beta-barr | 99.29 | |
| 3izq_1 | 611 | HBS1P, elongation factor 1 alpha-like protein; NO- | 99.29 | |
| 3cb4_D | 599 | GTP-binding protein LEPA; GTPase, OB-fold, membran | 99.29 | |
| 1kk1_A | 410 | EIF2gamma; initiation of translation; HET: GNP; 1. | 99.28 | |
| 2qtf_A | 364 | Protein HFLX, GTP-binding protein; beta-alpha-barr | 99.28 | |
| 1n0u_A | 842 | EF-2, elongation factor 2; G-protein, CIS-proline, | 99.27 | |
| 1jwy_B | 315 | Dynamin A GTPase domain; dynamin, GTPase, GDP, myo | 99.27 | |
| 1wxq_A | 397 | GTP-binding protein; structural genomics, riken st | 99.27 | |
| 3tr5_A | 528 | RF-3, peptide chain release factor 3; protein synt | 99.26 | |
| 1zo1_I | 501 | IF2, translation initiation factor 2; E. coli, rib | 99.26 | |
| 4fid_A | 340 | G protein alpha subunit; RAS-like domain, all-heli | 99.25 | |
| 1dar_A | 691 | EF-G, elongation factor G; ribosomal translocase, | 99.25 | |
| 1ega_A | 301 | Protein (GTP-binding protein ERA); GTPase, RNA-bin | 99.25 | |
| 1g7s_A | 594 | Translation initiation factor IF2/EIF5B; translati | 99.23 | |
| 1f60_A | 458 | Elongation factor EEF1A; protein-protein complex, | 99.22 | |
| 1r5b_A | 467 | Eukaryotic peptide chain release factor GTP-bindi | 99.21 | |
| 2ywe_A | 600 | GTP-binding protein LEPA; G domain, beta-barrel, f | 99.21 | |
| 3avx_A | 1289 | Elongation factor TS, elongation factor TU, linke | 99.21 | |
| 3ohm_A | 327 | Guanine nucleotide-binding protein G(Q) subunit A; | 99.21 | |
| 2elf_A | 370 | Protein translation elongation factor 1A; tRNA, py | 99.2 | |
| 2e87_A | 357 | Hypothetical protein PH1320; GTP-binding, GTPase, | 99.2 | |
| 1lnz_A | 342 | SPO0B-associated GTP-binding protein; GTPase, OBG, | 99.19 | |
| 2dy1_A | 665 | Elongation factor G; translocation, GTP complex, s | 99.16 | |
| 3mca_A | 592 | HBS1, elongation factor 1 alpha-like protein; prot | 99.16 | |
| 3t34_A | 360 | Dynamin-related protein 1A, linker, dynamin-relat | 99.15 | |
| 2rdo_7 | 704 | EF-G, elongation factor G; elongation factor G, EF | 99.14 | |
| 2xex_A | 693 | Elongation factor G; GTPase, translation, biosynth | 99.13 | |
| 2x2e_A | 353 | Dynamin-1; nitration, hydrolase, membrane fission, | 99.12 | |
| 2qpt_A | 550 | EH domain-containing protein-2; protein-nucleotide | 99.12 | |
| 2dby_A | 368 | GTP-binding protein; GDP, structural genomics, NPP | 99.11 | |
| 4dkx_A | 216 | RAS-related protein RAB-6A; GTP binding fold, memb | 99.11 | |
| 2j69_A | 695 | Bacterial dynamin-like protein; FZO, FZL, GTPase, | 99.09 | |
| 2qnr_A | 301 | Septin-2, protein NEDD5; structural genomics conso | 99.0 | |
| 2qag_C | 418 | Septin-7; cell cycle, cell division, GTP-binding, | 98.94 | |
| 1ni3_A | 392 | YCHF GTPase, YCHF GTP-binding protein; structural | 98.93 | |
| 1cip_A | 353 | Protein (guanine nucleotide-binding protein alpha- | 98.8 | |
| 1azs_C | 402 | GS-alpha; complex (lyase/hydrolase), hydrolase, si | 98.8 | |
| 4a9a_A | 376 | Ribosome-interacting GTPase 1; DRG-DFRP complex, r | 98.79 | |
| 2xtz_A | 354 | Guanine nucleotide-binding protein alpha-1 subuni; | 98.68 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 98.65 | |
| 2ew1_A | 201 | RAS-related protein RAB-30; G-protein, GTP analogu | 98.63 | |
| 1udx_A | 416 | The GTP-binding protein OBG; TGS domain, riken str | 98.63 | |
| 1zcb_A | 362 | G alpha I/13; GTP-binding, lipoprotein, membrane, | 98.6 | |
| 3cnl_A | 262 | YLQF, putative uncharacterized protein; circular p | 98.6 | |
| 2y8e_A | 179 | RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti | 98.58 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 98.53 | |
| 3vqt_A | 548 | RF-3, peptide chain release factor 3; translation, | 98.51 | |
| 2hup_A | 201 | RAS-related protein RAB-43; G-protein, GDP, struct | 98.5 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 98.49 | |
| 3c5c_A | 187 | RAS-like protein 12; GDP, GTPase, structural genom | 98.49 | |
| 3ihw_A | 184 | Centg3; RAS, centaurin, GTPase, structural genomic | 98.48 | |
| 1z08_A | 170 | RAS-related protein RAB-21; RAB GTPase, vesicular | 98.47 | |
| 1wms_A | 177 | RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p | 98.47 | |
| 1gwn_A | 205 | RHO-related GTP-binding protein RHOE; GTPase, inac | 98.46 | |
| 4bas_A | 199 | ADP-ribosylation factor, putative (small GTPase, p | 98.46 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 98.46 | |
| 1m7b_A | 184 | RND3/RHOE small GTP-binding protein; small GTPase, | 98.46 | |
| 2oil_A | 193 | CATX-8, RAS-related protein RAB-25; G-protein, GDP | 98.46 | |
| 2iwr_A | 178 | Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi | 98.46 | |
| 3bc1_A | 195 | RAS-related protein RAB-27A; RAB27, GTPase, RAB, s | 98.45 | |
| 2j1l_A | 214 | RHO-related GTP-binding protein RHOD; GTPase, memb | 98.45 | |
| 2g3y_A | 211 | GTP-binding protein GEM; small GTPase, GDP, inacti | 98.45 | |
| 2atx_A | 194 | Small GTP binding protein TC10; GTPase, P-loop, al | 98.45 | |
| 2atv_A | 196 | RERG, RAS-like estrogen-regulated growth inhibitor | 98.44 | |
| 3reg_A | 194 | RHO-like small GTPase; cytoskeleton, nucleotide-bi | 98.44 | |
| 2a5j_A | 191 | RAS-related protein RAB-2B; GTPase, signal transdu | 98.43 | |
| 2gf9_A | 189 | RAS-related protein RAB-3D; G-protein, structural | 98.43 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 98.43 | |
| 2fg5_A | 192 | RAB-22B, RAS-related protein RAB-31; G-protein, GT | 98.42 | |
| 2bme_A | 186 | RAB4A, RAS-related protein RAB4A; GTP-binding prot | 98.42 | |
| 1puj_A | 282 | YLQF, conserved hypothetical protein YLQF; structu | 98.41 | |
| 3q3j_B | 214 | RHO-related GTP-binding protein RHO6; RAS-binding | 98.41 | |
| 2fu5_C | 183 | RAS-related protein RAB-8A; MSS4:RAB8 protein comp | 98.41 | |
| 1zbd_A | 203 | Rabphilin-3A; G protein, effector, RABCDR, synapti | 98.41 | |
| 3dz8_A | 191 | RAS-related protein RAB-3B; GDP, GTPase, structura | 98.4 | |
| 1z0j_A | 170 | RAB-22, RAS-related protein RAB-22A; RAB GTPase, R | 98.4 | |
| 2o52_A | 200 | RAS-related protein RAB-4B; G-protein, GDP, struct | 98.4 | |
| 3cpj_B | 223 | GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl | 98.4 | |
| 3tkl_A | 196 | RAS-related protein RAB-1A; vesicle trafficking, p | 98.4 | |
| 3clv_A | 208 | RAB5 protein, putative; malaria, GTPase, structura | 98.39 | |
| 3tw8_B | 181 | RAS-related protein RAB-35; longin domain, RAB GTP | 98.39 | |
| 3gj0_A | 221 | GTP-binding nuclear protein RAN; G protein, GDP, a | 98.39 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 98.39 | |
| 3kkq_A | 183 | RAS-related protein M-RAS; GTP-binding, GTPase, si | 98.39 | |
| 1c1y_A | 167 | RAS-related protein RAP-1A; GTP-binding proteins, | 98.39 | |
| 1z0f_A | 179 | RAB14, member RAS oncogene family; RAB GTPase, ves | 98.38 | |
| 2bcg_Y | 206 | Protein YP2, GTP-binding protein YPT1; RABGTPase, | 98.37 | |
| 2fn4_A | 181 | P23, RAS-related protein R-RAS; GDP/GTP binding, G | 98.37 | |
| 3t5g_A | 181 | GTP-binding protein RHEB; immunoglobulin-like beta | 98.37 | |
| 1g16_A | 170 | RAS-related protein SEC4; G protein RAB, signaling | 98.36 | |
| 1r2q_A | 170 | RAS-related protein RAB-5A; GTPase, GNP, atomic re | 98.36 | |
| 1zd9_A | 188 | ADP-ribosylation factor-like 10B; transport protei | 98.36 | |
| 2zej_A | 184 | Dardarin, leucine-rich repeat kinase 2; parkinson' | 98.36 | |
| 2gf0_A | 199 | GTP-binding protein DI-RAS1; GDP/GTP binding, GTP | 98.36 | |
| 2hxs_A | 178 | RAB-26, RAS-related protein RAB-28; GTPase, signal | 98.36 | |
| 2j0v_A | 212 | RAC-like GTP-binding protein ARAC7; nucleotide-bin | 98.35 | |
| 2f7s_A | 217 | C25KG, RAS-related protein RAB-27B; G-protein, str | 98.35 | |
| 2erx_A | 172 | GTP-binding protein DI-RAS2; GTP hydrolysis, trans | 98.35 | |
| 1x3s_A | 195 | RAS-related protein RAB-18; GTPase, GNP, structura | 98.33 | |
| 1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 98.33 | |
| 1vg8_A | 207 | RAS-related protein RAB-7; GTP-binding protein, pr | 98.32 | |
| 3zvr_A | 772 | Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito | 98.31 | |
| 1ek0_A | 170 | Protein (GTP-binding protein YPT51); vesicular tra | 98.31 | |
| 2bov_A | 206 | RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, | 98.31 | |
| 2q3h_A | 201 | RAS homolog gene family, member U; GTPase, structu | 98.31 | |
| 1mh1_A | 186 | RAC1; GTP-binding, GTPase, small G-protein, RHO fa | 98.31 | |
| 1z06_A | 189 | RAS-related protein RAB-33B; RAB GTPase, RAB33B GT | 98.29 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 98.29 | |
| 3t1o_A | 198 | Gliding protein MGLA; G domain containing protein, | 98.29 | |
| 2il1_A | 192 | RAB12; G-protein, GDP, GTPase, predicted, structur | 98.28 | |
| 4dsu_A | 189 | GTPase KRAS, isoform 2B; small G-protein, signalin | 98.28 | |
| 3oes_A | 201 | GTPase rhebl1; small GTPase, structural genomics, | 98.27 | |
| 3bwd_D | 182 | RAC-like GTP-binding protein ARAC6; G domain, cyto | 98.27 | |
| 2cjw_A | 192 | GTP-binding protein GEM; nucleotide-binding, small | 98.27 | |
| 2g6b_A | 180 | RAS-related protein RAB-26; G-protein, GTP analogu | 98.27 | |
| 2h57_A | 190 | ADP-ribosylation factor-like protein 6; GTP, GTPas | 98.26 | |
| 2gco_A | 201 | H9, RHO-related GTP-binding protein RHOC; GTPase,s | 98.25 | |
| 1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 98.25 | |
| 2fh5_B | 214 | SR-beta, signal recognition particle receptor beta | 98.25 | |
| 1r8s_A | 164 | ADP-ribosylation factor 1; protein transport/excha | 98.25 | |
| 2p5s_A | 199 | RAS and EF-hand domain containing; G-protein, RAB, | 98.24 | |
| 2efe_B | 181 | Small GTP-binding protein-like; GEF, GTPase, VPS9, | 98.24 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 98.24 | |
| 4gzl_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 98.24 | |
| 2a9k_A | 187 | RAS-related protein RAL-A; bacterial ADP-ribosyltr | 98.23 | |
| 3j25_A | 638 | Tetracycline resistance protein TETM; antibiotic r | 98.23 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 98.23 | |
| 4djt_A | 218 | GTP-binding nuclear protein GSP1; structural genom | 98.22 | |
| 2h17_A | 181 | ADP-ribosylation factor-like protein 5A; GDP, GTPa | 98.22 | |
| 3l0i_B | 199 | RAS-related protein RAB-1A; GEF-GDF-RAB complex, G | 98.21 | |
| 3cph_A | 213 | RAS-related protein SEC4; RAB GTPase, prenylation, | 98.2 | |
| 3cbq_A | 195 | GTP-binding protein REM 2; FLJ38964A, structural g | 98.2 | |
| 2fv8_A | 207 | H6, RHO-related GTP-binding protein RHOB; GDP/GTP | 98.19 | |
| 1ksh_A | 186 | ARF-like protein 2; small GTPase, small GTP-bindin | 98.19 | |
| 1zj6_A | 187 | ADP-ribosylation factor-like protein 5; ARL, GTP-b | 98.19 | |
| 3con_A | 190 | GTPase NRAS; structural genomics consortium, SGC, | 98.18 | |
| 2nzj_A | 175 | GTP-binding protein REM 1; GDP/GTP binding, GTP hy | 98.18 | |
| 1fzq_A | 181 | ADP-ribosylation factor-like protein 3; protein-GD | 98.17 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 98.16 | |
| 1moz_A | 183 | ARL1, ADP-ribosylation factor-like protein 1; GTP- | 98.16 | |
| 1upt_A | 171 | ARL1, ADP-ribosylation factor-like protein 1; hydr | 98.16 | |
| 2b6h_A | 192 | ADP-ribosylation factor 5; membrane trafficking, G | 98.14 | |
| 4fn5_A | 709 | EF-G 1, elongation factor G 1; translation, transl | 98.13 | |
| 2cxx_A | 190 | Probable GTP-binding protein ENGB; structural geno | 98.12 | |
| 3q85_A | 169 | GTP-binding protein REM 2; G-domain, CAV2 beta, si | 98.12 | |
| 1m2o_B | 190 | GTP-binding protein SAR1, GTP binding protein; zin | 98.11 | |
| 3c5h_A | 255 | Glucocorticoid receptor DNA-binding factor 1; RAS, | 98.11 | |
| 2x77_A | 189 | ADP-ribosylation factor; GTP-binding protein, smal | 98.08 | |
| 2lkc_A | 178 | Translation initiation factor IF-2; NMR {Geobacill | 98.06 | |
| 3h2y_A | 368 | GTPase family protein; GTP-binding protein YQEH, p | 98.06 | |
| 2wji_A | 165 | Ferrous iron transport protein B homolog; membrane | 98.05 | |
| 1f6b_A | 198 | SAR1; gtpases, N-terminal helix, Mg-containing com | 98.04 | |
| 3ec1_A | 369 | YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase | 98.03 | |
| 1svi_A | 195 | GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro | 98.03 | |
| 2yc2_C | 208 | IFT27, small RAB-related GTPase; transport protein | 98.03 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 98.01 | |
| 2wjg_A | 188 | FEOB, ferrous iron transport protein B homolog; me | 98.0 | |
| 1bif_A | 469 | 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; | 97.96 | |
| 3th5_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 97.2 | |
| 3q72_A | 166 | GTP-binding protein RAD; G-domain, CAV2 beta, sign | 97.94 | |
| 1yrb_A | 262 | ATP(GTP)binding protein; GTPase, P-loop, rossman f | 97.92 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 97.92 | |
| 2wkq_A | 332 | NPH1-1, RAS-related C3 botulinum toxin substrate 1 | 97.91 | |
| 3r7w_B | 331 | Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT | 97.89 | |
| 3r7w_A | 307 | Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT | 97.89 | |
| 3pqc_A | 195 | Probable GTP-binding protein ENGB; rossmann fold, | 97.83 | |
| 3dpu_A | 535 | RAB family protein; roccor, G-domain, COR, GTP-bin | 97.83 | |
| 1nrj_B | 218 | SR-beta, signal recognition particle receptor beta | 97.81 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 97.8 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 97.8 | |
| 3llu_A | 196 | RAS-related GTP-binding protein C; structural geno | 97.79 | |
| 3o47_A | 329 | ADP-ribosylation factor GTPase-activating protein | 97.79 | |
| 2gj8_A | 172 | MNME, tRNA modification GTPase TRME; G-domain dime | 97.78 | |
| 3a1s_A | 258 | Iron(II) transport protein B; FEOB, iron transport | 97.75 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 97.73 | |
| 2qu8_A | 228 | Putative nucleolar GTP-binding protein 1; GTPase, | 97.71 | |
| 3lxx_A | 239 | GTPase IMAP family member 4; structural genomics c | 97.7 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 97.68 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 97.64 | |
| 3t5d_A | 274 | Septin-7; GTP-binding protein, cytoskeleton, signa | 97.62 | |
| 3b1v_A | 272 | Ferrous iron uptake transporter protein B; G prote | 97.61 | |
| 3k53_A | 271 | Ferrous iron transport protein B; GTPase fold, hel | 97.61 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 97.58 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 97.58 | |
| 2xtp_A | 260 | GTPase IMAP family member 2; immune system, G prot | 97.51 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 97.49 | |
| 1wf3_A | 301 | GTP-binding protein; GTPase, riken structural geno | 97.49 | |
| 3i8s_A | 274 | Ferrous iron transport protein B; GTPase, GPCR, ir | 97.47 | |
| 4dhe_A | 223 | Probable GTP-binding protein ENGB; melioidosis, RA | 97.46 | |
| 3lxw_A | 247 | GTPase IMAP family member 1; immunity, structural | 97.44 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 97.41 | |
| 3iby_A | 256 | Ferrous iron transport protein B; G protein, G dom | 97.38 | |
| 3def_A | 262 | T7I23.11 protein; chloroplast, TOC33, GTPase, hydr | 97.35 | |
| 2aka_B | 299 | Dynamin-1; fusion protein, GTPase domain, myosin, | 97.34 | |
| 1h65_A | 270 | Chloroplast outer envelope protein OEP34; GTPase, | 97.3 | |
| 2qnr_A | 301 | Septin-2, protein NEDD5; structural genomics conso | 97.22 | |
| 3q5d_A | 447 | Atlastin-1; G protein, GTPase, GDP/GTP binding, hy | 97.2 | |
| 3l82_B | 227 | F-box only protein 4; TRFH domain, helix, GTPase d | 97.14 | |
| 2qag_A | 361 | Septin-2, protein NEDD5; cell cycle, cell division | 97.13 | |
| 2qag_C | 418 | Septin-7; cell cycle, cell division, GTP-binding, | 97.12 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 97.08 | |
| 3iev_A | 308 | GTP-binding protein ERA; ERA, GTPase, KH domain, a | 97.05 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 97.03 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 96.91 | |
| 1ega_A | 301 | Protein (GTP-binding protein ERA); GTPase, RNA-bin | 96.89 | |
| 2x2e_A | 353 | Dynamin-1; nitration, hydrolase, membrane fission, | 96.86 | |
| 3t34_A | 360 | Dynamin-related protein 1A, linker, dynamin-relat | 96.85 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 96.85 | |
| 1jal_A | 363 | YCHF protein; nucleotide-binding fold, structural | 96.84 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 96.83 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 96.81 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 96.8 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 96.79 | |
| 3gee_A | 476 | MNME, tRNA modification GTPase MNME; G protein, cy | 96.79 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 96.79 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 96.77 | |
| 3cnl_A | 262 | YLQF, putative uncharacterized protein; circular p | 96.76 | |
| 3geh_A | 462 | MNME, tRNA modification GTPase MNME; G protein, U3 | 96.75 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 96.74 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 96.71 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 96.7 | |
| 1jwy_B | 315 | Dynamin A GTPase domain; dynamin, GTPase, GDP, myo | 96.7 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 96.66 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 96.66 | |
| 2qtf_A | 364 | Protein HFLX, GTP-binding protein; beta-alpha-barr | 96.65 | |
| 1wxq_A | 397 | GTP-binding protein; structural genomics, riken st | 96.63 | |
| 1xzp_A | 482 | Probable tRNA modification GTPase TRME; GTP-bindin | 96.62 | |
| 2e87_A | 357 | Hypothetical protein PH1320; GTP-binding, GTPase, | 96.62 | |
| 3l2o_B | 312 | F-box only protein 4; small G protein fold, UBL co | 96.61 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 96.6 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 96.6 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 96.58 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 96.57 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 96.57 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 96.57 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 96.54 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 96.53 | |
| 1puj_A | 282 | YLQF, conserved hypothetical protein YLQF; structu | 96.52 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 96.5 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 96.47 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 96.47 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 96.46 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 96.46 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 96.45 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 96.43 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 96.43 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 96.43 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 96.42 | |
| 3qq5_A | 423 | Small GTP-binding protein; hydrogenase, H-cluster, | 96.4 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 96.4 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 96.39 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 96.38 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 96.38 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 96.38 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 96.38 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 96.37 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 96.36 | |
| 3izy_P | 537 | Translation initiation factor IF-2, mitochondrial; | 96.35 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 96.34 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 96.33 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 96.32 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 96.31 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 96.3 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 96.3 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 96.28 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 96.28 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 96.28 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 96.28 | |
| 3sr0_A | 206 | Adenylate kinase; phosphoryl transfer analogue, AL | 96.27 | |
| 3sjy_A | 403 | Translation initiation factor 2 subunit gamma; zin | 96.27 | |
| 2ohf_A | 396 | Protein OLA1, GTP-binding protein 9; ATPase, GTPas | 96.26 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 96.26 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 96.26 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 96.23 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 96.21 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 96.21 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 96.2 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 96.19 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 96.19 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 96.19 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 96.19 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 96.19 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 96.18 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 96.18 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 96.17 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 96.17 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 96.17 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 96.16 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 96.16 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 96.16 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 96.14 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.14 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 96.14 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 96.14 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 96.13 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 96.13 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 96.12 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 96.12 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 96.12 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 96.12 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 96.12 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 96.11 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 96.11 | |
| 2dby_A | 368 | GTP-binding protein; GDP, structural genomics, NPP | 96.11 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 96.11 | |
| 2qpt_A | 550 | EH domain-containing protein-2; protein-nucleotide | 96.1 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 96.1 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 96.09 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 96.09 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 96.07 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 96.07 | |
| 1lnz_A | 342 | SPO0B-associated GTP-binding protein; GTPase, OBG, | 96.06 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 96.06 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 96.06 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 96.06 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 96.05 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 96.04 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 96.03 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 96.03 | |
| 1t9h_A | 307 | YLOQ, probable GTPase ENGC; N-terminal beta-barrel | 96.02 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 96.01 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 96.01 | |
| 3p26_A | 483 | Elongation factor 1 alpha-like protein; GTP/GDP bi | 96.01 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 95.98 | |
| 1kk1_A | 410 | EIF2gamma; initiation of translation; HET: GNP; 1. | 95.98 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 95.97 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 95.96 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 95.96 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 95.95 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 95.95 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 95.94 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 95.94 | |
| 3izq_1 | 611 | HBS1P, elongation factor 1 alpha-like protein; NO- | 95.93 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 95.92 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 95.92 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 95.92 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 95.91 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 95.91 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 95.91 | |
| 1zun_B | 434 | Sulfate adenylate transferase, subunit 1/adenylyls | 95.89 | |
| 2j69_A | 695 | Bacterial dynamin-like protein; FZO, FZL, GTPase, | 95.89 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 95.88 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 95.88 |
| >4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* | Back alignment and structure |
|---|
Probab=99.92 E-value=1.2e-25 Score=164.19 Aligned_cols=90 Identities=37% Similarity=0.684 Sum_probs=75.0
Q ss_pred ceeeEEEEEeCCCCChHHHHHHHHhCCCCCCCCCceeeeeEEEEEEECCeEEEEEEEeCCCccccccchhhhhcCCCEEE
Q psy13826 84 SYIFKYIIIGDMGVGKSCLLHQFTEQKFMPDCPHTIGVEFGTRIIEVHGEKIKLQIWDTAGQERFRAVTRSYYRGAAGAL 163 (173)
Q Consensus 84 ~~~~ki~l~G~~~vGKssl~~~~~~~~~~~~~~~t~~~~~~~~~~~~~~~~~~l~i~D~~g~~~~~~~~~~~~~~~~~~i 163 (173)
...|||+++|++|||||||++||+.+.|...+.||++.++....+.+++..+.++||||+|+++|..+++.|++.+++++
T Consensus 11 ~k~~KivlvGd~~VGKTsLi~r~~~~~f~~~~~~Tig~d~~~k~~~~~~~~v~l~iwDtaGqe~~~~l~~~~~~~a~~~i 90 (216)
T 4dkx_A 11 LRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTIRLQLWDTAGLERFRSLIPSYIRDSAAAV 90 (216)
T ss_dssp --CEEEEEECSTTSSHHHHHHHHHHSCCC----------CEEEEEECSSCEEEEEEECCSCTTTCGGGHHHHHTTCSEEE
T ss_pred CCcEEEEEECcCCcCHHHHHHHHHhCCCCCCcCCccceEEEEEEEEecceEEEEEEEECCCchhhhhHHHHHhccccEEE
Confidence 35689999999999999999999999999999999999998888999999999999999999999999999999999999
Q ss_pred EEEeCCCCCC
Q psy13826 164 MVIDVSHVKE 173 (173)
Q Consensus 164 lv~d~t~~~S 173 (173)
+|||+++++|
T Consensus 91 lv~di~~~~S 100 (216)
T 4dkx_A 91 VVYDITNVNS 100 (216)
T ss_dssp EEEETTCHHH
T ss_pred EEeecchhHH
Confidence 9999999764
|
| >2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* | Back alignment and structure |
|---|
| >2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* | Back alignment and structure |
|---|
| >2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* | Back alignment and structure |
|---|
| >2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* | Back alignment and structure |
|---|
| >1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* | Back alignment and structure |
|---|
| >3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* | Back alignment and structure |
|---|
| >3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* | Back alignment and structure |
|---|
| >2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* | Back alignment and structure |
|---|
| >2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* | Back alignment and structure |
|---|
| >2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* | Back alignment and structure |
|---|
| >3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} | Back alignment and structure |
|---|
| >1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* | Back alignment and structure |
|---|
| >1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* | Back alignment and structure |
|---|
| >3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* | Back alignment and structure |
|---|
| >1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* | Back alignment and structure |
|---|
| >3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* | Back alignment and structure |
|---|
| >1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* | Back alignment and structure |
|---|
| >2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* | Back alignment and structure |
|---|
| >1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* | Back alignment and structure |
|---|
| >2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* | Back alignment and structure |
|---|
| >3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A | Back alignment and structure |
|---|
| >2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} | Back alignment and structure |
|---|
| >2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* | Back alignment and structure |
|---|
| >3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* | Back alignment and structure |
|---|
| >3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* | Back alignment and structure |
|---|
| >2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... | Back alignment and structure |
|---|
| >3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* | Back alignment and structure |
|---|
| >1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* | Back alignment and structure |
|---|
| >3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... | Back alignment and structure |
|---|
| >4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* | Back alignment and structure |
|---|
| >3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... | Back alignment and structure |
|---|
| >3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} | Back alignment and structure |
|---|
| >2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C | Back alignment and structure |
|---|
| >2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A | Back alignment and structure |
|---|
| >1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* | Back alignment and structure |
|---|
| >4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* | Back alignment and structure |
|---|
| >1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* | Back alignment and structure |
|---|
| >2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} | Back alignment and structure |
|---|
| >2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* | Back alignment and structure |
|---|
| >4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* | Back alignment and structure |
|---|
| >3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C | Back alignment and structure |
|---|
| >2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
|---|
| >3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* | Back alignment and structure |
|---|
| >2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* | Back alignment and structure |
|---|
| >2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* | Back alignment and structure |
|---|
| >2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* | Back alignment and structure |
|---|
| >3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* | Back alignment and structure |
|---|
| >1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... | Back alignment and structure |
|---|
| >1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* | Back alignment and structure |
|---|
| >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 | Back alignment and structure |
|---|
| >1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* | Back alignment and structure |
|---|
| >1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* | Back alignment and structure |
|---|
| >2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* | Back alignment and structure |
|---|
| >2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* | Back alignment and structure |
|---|
| >4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* | Back alignment and structure |
|---|
| >2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* | Back alignment and structure |
|---|
| >2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* | Back alignment and structure |
|---|
| >3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} | Back alignment and structure |
|---|
| >3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* | Back alignment and structure |
|---|
| >3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* | Back alignment and structure |
|---|
| >1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 | Back alignment and structure |
|---|
| >2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* | Back alignment and structure |
|---|
| >3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* | Back alignment and structure |
|---|
| >1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* | Back alignment and structure |
|---|
| >2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* | Back alignment and structure |
|---|
| >3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A | Back alignment and structure |
|---|
| >3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A | Back alignment and structure |
|---|
| >3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* | Back alignment and structure |
|---|
| >2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} | Back alignment and structure |
|---|
| >3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 | Back alignment and structure |
|---|
| >2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A | Back alignment and structure |
|---|
| >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 | Back alignment and structure |
|---|
| >3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* | Back alignment and structure |
|---|
| >3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* | Back alignment and structure |
|---|
| >3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* | Back alignment and structure |
|---|
| >2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* | Back alignment and structure |
|---|
| >1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* | Back alignment and structure |
|---|
| >3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* | Back alignment and structure |
|---|
| >3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} | Back alignment and structure |
|---|
| >4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* | Back alignment and structure |
|---|
| >1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* | Back alignment and structure |
|---|
| >3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* | Back alignment and structure |
|---|
| >3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} | Back alignment and structure |
|---|
| >3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* | Back alignment and structure |
|---|
| >3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} | Back alignment and structure |
|---|
| >1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* | Back alignment and structure |
|---|
| >2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... | Back alignment and structure |
|---|
| >1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} | Back alignment and structure |
|---|
| >2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* | Back alignment and structure |
|---|
| >1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* | Back alignment and structure |
|---|
| >1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* | Back alignment and structure |
|---|
| >3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* | Back alignment and structure |
|---|
| >1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* | Back alignment and structure |
|---|
| >2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A | Back alignment and structure |
|---|
| >1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* | Back alignment and structure |
|---|
| >1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* | Back alignment and structure |
|---|
| >1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} | Back alignment and structure |
|---|
| >4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... | Back alignment and structure |
|---|
| >1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X | Back alignment and structure |
|---|
| >1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* | Back alignment and structure |
|---|
| >1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A | Back alignment and structure |
|---|
| >1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A | Back alignment and structure |
|---|
| >2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* | Back alignment and structure |
|---|
| >3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B | Back alignment and structure |
|---|
| >3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* | Back alignment and structure |
|---|
| >2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* | Back alignment and structure |
|---|
| >3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* | Back alignment and structure |
|---|
| >2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H | Back alignment and structure |
|---|
| >2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A | Back alignment and structure |
|---|
| >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} | Back alignment and structure |
|---|
| >2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A | Back alignment and structure |
|---|
| >4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* | Back alignment and structure |
|---|
| >2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* | Back alignment and structure |
|---|
| >2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* | Back alignment and structure |
|---|
| >2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... | Back alignment and structure |
|---|
| >1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* | Back alignment and structure |
|---|
| >4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 | Back alignment and structure |
|---|
| >1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* | Back alignment and structure |
|---|
| >3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* | Back alignment and structure |
|---|
| >2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* | Back alignment and structure |
|---|
| >2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* | Back alignment and structure |
|---|
| >1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* | Back alignment and structure |
|---|
| >1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* | Back alignment and structure |
|---|
| >2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A | Back alignment and structure |
|---|
| >3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* | Back alignment and structure |
|---|
| >2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* | Back alignment and structure |
|---|
| >2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* | Back alignment and structure |
|---|
| >2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* | Back alignment and structure |
|---|
| >2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* | Back alignment and structure |
|---|
| >1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* | Back alignment and structure |
|---|
| >2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* | Back alignment and structure |
|---|
| >1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* | Back alignment and structure |
|---|
| >2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} | Back alignment and structure |
|---|
| >3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
|---|
| >3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* | Back alignment and structure |
|---|
| >1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* | Back alignment and structure |
|---|
| >1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* | Back alignment and structure |
|---|
| >2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* | Back alignment and structure |
|---|
| >2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* | Back alignment and structure |
|---|
| >3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* | Back alignment and structure |
|---|
| >1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A | Back alignment and structure |
|---|
| >1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* | Back alignment and structure |
|---|
| >1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* | Back alignment and structure |
|---|
| >2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* | Back alignment and structure |
|---|
| >2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* | Back alignment and structure |
|---|
| >2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* | Back alignment and structure |
|---|
| >2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* | Back alignment and structure |
|---|
| >1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* | Back alignment and structure |
|---|
| >3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A | Back alignment and structure |
|---|
| >1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} | Back alignment and structure |
|---|
| >2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} | Back alignment and structure |
|---|
| >1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... | Back alignment and structure |
|---|
| >1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* | Back alignment and structure |
|---|
| >3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* | Back alignment and structure |
|---|
| >2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* | Back alignment and structure |
|---|
| >3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C | Back alignment and structure |
|---|
| >2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* | Back alignment and structure |
|---|
| >2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... | Back alignment and structure |
|---|
| >1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* | Back alignment and structure |
|---|
| >2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 | Back alignment and structure |
|---|
| >1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... | Back alignment and structure |
|---|
| >2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* | Back alignment and structure |
|---|
| >2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* | Back alignment and structure |
|---|
| >3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* | Back alignment and structure |
|---|
| >3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* | Back alignment and structure |
|---|
| >1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* | Back alignment and structure |
|---|
| >2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* | Back alignment and structure |
|---|
| >2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* | Back alignment and structure |
|---|
| >4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* | Back alignment and structure |
|---|
| >1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* | Back alignment and structure |
|---|
| >3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} | Back alignment and structure |
|---|
| >2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* | Back alignment and structure |
|---|
| >3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* | Back alignment and structure |
|---|
| >1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* | Back alignment and structure |
|---|
| >3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} | Back alignment and structure |
|---|
| >1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* | Back alignment and structure |
|---|
| >2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A | Back alignment and structure |
|---|
| >3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* | Back alignment and structure |
|---|
| >1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* | Back alignment and structure |
|---|
| >2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* | Back alignment and structure |
|---|
| >3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* | Back alignment and structure |
|---|
| >3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* | Back alignment and structure |
|---|
| >3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A | Back alignment and structure |
|---|
| >3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* | Back alignment and structure |
|---|
| >3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A | Back alignment and structure |
|---|
| >3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* | Back alignment and structure |
|---|
| >3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* | Back alignment and structure |
|---|
| >3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 | Back alignment and structure |
|---|
| >3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* | Back alignment and structure |
|---|
| >4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} | Back alignment and structure |
|---|
| >3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* | Back alignment and structure |
|---|
| >2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* | Back alignment and structure |
|---|
| >1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* | Back alignment and structure |
|---|
| >2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* | Back alignment and structure |
|---|
| >3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* | Back alignment and structure |
|---|
| >3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X | Back alignment and structure |
|---|
| >2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A | Back alignment and structure |
|---|
| >3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* | Back alignment and structure |
|---|
| >3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A | Back alignment and structure |
|---|
| >1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* | Back alignment and structure |
|---|
| >2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* | Back alignment and structure |
|---|
| >3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* | Back alignment and structure |
|---|
| >2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 173 | ||||
| d2bcgy1 | 194 | c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Sac | 2e-32 | |
| d2bcgy1 | 194 | c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Sac | 1e-07 | |
| d2fu5c1 | 173 | c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [Ta | 3e-32 | |
| d2fu5c1 | 173 | c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [Ta | 1e-07 | |
| d1g16a_ | 166 | c.37.1.8 (A:) Rab-related protein Sec4 {Baker's ye | 9e-32 | |
| d1g16a_ | 166 | c.37.1.8 (A:) Rab-related protein Sec4 {Baker's ye | 1e-05 | |
| d2ew1a1 | 171 | c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [Ta | 1e-30 | |
| d2ew1a1 | 171 | c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [Ta | 1e-07 | |
| d3raba_ | 169 | c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxI | 2e-28 | |
| d3raba_ | 169 | c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxI | 6e-07 | |
| d2g6ba1 | 170 | c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [T | 7e-27 | |
| d2g6ba1 | 170 | c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [T | 3e-07 | |
| d2bmea1 | 174 | c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [Ta | 7e-26 | |
| d2bmea1 | 174 | c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [Ta | 6e-08 | |
| d1x3sa1 | 177 | c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [Ta | 1e-25 | |
| d1x3sa1 | 177 | c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [Ta | 3e-06 | |
| d2f7sa1 | 186 | c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [T | 6e-24 | |
| d2f7sa1 | 186 | c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [T | 4e-07 | |
| d1z0fa1 | 166 | c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [Ta | 9e-24 | |
| d1z0fa1 | 166 | c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [Ta | 6e-08 | |
| d2f9la1 | 175 | c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [T | 2e-22 | |
| d2f9la1 | 175 | c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [T | 2e-07 | |
| d2a5ja1 | 173 | c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [Ta | 2e-19 | |
| d2a5ja1 | 173 | c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [Ta | 5e-08 | |
| d1r2qa_ | 170 | c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: | 6e-18 | |
| d1r2qa_ | 170 | c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: | 5e-05 | |
| d1z08a1 | 167 | c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [T | 8e-18 | |
| d1z08a1 | 167 | c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [T | 2e-07 | |
| d1yzqa1 | 164 | c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [Ta | 1e-17 | |
| d1yzqa1 | 164 | c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [Ta | 2e-06 | |
| d1wmsa_ | 174 | c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: | 2e-17 | |
| d1wmsa_ | 174 | c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: | 2e-08 | |
| d1vg8a_ | 184 | c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId | 2e-15 | |
| d1vg8a_ | 184 | c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId | 6e-06 | |
| d1z06a1 | 165 | c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) | 3e-14 | |
| d1z06a1 | 165 | c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) | 6e-06 | |
| d2atxa1 | 185 | c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [Tax | 3e-14 | |
| d2atxa1 | 185 | c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [Tax | 2e-07 | |
| d1azta2 | 221 | c.37.1.8 (A:35-65,A:202-391) Transducin (alpha sub | 4e-14 | |
| d1azta2 | 221 | c.37.1.8 (A:35-65,A:202-391) Transducin (alpha sub | 2e-05 | |
| d1ek0a_ | 170 | c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces | 8e-14 | |
| d1ek0a_ | 170 | c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces | 4e-05 | |
| d1ky3a_ | 175 | c.37.1.8 (A:) Rab-related protein ypt7p {Baker's y | 9e-14 | |
| d1ky3a_ | 175 | c.37.1.8 (A:) Rab-related protein ypt7p {Baker's y | 1e-05 | |
| d2ngra_ | 191 | c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: | 2e-13 | |
| d2ngra_ | 191 | c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: | 3e-05 | |
| d1z0ja1 | 167 | c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [ | 5e-13 | |
| d1z0ja1 | 167 | c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [ | 6e-05 | |
| d1r8sa_ | 160 | c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo | 5e-13 | |
| d1r8sa_ | 160 | c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo | 3e-04 | |
| d1kaoa_ | 167 | c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: | 1e-12 | |
| d1kaoa_ | 167 | c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: | 1e-05 | |
| d1z2aa1 | 164 | c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [Ta | 1e-12 | |
| d1z2aa1 | 164 | c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [Ta | 1e-04 | |
| d2fn4a1 | 173 | c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [T | 2e-12 | |
| d2fn4a1 | 173 | c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [T | 9e-07 | |
| d1c1ya_ | 167 | c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: | 2e-12 | |
| d1c1ya_ | 167 | c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: | 2e-05 | |
| d1x1ra1 | 169 | c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRa | 3e-12 | |
| d1x1ra1 | 169 | c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRa | 9e-06 | |
| d1e0sa_ | 173 | c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo | 7e-12 | |
| d1e0sa_ | 173 | c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo | 4e-04 | |
| d2erya1 | 171 | c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [ | 1e-11 | |
| d2erya1 | 171 | c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [ | 7e-06 | |
| d1kmqa_ | 177 | c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9 | 1e-11 | |
| d1kmqa_ | 177 | c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9 | 4e-05 | |
| d1moza_ | 182 | c.37.1.8 (A:) ADP-ribosylation factor {Baker's yea | 2e-11 | |
| d1moza_ | 182 | c.37.1.8 (A:) ADP-ribosylation factor {Baker's yea | 0.004 | |
| d1ctqa_ | 166 | c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapi | 2e-11 | |
| d1ctqa_ | 166 | c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapi | 2e-05 | |
| d1mh1a_ | 183 | c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 96 | 2e-11 | |
| d1mh1a_ | 183 | c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 96 | 8e-06 | |
| d1u8za_ | 168 | c.37.1.8 (A:) Ras-related protein RalA {Cotton-top | 4e-11 | |
| d1u8za_ | 168 | c.37.1.8 (A:) Ras-related protein RalA {Cotton-top | 3e-06 | |
| d1ksha_ | 165 | c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus | 4e-11 | |
| d1ksha_ | 165 | c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus | 2e-04 | |
| d2fh5b1 | 207 | c.37.1.8 (B:63-269) Signal recognition particle re | 1e-10 | |
| d2fh5b1 | 207 | c.37.1.8 (B:63-269) Signal recognition particle re | 9e-04 | |
| d1zcba2 | 200 | c.37.1.8 (A:47-75,A:202-372) Transducin (alpha sub | 1e-10 | |
| d1zcba2 | 200 | c.37.1.8 (A:47-75,A:202-372) Transducin (alpha sub | 8e-04 | |
| d2qtvb1 | 166 | c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharom | 3e-10 | |
| d2qtvb1 | 166 | c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharom | 9e-04 | |
| d1i2ma_ | 170 | c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 96 | 6e-10 | |
| d1i2ma_ | 170 | c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 96 | 2e-05 | |
| d2bcjq2 | 200 | c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha sub | 9e-10 | |
| d2bcjq2 | 200 | c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha sub | 3e-04 | |
| d1m7ba_ | 179 | c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [T | 1e-09 | |
| d1m7ba_ | 179 | c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [T | 3e-05 | |
| d1zj6a1 | 177 | c.37.1.8 (A:2-178) ADP-ribosylation factor {Human | 6e-09 | |
| d1zj6a1 | 177 | c.37.1.8 (A:2-178) ADP-ribosylation factor {Human | 6e-04 | |
| d2atva1 | 168 | c.37.1.8 (A:5-172) Ras-like estrogen-regulated gro | 1e-08 | |
| d2atva1 | 168 | c.37.1.8 (A:5-172) Ras-like estrogen-regulated gro | 1e-05 | |
| d2erxa1 | 171 | c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [ | 1e-08 | |
| d2erxa1 | 171 | c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [ | 2e-05 | |
| d1xtqa1 | 167 | c.37.1.8 (A:3-169) GTP-binding protein RheB {Human | 3e-08 | |
| d1xtqa1 | 167 | c.37.1.8 (A:3-169) GTP-binding protein RheB {Human | 9e-05 | |
| d1fzqa_ | 176 | c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus | 6e-08 | |
| d1fzqa_ | 176 | c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus | 0.001 | |
| d1svsa1 | 195 | c.37.1.8 (A:32-60,A:182-347) Transducin (alpha sub | 1e-07 | |
| d1svsa1 | 195 | c.37.1.8 (A:32-60,A:182-347) Transducin (alpha sub | 0.003 | |
| d2gjsa1 | 168 | c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [Tax | 2e-07 | |
| d2gjsa1 | 168 | c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [Tax | 1e-05 | |
| d1upta_ | 169 | c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo | 4e-07 | |
| d1upta_ | 169 | c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo | 4e-04 | |
| d1nrjb_ | 209 | c.37.1.8 (B:) Signal recognition particle receptor | 6e-07 | |
| d1nrjb_ | 209 | c.37.1.8 (B:) Signal recognition particle receptor | 0.002 | |
| d2bmja1 | 175 | c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {H | 1e-06 | |
| d2bmja1 | 175 | c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {H | 7e-05 | |
| d2g3ya1 | 172 | c.37.1.8 (A:73-244) GTP-binding protein GEM {Human | 4e-06 | |
| d2g3ya1 | 172 | c.37.1.8 (A:73-244) GTP-binding protein GEM {Human | 3e-05 | |
| d1f6ba_ | 186 | c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus gr | 5e-06 | |
| d1f6ba_ | 186 | c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus gr | 1e-04 | |
| d1zd9a1 | 164 | c.37.1.8 (A:18-181) ADP-ribosylation factor {Human | 2e-05 | |
| d1zd9a1 | 164 | c.37.1.8 (A:18-181) ADP-ribosylation factor {Human | 9e-04 | |
| d1tq4a_ | 400 | c.37.1.8 (A:) Interferon-inducible GTPase {Mouse ( | 0.004 |
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 194 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: G proteins domain: GTPase Ytp1 species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 112 bits (281), Expect = 2e-32
Identities = 47/90 (52%), Positives = 67/90 (74%)
Query: 83 YSYIFKYIIIGDMGVGKSCLLHQFTEQKFMPDCPHTIGVEFGTRIIEVHGEKIKLQIWDT 142
Y Y+FK ++IG+ GVGKSCLL +F++ + D TIGV+F + +E+ G+ +KLQIWDT
Sbjct: 3 YDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDT 62
Query: 143 AGQERFRAVTRSYYRGAAGALMVIDVSHVK 172
AGQERFR +T SYYRG+ G ++V DV+ +
Sbjct: 63 AGQERFRTITSSYYRGSHGIIIVYDVTDQE 92
|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 194 | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Length = 173 | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Length = 173 | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 169 | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 169 | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Length = 177 | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Length = 177 | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Length = 186 | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Length = 186 | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Length = 175 | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Length = 175 | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Length = 173 | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Length = 173 | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Length = 170 | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Length = 170 | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Length = 167 | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Length = 167 | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Length = 164 | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Length = 164 | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 184 | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 184 | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Length = 165 | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Length = 165 | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Length = 185 | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Length = 185 | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Length = 221 | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Length = 221 | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 170 | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 170 | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 175 | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 175 | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Length = 191 | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Length = 191 | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Length = 167 | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Length = 167 | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Length = 160 | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Length = 160 | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Length = 167 | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Length = 167 | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Length = 164 | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Length = 164 | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Length = 173 | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Length = 173 | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Length = 167 | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Length = 167 | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Length = 169 | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Length = 169 | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Length = 173 | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Length = 173 | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Length = 177 | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Length = 177 | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Length = 182 | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Length = 182 | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Length = 166 | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Length = 166 | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Length = 183 | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Length = 183 | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Length = 168 | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Length = 168 | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Length = 165 | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Length = 165 | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 207 | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 207 | Back information, alignment and structure |
|---|
| >d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Length = 200 | Back information, alignment and structure |
|---|
| >d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Length = 200 | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Length = 170 | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Length = 170 | Back information, alignment and structure |
|---|
| >d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Length = 200 | Back information, alignment and structure |
|---|
| >d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Length = 200 | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Length = 179 | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Length = 179 | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Length = 177 | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Length = 177 | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Length = 168 | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Length = 168 | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Length = 167 | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Length = 167 | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Length = 176 | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Length = 176 | Back information, alignment and structure |
|---|
| >d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 195 | Back information, alignment and structure |
|---|
| >d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 195 | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Length = 168 | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Length = 168 | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Length = 169 | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Length = 169 | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 209 | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 209 | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Length = 175 | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Length = 175 | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Length = 172 | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Length = 172 | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 186 | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 186 | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Length = 164 | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Length = 164 | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Length = 400 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 173 | |||
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.91 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 99.9 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 99.9 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 99.9 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 99.9 | |
| d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 99.9 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 99.89 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 99.89 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 99.89 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 99.89 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 99.89 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 99.89 | |
| d2ngra_ | 191 | CDC42 {Human (Homo sapiens) [TaxId: 9606]} | 99.88 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 99.88 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 99.88 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 99.88 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 99.88 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 99.88 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 99.88 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 99.87 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 99.87 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 99.87 | |
| d1m7ba_ | 179 | RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | 99.87 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 99.87 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 99.87 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 99.87 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 99.87 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 99.87 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 99.87 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 99.86 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 99.86 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 99.86 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 99.86 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 99.86 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 99.84 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 99.83 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 99.82 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.82 | |
| d2bmja1 | 175 | Centaurin gamma 1, G domain {Human (Homo sapiens) | 99.82 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 99.81 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 99.8 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 99.79 | |
| d1svsa1 | 195 | Transducin (alpha subunit) {Rat (Rattus norvegicus | 99.77 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 99.76 | |
| d2bcjq2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 99.75 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 99.75 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 99.72 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 99.71 | |
| d1zcba2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 99.69 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 99.69 | |
| d1azta2 | 221 | Transducin (alpha subunit) {Cow (Bos taurus) [TaxI | 99.63 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 99.56 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 99.56 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 99.5 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 99.49 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 99.44 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 99.4 | |
| d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 99.37 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 99.35 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 99.23 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 99.15 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 99.15 | |
| d1wb1a4 | 179 | Elongation factor SelB, N-terminal domain {Methano | 99.15 | |
| d1g7sa4 | 227 | Initiation factor IF2/eIF5b, N-terminal (G) domain | 99.12 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 99.09 | |
| d2c78a3 | 204 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 99.08 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 99.07 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 99.02 | |
| d1d2ea3 | 196 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 99.01 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 98.98 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 98.98 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 98.97 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 98.97 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 98.97 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 98.96 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 98.95 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 98.94 | |
| d2ngra_ | 191 | CDC42 {Human (Homo sapiens) [TaxId: 9606]} | 98.93 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 98.92 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 98.92 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 98.9 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 98.89 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 98.89 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 98.89 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 98.88 | |
| d1zunb3 | 222 | Sulfate adenylate transferase subunit cysN/C, EF-T | 98.88 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 98.87 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 98.87 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 98.87 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 98.87 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 98.86 | |
| d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 98.86 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 98.86 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 98.86 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 98.85 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 98.85 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 98.83 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 98.83 | |
| d1kk1a3 | 195 | Initiation factor eIF2 gamma subunit, N-terminal ( | 98.83 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 98.82 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 98.82 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 98.82 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 98.82 | |
| d1m7ba_ | 179 | RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | 98.81 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 98.8 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 98.8 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 98.78 | |
| d2dy1a2 | 267 | Elongation factor G (EF-G), N-terminal (G) domain | 98.78 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 98.78 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 98.77 | |
| d2bcjq2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 98.77 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 98.77 | |
| d2bv3a2 | 276 | Elongation factor G (EF-G), N-terminal (G) domain | 98.76 | |
| d1zcba2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 98.69 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 98.68 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 98.67 | |
| d2qn6a3 | 205 | Initiation factor eIF2 gamma subunit, N-terminal ( | 98.66 | |
| d1wxqa1 | 319 | GTP-binding protein PH0525 {Pyrococcus horikoshii | 98.66 | |
| d1n0ua2 | 341 | Elongation factor 2 (eEF-2), N-terminal (G) domain | 98.65 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 98.64 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 98.59 | |
| d1ni3a1 | 296 | YchF GTP-binding protein N-terminal domain {Fissio | 98.57 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 98.57 | |
| d1jnya3 | 224 | Elongation factor eEF-1alpha, N-terminal (G) domai | 98.57 | |
| d1jala1 | 278 | YchF GTP-binding protein N-terminal domain {Haemop | 98.55 | |
| d1r5ba3 | 245 | Eukaryotic peptide chain release factor ERF2, G do | 98.52 | |
| d1svsa1 | 195 | Transducin (alpha subunit) {Rat (Rattus norvegicus | 98.51 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 98.51 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 98.47 | |
| d1f60a3 | 239 | Elongation factor eEF-1alpha, N-terminal (G) domai | 98.46 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 98.46 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 98.44 | |
| d2bmja1 | 175 | Centaurin gamma 1, G domain {Human (Homo sapiens) | 98.43 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 98.42 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 98.4 | |
| d1azta2 | 221 | Transducin (alpha subunit) {Cow (Bos taurus) [TaxI | 98.4 | |
| d1puja_ | 273 | Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 | 98.4 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 98.35 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 98.24 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 98.22 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 98.18 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 98.13 | |
| d2akab1 | 299 | Dynamin G domain {Rat (Rattus norvegicus) [TaxId: | 98.07 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 97.94 | |
| d1jwyb_ | 306 | Dynamin G domain {Dictyostelium discoideum [TaxId: | 97.93 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 97.9 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 97.89 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 97.87 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 97.7 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 97.69 | |
| d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 97.66 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 97.63 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 97.62 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 97.57 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 97.56 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 97.5 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 97.4 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 97.39 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 97.39 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 97.3 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 97.28 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 97.23 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 97.17 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 97.15 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 97.14 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 97.13 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 97.12 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 97.12 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 97.12 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 97.11 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 97.1 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 97.1 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 97.09 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 97.07 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 97.05 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 97.02 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 97.01 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 97.0 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 96.94 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 96.93 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 96.93 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 96.92 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 96.91 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 96.89 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 96.87 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 96.84 | |
| d1wb1a4 | 179 | Elongation factor SelB, N-terminal domain {Methano | 96.84 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 96.8 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 96.79 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 96.78 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 96.75 | |
| d1f5na2 | 277 | Interferon-induced guanylate-binding protein 1 (GB | 96.74 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 96.74 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 96.73 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 96.72 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 96.7 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 96.69 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 96.67 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 96.67 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 96.67 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 96.66 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 96.65 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 96.65 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 96.63 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 96.61 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 96.59 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 96.59 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.58 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 96.55 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 96.54 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 96.54 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 96.54 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 96.53 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 96.52 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 96.47 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 96.45 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 96.44 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 96.41 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 96.4 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 96.39 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 96.38 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 96.38 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 96.37 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 96.37 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 96.37 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 96.35 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 96.35 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 96.35 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 96.34 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 96.34 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 96.34 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 96.34 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 96.34 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 96.32 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 96.31 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 96.3 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 96.29 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 96.28 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 96.27 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 96.27 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 96.26 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 96.25 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 96.24 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 96.24 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 96.17 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 96.15 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 96.15 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.14 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 96.13 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 96.08 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 96.08 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 96.07 | |
| d1puja_ | 273 | Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 | 96.05 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 96.05 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 96.03 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 96.0 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 95.99 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 95.98 | |
| d1wxqa1 | 319 | GTP-binding protein PH0525 {Pyrococcus horikoshii | 95.98 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 95.97 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 95.97 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 95.96 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 95.94 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 95.91 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 95.89 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 95.89 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 95.87 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 95.86 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 95.85 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 95.85 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 95.83 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 95.83 | |
| d1ni3a1 | 296 | YchF GTP-binding protein N-terminal domain {Fissio | 95.8 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 95.8 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 95.78 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 95.77 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 95.76 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 95.75 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 95.73 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 95.72 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 95.72 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 95.71 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 95.69 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 95.66 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 95.66 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 95.64 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 95.6 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 95.56 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 95.52 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 95.52 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 95.52 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 95.52 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 95.49 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 95.48 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 95.47 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 95.44 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 95.41 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 95.41 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 95.41 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 95.31 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 95.24 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 95.24 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 95.24 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 95.23 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 95.23 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 95.22 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 95.22 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 95.22 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 95.22 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 95.2 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 95.18 | |
| d1jala1 | 278 | YchF GTP-binding protein N-terminal domain {Haemop | 95.16 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 95.14 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 95.12 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.08 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 95.03 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 95.02 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 95.0 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 94.92 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 94.88 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 94.87 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 94.87 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 94.87 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 94.84 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 94.83 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 94.79 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 94.76 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 94.75 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 94.71 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 94.7 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 94.68 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 94.67 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 94.67 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 94.64 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 94.63 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 94.63 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 94.62 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 94.61 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 94.6 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 94.6 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 94.59 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 94.59 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 94.57 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 94.57 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 94.56 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 94.54 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 94.53 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 94.52 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 94.51 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 94.5 | |
| d2akab1 | 299 | Dynamin G domain {Rat (Rattus norvegicus) [TaxId: | 94.47 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 94.46 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 94.45 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 94.43 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 94.35 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 94.35 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 94.34 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 94.33 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 94.33 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 94.31 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 94.28 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 94.26 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 94.23 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 94.23 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 94.22 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 94.2 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 94.19 | |
| d1g7sa4 | 227 | Initiation factor IF2/eIF5b, N-terminal (G) domain | 94.16 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 94.12 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 94.12 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 94.11 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 94.06 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 94.05 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 94.03 | |
| d1jwyb_ | 306 | Dynamin G domain {Dictyostelium discoideum [TaxId: | 93.95 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 93.94 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 93.88 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 93.86 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 93.85 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 93.82 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 93.77 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 93.72 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 93.71 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 93.71 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 93.7 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 93.67 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 93.65 | |
| d1e69a_ | 308 | Smc head domain {Thermotoga maritima [TaxId: 2336] | 93.58 | |
| d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 93.51 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 93.48 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 93.47 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 93.45 | |
| d2c78a3 | 204 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 93.43 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 93.34 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 93.31 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 93.22 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 93.14 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 93.11 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 93.04 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 93.0 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 92.82 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 92.81 | |
| d1osna_ | 331 | Thymidine kinase {Varicella-zoster virus [TaxId: 1 | 92.79 | |
| d1qhla_ | 222 | Cell division protein MukB {Escherichia coli [TaxI | 92.78 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 92.76 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 92.74 | |
| d1p6xa_ | 333 | Thymidine kinase {Equine herpesvirus type 4 [TaxId | 92.74 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 92.65 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 92.65 | |
| d1kk1a3 | 195 | Initiation factor eIF2 gamma subunit, N-terminal ( | 92.57 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 92.55 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 92.51 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 92.4 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 92.37 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 92.33 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 92.21 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 92.17 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 92.16 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 92.1 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 92.01 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 92.0 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 91.98 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 91.9 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 91.84 | |
| d1e2ka_ | 329 | Thymidine kinase {Herpes simplex virus type 1, dif | 91.69 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 91.69 | |
| d1w1wa_ | 427 | Smc head domain {Baker's yeast (Saccharomyces cere | 91.64 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 91.64 | |
| d1d2ea3 | 196 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 91.57 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 91.39 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 91.33 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 91.15 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 91.03 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 90.93 | |
| d1zunb3 | 222 | Sulfate adenylate transferase subunit cysN/C, EF-T | 90.82 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 90.76 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 90.71 | |
| d2qn6a3 | 205 | Initiation factor eIF2 gamma subunit, N-terminal ( | 90.7 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 90.69 | |
| d1cp2a_ | 269 | Nitrogenase iron protein {Clostridium pasteurianum | 90.42 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 89.84 | |
| d2jdid3 | 276 | Central domain of beta subunit of F1 ATP synthase | 89.81 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 89.69 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 89.53 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 89.46 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 89.43 | |
| d2jdid3 | 276 | Central domain of beta subunit of F1 ATP synthase | 89.34 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 89.23 | |
| d1e69a_ | 308 | Smc head domain {Thermotoga maritima [TaxId: 2336] | 89.08 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 89.06 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 89.01 | |
| d1f5na2 | 277 | Interferon-induced guanylate-binding protein 1 (GB | 88.93 | |
| d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 88.86 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 88.48 | |
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 88.21 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 88.18 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 87.99 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 87.74 | |
| d1qhla_ | 222 | Cell division protein MukB {Escherichia coli [TaxI | 87.71 | |
| d2afhe1 | 289 | Nitrogenase iron protein {Azotobacter vinelandii [ | 87.69 | |
| d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 87.26 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 87.01 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 86.9 | |
| d2dy1a2 | 267 | Elongation factor G (EF-G), N-terminal (G) domain | 86.88 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 86.79 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 86.56 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 86.46 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 86.28 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 86.24 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 86.05 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 85.88 | |
| d2bv3a2 | 276 | Elongation factor G (EF-G), N-terminal (G) domain | 85.6 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 85.26 | |
| d1w1wa_ | 427 | Smc head domain {Baker's yeast (Saccharomyces cere | 85.16 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 84.97 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 84.85 | |
| d1cp2a_ | 269 | Nitrogenase iron protein {Clostridium pasteurianum | 84.59 | |
| d2jdia3 | 285 | Central domain of alpha subunit of F1 ATP synthase | 84.4 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 84.27 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 84.19 | |
| d1g8fa3 | 122 | ATP sulfurylase C-terminal domain {Baker's yeast ( | 83.94 | |
| d1p6xa_ | 333 | Thymidine kinase {Equine herpesvirus type 4 [TaxId | 83.31 | |
| d1jnya3 | 224 | Elongation factor eEF-1alpha, N-terminal (G) domai | 82.99 | |
| d1f60a3 | 239 | Elongation factor eEF-1alpha, N-terminal (G) domai | 82.51 | |
| d2jdia3 | 285 | Central domain of alpha subunit of F1 ATP synthase | 82.06 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 81.75 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 81.66 | |
| d1osna_ | 331 | Thymidine kinase {Varicella-zoster virus [TaxId: 1 | 81.59 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 81.57 | |
| d1r5ba3 | 245 | Eukaryotic peptide chain release factor ERF2, G do | 81.46 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 81.33 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 81.28 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 81.03 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 80.98 | |
| d1fx0a3 | 276 | Central domain of alpha subunit of F1 ATP synthase | 80.81 |
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: G proteins domain: Rab3a species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.91 E-value=3.4e-24 Score=149.07 Aligned_cols=91 Identities=42% Similarity=0.888 Sum_probs=85.7
Q ss_pred cceeeEEEEEeCCCCChHHHHHHHHhCCCCCCCCCceeeeeEEEEEEECCeEEEEEEEeCCCccccccchhhhhcCCCEE
Q psy13826 83 YSYIFKYIIIGDMGVGKSCLLHQFTEQKFMPDCPHTIGVEFGTRIIEVHGEKIKLQIWDTAGQERFRAVTRSYYRGAAGA 162 (173)
Q Consensus 83 ~~~~~ki~l~G~~~vGKssl~~~~~~~~~~~~~~~t~~~~~~~~~~~~~~~~~~l~i~D~~g~~~~~~~~~~~~~~~~~~ 162 (173)
+++.+||+++|++|||||||+++|++++|...+.++.+.+.....+......+.+++|||+|++++..+++.+++.+|++
T Consensus 2 ~~~~~Ki~vvG~~~vGKTsLi~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~wDt~G~e~~~~~~~~~~~~ad~~ 81 (169)
T d3raba_ 2 FDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGF 81 (169)
T ss_dssp CSEEEEEEEECSTTSSHHHHHHHHHHSCCCSSCCCCCSEEEEEEEEEETTEEEEEEEEEECCSGGGHHHHHTTTTTCCEE
T ss_pred CCeEEEEEEECCCCcCHHHHHHHHHcCCCCcccccccccceeeEEEEeecceEEEEEEECCCchhhHHHHHHHHhcCCEE
Confidence 56789999999999999999999999999999999999888888888899999999999999999999999999999999
Q ss_pred EEEEeCCCCCC
Q psy13826 163 LMVIDVSHVKE 173 (173)
Q Consensus 163 ilv~d~t~~~S 173 (173)
|+|||+++++|
T Consensus 82 ilv~d~~~~~s 92 (169)
T d3raba_ 82 ILMYDITNEES 92 (169)
T ss_dssp EEEEETTCHHH
T ss_pred EEEEECccchh
Confidence 99999998753
|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} | Back information, alignment and structure |
|---|
| >d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} | Back information, alignment and structure |
|---|
| >d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} | Back information, alignment and structure |
|---|
| >d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} | Back information, alignment and structure |
|---|