Psyllid ID: psy13831


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--
MPDAFTFQPYKVYGTMEQHIHFWLGKNTSTDEAAVAAYKSVELDNYLNGSPVQHREVQGGESIRFRGYFKNGISYHRKVLTH
ccccEEEEEEEEcccEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHcccccEEEcccccccHHHHHcccccEEEEcccccc
cccEEEEcEEEEEccEEEEEEEEEcccccHHHHHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHccccccEEEcEcccc
mpdaftfqpykvygtmEQHIHFWlgkntstdEAAVAAYKSVEldnylngspvqhrevqggesirfrGYFKNGISYHRKVLTH
MPDAFTFQPYKVYGTMEQHIHFWLGKNTSTDEAAVAAYKSVELDnylngspvqhrevqggesirfrgyfkngisyhrkvlth
MPDAFTFQPYKVYGTMEQHIHFWLGKNTSTDEAAVAAYKSVELDNYLNGSPVQHREVQGGESIRFRGYFKNGISYHRKVLTH
****FTFQPYKVYGTMEQHIHFWLGKNTSTDEAAVAAYKSVELDNYLNGSPVQHREVQGGESIRFRGYFKNGISYHR*****
MPDAFTFQPYKVYGTMEQHIHFWLGKNTSTDEAAVAAYKSVELDNYLNGSPVQHREVQGGESIRFRGYFKNGISYHR*****
MPDAFTFQPYKVYGTMEQHIHFWLGKNTSTDEAAVAAYKSVELDNYLNGSPVQHREVQGGESIRFRGYFKNGISYHRKVLTH
MPDAFTFQPYKVYGTMEQHIHFWLGKNTSTDEAAVAAYKSVELDNYLNGSPVQHREVQGGESIRFRGYFKNGISYHRKV***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPDAFTFQPYKVYGTMEQHIHFWLGKNTSTDEAAVAAYKSVELDNYLNGSPVQHREVQGGESIRFRGYFKNGISYHRKVLTH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query82 2.2.26 [Sep-21-2011]
O88398 819 Advillin OS=Mus musculus yes N/A 0.817 0.081 0.567 4e-16
Q9WU06 829 Advillin OS=Rattus norveg yes N/A 0.817 0.080 0.567 4e-16
O75366 819 Advillin OS=Homo sapiens yes N/A 0.817 0.081 0.567 5e-16
Q07171 798 Gelsolin OS=Drosophila me yes N/A 0.707 0.072 0.637 7e-15
Q7JQD3 367 Gelsolin-like protein 1 O N/A N/A 0.841 0.188 0.507 2e-14
Q68FP1 780 Gelsolin OS=Rattus norveg no N/A 0.780 0.082 0.531 2e-14
P20305 772 Gelsolin (Fragment) OS=Su no N/A 0.780 0.082 0.531 3e-14
Q28372 731 Gelsolin OS=Equus caballu no N/A 0.780 0.087 0.531 3e-14
Q3SX14 731 Gelsolin OS=Bos taurus GN no N/A 0.780 0.087 0.531 3e-14
P06396 782 Gelsolin OS=Homo sapiens no N/A 0.780 0.081 0.531 4e-14
>sp|O88398|AVIL_MOUSE Advillin OS=Mus musculus GN=Avil PE=1 SV=2 Back     alignment and function desciption
 Score = 83.2 bits (204), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 38/67 (56%), Positives = 49/67 (73%)

Query: 11  KVYGTMEQHIHFWLGKNTSTDEAAVAAYKSVELDNYLNGSPVQHREVQGGESIRFRGYFK 70
           +V   + Q+IHFW+GK++S DE + AA  + +LD+YL GSPVQHREVQ  ES  FRGYFK
Sbjct: 50  RVGSLLSQNIHFWIGKDSSQDEQSCAAIYTTQLDDYLGGSPVQHREVQYHESDTFRGYFK 109

Query: 71  NGISYHR 77
            GI Y +
Sbjct: 110 QGIIYKK 116




Ca(2+)-regulated actin-binding protein. May have a unique function in the morphogenesis of neuronal cells which form ganglia. Required for SREC1-mediated regulation of neurite-like outgrowth. Plays a role in regenerative sensory axon outgrowth and remodeling processes after peripheral injury in neonates. Involved in the formation of long fine actin-containing filopodia-like structures in fibroblast. Plays a role in ciliogenesis.
Mus musculus (taxid: 10090)
>sp|Q9WU06|AVIL_RAT Advillin OS=Rattus norvegicus GN=Avil PE=2 SV=1 Back     alignment and function description
>sp|O75366|AVIL_HUMAN Advillin OS=Homo sapiens GN=AVIL PE=1 SV=3 Back     alignment and function description
>sp|Q07171|GELS_DROME Gelsolin OS=Drosophila melanogaster GN=Gel PE=1 SV=2 Back     alignment and function description
>sp|Q7JQD3|GELS1_LUMTE Gelsolin-like protein 1 OS=Lumbricus terrestris GN=AM PE=1 SV=1 Back     alignment and function description
>sp|Q68FP1|GELS_RAT Gelsolin OS=Rattus norvegicus GN=Gsn PE=1 SV=1 Back     alignment and function description
>sp|P20305|GELS_PIG Gelsolin (Fragment) OS=Sus scrofa GN=GSN PE=1 SV=1 Back     alignment and function description
>sp|Q28372|GELS_HORSE Gelsolin OS=Equus caballus GN=GSN PE=1 SV=2 Back     alignment and function description
>sp|Q3SX14|GELS_BOVIN Gelsolin OS=Bos taurus GN=GSN PE=2 SV=1 Back     alignment and function description
>sp|P06396|GELS_HUMAN Gelsolin OS=Homo sapiens GN=GSN PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query82
427788725 845 Putative villin-1 [Rhipicephalus pulchel 0.756 0.073 0.666 6e-17
346468069 845 hypothetical protein [Amblyomma maculatu 0.756 0.073 0.634 3e-16
242021163 828 Advillin, putative [Pediculus humanus co 0.719 0.071 0.666 1e-15
189237843 840 PREDICTED: similar to villin [Tribolium 0.756 0.073 0.619 2e-15
321477204 833 hypothetical protein DAPPUDRAFT_311761 [ 0.731 0.072 0.633 3e-15
444509389 804 Advillin [Tupaia chinensis] 0.817 0.083 0.582 5e-15
348580809 807 PREDICTED: advillin-like [Cavia porcellu 0.817 0.083 0.582 5e-15
348684334 1042 hypothetical protein PHYSODRAFT_349852 [ 0.695 0.054 0.689 7e-15
405976016 819 Villin-1 [Crassostrea gigas] 0.792 0.079 0.582 8e-15
427793269 781 Putative scinderin like a, partial [Rhip 0.756 0.079 0.661 9e-15
>gi|427788725|gb|JAA59814.1| Putative villin-1 [Rhipicephalus pulchellus] Back     alignment and taxonomy information
 Score = 91.7 bits (226), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 42/63 (66%), Positives = 48/63 (76%)

Query: 11  KVYGTMEQHIHFWLGKNTSTDEAAVAAYKSVELDNYLNGSPVQHREVQGGESIRFRGYFK 70
           K  G ++ HIHFWLG  TS DEA VAAYK+VELD++L GSPVQHREVQG ES RF  YF 
Sbjct: 65  KAVGNLDIHIHFWLGAQTSQDEAGVAAYKTVELDDFLGGSPVQHREVQGFESQRFLSYFP 124

Query: 71  NGI 73
            G+
Sbjct: 125 RGL 127




Source: Rhipicephalus pulchellus

Species: Rhipicephalus pulchellus

Genus: Rhipicephalus

Family: Ixodidae

Order: Ixodida

Class: Arachnida

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|346468069|gb|AEO33879.1| hypothetical protein [Amblyomma maculatum] Back     alignment and taxonomy information
>gi|242021163|ref|XP_002431015.1| Advillin, putative [Pediculus humanus corporis] gi|212516244|gb|EEB18277.1| Advillin, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|189237843|ref|XP_974681.2| PREDICTED: similar to villin [Tribolium castaneum] gi|270006740|gb|EFA03188.1| hypothetical protein TcasGA2_TC013108 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|321477204|gb|EFX88163.1| hypothetical protein DAPPUDRAFT_311761 [Daphnia pulex] Back     alignment and taxonomy information
>gi|444509389|gb|ELV09226.1| Advillin [Tupaia chinensis] Back     alignment and taxonomy information
>gi|348580809|ref|XP_003476171.1| PREDICTED: advillin-like [Cavia porcellus] Back     alignment and taxonomy information
>gi|348684334|gb|EGZ24149.1| hypothetical protein PHYSODRAFT_349852 [Phytophthora sojae] Back     alignment and taxonomy information
>gi|405976016|gb|EKC40540.1| Villin-1 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|427793269|gb|JAA62086.1| Putative scinderin like a, partial [Rhipicephalus pulchellus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query82
UNIPROTKB|F8VVU1157 AVIL "Advillin" [Homo sapiens 0.792 0.414 0.584 6e-16
UNIPROTKB|Q5T0I0 260 GSN "Gelsolin" [Homo sapiens ( 0.780 0.246 0.531 5.4e-15
UNIPROTKB|Q5T0I1228 GSN "Gelsolin" [Homo sapiens ( 0.780 0.280 0.531 5.4e-15
MGI|MGI:1333798 819 Avil "advillin" [Mus musculus 0.817 0.081 0.567 6.1e-15
RGD|620301 829 Avil "advillin" [Rattus norveg 0.817 0.080 0.567 6.2e-15
UNIPROTKB|F1PBL8 816 AVIL "Uncharacterized protein" 0.756 0.075 0.612 9.9e-15
UNIPROTKB|O75366 819 AVIL "Advillin" [Homo sapiens 0.792 0.079 0.584 9.9e-15
UNIPROTKB|F1MMN9 816 AVIL "Uncharacterized protein" 0.756 0.075 0.596 1.6e-14
UNIPROTKB|I3LI80 819 AVIL "Uncharacterized protein" 0.756 0.075 0.596 1.6e-14
UNIPROTKB|Q7JQD3 367 AM "Gelsolin-like protein 1" [ 0.841 0.188 0.507 1.8e-14
UNIPROTKB|F8VVU1 AVIL "Advillin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 199 (75.1 bits), Expect = 6.0e-16, P = 6.0e-16
 Identities = 38/65 (58%), Positives = 47/65 (72%)

Query:    11 KVYGTMEQHIHFWLGKNTSTDEAAVAAYKSVELDNYLNGSPVQHREVQGGESIRFRGYFK 70
             +V   + Q IHFW+GK++S DE + AA  + +LD+YL GSPVQHREVQ  ES  FRGYFK
Sbjct:    50 RVASLLSQDIHFWIGKDSSQDEQSCAAIYTTQLDDYLGGSPVQHREVQYHESDTFRGYFK 109

Query:    71 NGISY 75
              GI Y
Sbjct:   110 QGIIY 114




GO:0003779 "actin binding" evidence=IEA
GO:0006950 "response to stress" evidence=IEA
GO:0010976 "positive regulation of neuron projection development" evidence=IEA
UNIPROTKB|Q5T0I0 GSN "Gelsolin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5T0I1 GSN "Gelsolin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1333798 Avil "advillin" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|620301 Avil "advillin" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1PBL8 AVIL "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O75366 AVIL "Advillin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MMN9 AVIL "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|I3LI80 AVIL "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q7JQD3 AM "Gelsolin-like protein 1" [Lumbricus terrestris (taxid:6398)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O88398AVIL_MOUSENo assigned EC number0.56710.81700.0818yesN/A
O75366AVIL_HUMANNo assigned EC number0.56710.81700.0818yesN/A
Q9WU06AVIL_RATNo assigned EC number0.56710.81700.0808yesN/A
Q21253GELS1_CAEELNo assigned EC number0.60710.68290.1178yesN/A
O81644VILI2_ARATHNo assigned EC number0.62960.65850.0553yesN/A
Q07171GELS_DROMENo assigned EC number0.63790.70730.0726yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query82
cd11290113 cd11290, gelsolin_S1_like, Gelsolin sub-domain 1-l 1e-31
smart0026290 smart00262, GEL, Gelsolin homology domain 1e-14
cd11293101 cd11293, gelsolin_S4_like, Gelsolin sub-domain 4-l 2e-12
pfam0062676 pfam00626, Gelsolin, Gelsolin repeat 6e-11
cd1128088 cd11280, gelsolin_like, Tandemly repeated domains 7e-08
cd1129298 cd11292, gelsolin_S3_like, Gelsolin sub-domain 3-l 2e-06
cd1129199 cd11291, gelsolin_S6_like, Gelsolin sub-domain 6-l 1e-04
>gnl|CDD|200446 cd11290, gelsolin_S1_like, Gelsolin sub-domain 1-like domain found in gelsolin, severin, villin, and related proteins Back     alignment and domain information
 Score =  105 bits (265), Expect = 1e-31
 Identities = 39/62 (62%), Positives = 44/62 (70%)

Query: 14  GTMEQHIHFWLGKNTSTDEAAVAAYKSVELDNYLNGSPVQHREVQGGESIRFRGYFKNGI 73
           G++   IH+WLGK  S DEA  AA K+VELD+YL G PVQHREVQG ES  F  YFK GI
Sbjct: 48  GSLSYDIHYWLGKEASQDEAGAAAIKAVELDDYLGGRPVQHREVQGHESEEFLSYFKKGI 107

Query: 74  SY 75
            Y
Sbjct: 108 IY 109


Gelsolin repeats occur in gelsolin, severin, villin, advillin, villidin, supervillin, flightless, quail, fragmin, and other proteins, usually in several copies. They co-occur with villin headpiece domains, leucine-rich repeats, and several other domains. These gelsolin-related actin binding proteins (GRABPs) play regulatory roles in the assembly and disassembly of actin filaments; they are involved in F-actin capping, uncapping, severing, or the nucleation of actin filaments. Severing of actin filaments is Ca2+ dependent. Villins are also linked to generating bundles of F-actin with uniform filament polarity, which is most likely mediated by their extra villin headpiece domain. Many family members have also adopted functions in the nucleus, including the regulation of transcription. Supervillin, gelsolin, and flightless I are involved in intracellular signaling via nuclear hormone receptors. The gelsolin_like domain is distantly related to the actin depolymerizing domains found in cofilin and similar proteins. Length = 113

>gnl|CDD|214590 smart00262, GEL, Gelsolin homology domain Back     alignment and domain information
>gnl|CDD|200449 cd11293, gelsolin_S4_like, Gelsolin sub-domain 4-like domain found in gelsolin, severin, villin, and related proteins Back     alignment and domain information
>gnl|CDD|201354 pfam00626, Gelsolin, Gelsolin repeat Back     alignment and domain information
>gnl|CDD|200436 cd11280, gelsolin_like, Tandemly repeated domains found in gelsolin, severin, villin, and related proteins Back     alignment and domain information
>gnl|CDD|200448 cd11292, gelsolin_S3_like, Gelsolin sub-domain 3-like domain found in gelsolin, severin, villin, and related proteins Back     alignment and domain information
>gnl|CDD|200447 cd11291, gelsolin_S6_like, Gelsolin sub-domain 6-like domain found in gelsolin, severin, villin, and related proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 82
KOG0443|consensus 827 99.91
KOG0443|consensus 827 99.9
KOG0445|consensus 919 99.61
KOG0444|consensus 1255 99.54
smart0026290 GEL Gelsolin homology domain. Gelsolin/severin/vil 99.53
PF0062676 Gelsolin: Gelsolin repeat; InterPro: IPR007123 Gel 99.43
KOG0444|consensus 1255 97.92
PF00241127 Cofilin_ADF: Cofilin/tropomyosin-type actin-bindin 95.05
smart00102127 ADF Actin depolymerisation factor/cofilin -like do 94.83
cd00013132 ADF Actin depolymerisation factor/cofilin -like do 92.36
PLN03216141 actin depolymerizing factor; Provisional 89.42
KOG0445|consensus 919 87.22
KOG3655|consensus 484 83.51
>KOG0443|consensus Back     alignment and domain information
Probab=99.91  E-value=1e-24  Score=175.68  Aligned_cols=80  Identities=28%  Similarity=0.370  Sum_probs=75.2

Q ss_pred             Ccee-eeeeeeCC-ceeEEEEEEeCCCCCHHHHHHHHHHHHHHHHHcCCCCeEEEeecCCCChhHHhcccCCEEEEeccc
Q psy13831          3 DAFT-FQPYKVYG-TMEQHIHFWLGKNTSTDEAAVAAYKSVELDNYLNGSPVQHREVQGGESIRFRGYFKNGISYHRKVL   80 (82)
Q Consensus         3 ~~~~-~yty~~~~-~~~~~iy~W~G~~ss~de~~aaa~~a~~ld~~l~~~~vq~Rv~QGkEp~~Fl~lFkg~~ii~~G~~   80 (82)
                      |||+ +|||+..+ +.+++||.|+|++|++||+++|+.+|++|++.++|.|+|+|++||||||||++||+|+|||++|+.
T Consensus       426 dcYlvlYtY~~~~~~~~~iiY~W~G~qAs~ee~~~a~~~A~~l~~s~kg~~vq~rv~~GkEP~hF~~iFqgkliifkgg~  505 (827)
T KOG0443|consen  426 DCYLVLYTYPRGEERTEHIIYVWQGKQASQEERAAAISLAKALVESLKGVPVQVRIYEGKEPPHFLAIFQGKLIIFKGGT  505 (827)
T ss_pred             CeEEEEEeeccCCcccceEEEEEecccCCHHHHHHHHHHHHHHhhhcCCceeEEEeecCCCChHHHHhhCCceEEEecCc
Confidence            8886 58888555 899999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             CC
Q psy13831         81 TH   82 (82)
Q Consensus        81 ~~   82 (82)
                      ||
T Consensus       506 s~  507 (827)
T KOG0443|consen  506 SE  507 (827)
T ss_pred             CC
Confidence            75



>KOG0443|consensus Back     alignment and domain information
>KOG0445|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>smart00262 GEL Gelsolin homology domain Back     alignment and domain information
>PF00626 Gelsolin: Gelsolin repeat; InterPro: IPR007123 Gelsolin is a cytoplasmic, calcium-regulated, actin-modulating protein that binds to the barbed ends of actin filaments, preventing monomer exchange (end-blocking or capping) [] Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>PF00241 Cofilin_ADF: Cofilin/tropomyosin-type actin-binding protein; InterPro: IPR002108 The actin-depolymerising factor homology (ADF-H) domain is an ~150-amino acid motif that is present in three phylogenetically distinct classes of eukaryotic actin-binding proteins [, , ]: ADF/cofilins, which include ADF, cofilin, destrin, actophorin, coactosin, depactin and glia maturation factors (GMFs) beta and gamma Back     alignment and domain information
>smart00102 ADF Actin depolymerisation factor/cofilin -like domains Back     alignment and domain information
>cd00013 ADF Actin depolymerisation factor/cofilin -like domains; present in a family of essential eukaryotic actin regulatory proteins; these proteins enhance the turnover rate of actin and interact with actin monomers as well as actin filaments Back     alignment and domain information
>PLN03216 actin depolymerizing factor; Provisional Back     alignment and domain information
>KOG0445|consensus Back     alignment and domain information
>KOG3655|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query82
1eqy_S125 Complex Between Rabbit Muscle Alpha-Actin: Human Ge 2e-15
1c0f_S127 Crystal Structure Of Dictyostelium Caatp-Actin In C 2e-15
1yag_G125 Structure Of The Yeast Actin-human Gelsolin Segment 2e-15
1d4x_G126 Crystal Structure Of Caenorhabditis Elegans Mg-Atp 2e-15
1rgi_G 346 Crystal Structure Of Gelsolin Domains G1-G3 Bound T 2e-15
1p8z_G136 Complex Between Rabbit Muscle Alpha-Actin: Human Ge 2e-15
3ffk_A 377 Crystal Structure Of Human Gelsolin Domains G1-G3 B 2e-15
3ci5_G126 Complex Of Phosphorylated Dictyostelium Discoideum 2e-15
3tu5_B 297 Actin Complex With Gelsolin Segment 1 Fused To Cobl 2e-15
3cip_G128 Complex Of Dictyostelium Discoideum Actin With Gels 2e-15
1d0n_A 729 The Crystal Structure Of Calcium-Free Equine Plasma 3e-15
2fgh_A 731 Atp Bound Gelsolin Length = 731 3e-15
1t44_G147 Structural Basis Of Actin Sequestration By Thymosin 3e-15
3ffn_A 782 Crystal Structure Of Calcium-Free Human Gelsolin Le 3e-15
2ff3_A150 Crystal Structure Of Gelsolin Domain 1:n-Wasp V2 Mo 3e-15
1jhw_A 347 Ca2+-Binding Mimicry In The Crystal Structure Of Th 8e-14
1j72_A 347 Crystal Structure Of Mutant Macrophage Capping Prot 8e-14
2vik_A126 Refined Structure Of The Actin-Severing Domain Vill 2e-13
1p8x_A 344 The Calcium-activated C-terminal Half Of Gelsolin L 1e-05
1h1v_G 331 Gelsolin G4-G6ACTIN COMPLEX Length = 331 1e-05
1nph_A 329 Gelsolin Domains 4-6 In Active, Actin Free Conforma 1e-05
3fg6_A 371 Structure Of The C-terminus Of Adseverin Length = 3 5e-05
3fg7_A 398 The Crystal Structure Of Villin Domain 6 Length = 3 2e-04
>pdb|1EQY|S Chain S, Complex Between Rabbit Muscle Alpha-Actin: Human Gelsolin Domain 1 Length = 125 Back     alignment and structure

Iteration: 1

Score = 77.4 bits (189), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 34/64 (53%), Positives = 45/64 (70%) Query: 14 GTMEQHIHFWLGKNTSTDEAAVAAYKSVELDNYLNGSPVQHREVQGGESIRFRGYFKNGI 73 G ++ +H+WLG S DE+ AA +V+LD+YLNG VQHREVQG ES F GYFK+G+ Sbjct: 55 GNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGL 114 Query: 74 SYHR 77 Y + Sbjct: 115 KYKK 118
>pdb|1C0F|S Chain S, Crystal Structure Of Dictyostelium Caatp-Actin In Complex With Gelsolin Segment 1 Length = 127 Back     alignment and structure
>pdb|1YAG|G Chain G, Structure Of The Yeast Actin-human Gelsolin Segment 1 Complex Length = 125 Back     alignment and structure
>pdb|1D4X|G Chain G, Crystal Structure Of Caenorhabditis Elegans Mg-Atp Actin Complexed With Human Gelsolin Segment 1 At 1.75 A Resolution Length = 126 Back     alignment and structure
>pdb|1RGI|G Chain G, Crystal Structure Of Gelsolin Domains G1-G3 Bound To Actin Length = 346 Back     alignment and structure
>pdb|1P8Z|G Chain G, Complex Between Rabbit Muscle Alpha-Actin: Human Gelsolin Residues Val26-Glu156 Length = 136 Back     alignment and structure
>pdb|3FFK|A Chain A, Crystal Structure Of Human Gelsolin Domains G1-G3 Bound To Actin Length = 377 Back     alignment and structure
>pdb|3CI5|G Chain G, Complex Of Phosphorylated Dictyostelium Discoideum Actin With Gelsolin Length = 126 Back     alignment and structure
>pdb|3TU5|B Chain B, Actin Complex With Gelsolin Segment 1 Fused To Cobl Segment Length = 297 Back     alignment and structure
>pdb|3CIP|G Chain G, Complex Of Dictyostelium Discoideum Actin With Gelsolin Length = 128 Back     alignment and structure
>pdb|1D0N|A Chain A, The Crystal Structure Of Calcium-Free Equine Plasma Gelsolin. Length = 729 Back     alignment and structure
>pdb|2FGH|A Chain A, Atp Bound Gelsolin Length = 731 Back     alignment and structure
>pdb|1T44|G Chain G, Structural Basis Of Actin Sequestration By Thymosin-B4: Implications For Arp23 ACTIVATION Length = 147 Back     alignment and structure
>pdb|3FFN|A Chain A, Crystal Structure Of Calcium-Free Human Gelsolin Length = 782 Back     alignment and structure
>pdb|2FF3|A Chain A, Crystal Structure Of Gelsolin Domain 1:n-Wasp V2 Motif Hybrid In Complex With Actin Length = 150 Back     alignment and structure
>pdb|1JHW|A Chain A, Ca2+-Binding Mimicry In The Crystal Structure Of The Eu3+-Bound Mutant Human Macrophage Capping Protein Cap G Length = 347 Back     alignment and structure
>pdb|1J72|A Chain A, Crystal Structure Of Mutant Macrophage Capping Protein (Cap G) With Actin-Severing Activity In The Ca2+-Free Form Length = 347 Back     alignment and structure
>pdb|2VIK|A Chain A, Refined Structure Of The Actin-Severing Domain Villin 14t, Determined By Solution Nmr, Minimized Average Structure Length = 126 Back     alignment and structure
>pdb|1P8X|A Chain A, The Calcium-activated C-terminal Half Of Gelsolin Length = 344 Back     alignment and structure
>pdb|1H1V|G Chain G, Gelsolin G4-G6ACTIN COMPLEX Length = 331 Back     alignment and structure
>pdb|1NPH|A Chain A, Gelsolin Domains 4-6 In Active, Actin Free Conformation Identifies Sites Of Regulatory Calcium Ions Length = 329 Back     alignment and structure
>pdb|3FG6|A Chain A, Structure Of The C-terminus Of Adseverin Length = 371 Back     alignment and structure
>pdb|3FG7|A Chain A, The Crystal Structure Of Villin Domain 6 Length = 398 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query82
3cip_G128 Gelsolin; actin, dictyostelium discoideum, actin-a 6e-21
2vik_A126 Villin 14T; actin-binding protein, capping protein 1e-20
1t44_G147 Chimera of gelsolin domain 1 and C-terminal domain 1e-18
2ff3_A150 Gelsolin; protein-protein complex, structural prot 1e-18
1d0n_A 729 Horse plasma gelsolin; mixed alpha-beta structure, 5e-18
1d0n_A 729 Horse plasma gelsolin; mixed alpha-beta structure, 4e-14
1d0n_A 729 Horse plasma gelsolin; mixed alpha-beta structure, 8e-04
1j72_A 347 Macrophage capping protein; actin, human, CAP G, G 5e-17
1j72_A347 Macrophage capping protein; actin, human, CAP G, G 4e-04
2fh1_A 344 Gelsolin; calcium, contractIle protein; 1.55A {Hom 7e-15
3fg7_A 398 Villin-1; actin binding protein, gelsolin, actin c 2e-14
3fg6_A 371 Adseverin, scinderin; C-terminus of adseverin, act 3e-13
>3cip_G Gelsolin; actin, dictyostelium discoideum, actin-associated methyl histidine, ATP-binding, cytoskeleton, nucleotide-BIN phosphoprotein; HET: HIC ATP; 1.60A {Homo sapiens} SCOP: d.109.1.1 PDB: 3ci5_G* 1p8z_G* 1d4x_G* 1nlv_G* 1mdu_A* 1nm1_G* 1nmd_G* 1yag_G* 1yvn_G* 3cjb_G* 3cjc_G* 1esv_S* 1eqy_S* 1c0g_S* 1c0f_S* 1dej_S* 3a5l_S* 3a5m_S* 3a5n_S* 3a5o_S* Length = 128 Back     alignment and structure
 Score = 78.8 bits (194), Expect = 6e-21
 Identities = 34/64 (53%), Positives = 45/64 (70%)

Query: 14  GTMEQHIHFWLGKNTSTDEAAVAAYKSVELDNYLNGSPVQHREVQGGESIRFRGYFKNGI 73
           G ++  +H+WLG   S DE+  AA  +V+LD+YLNG  VQHREVQG ES  F GYFK+G+
Sbjct: 58  GNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGL 117

Query: 74  SYHR 77
            Y +
Sbjct: 118 KYKK 121


>2vik_A Villin 14T; actin-binding protein, capping protein, calcium-binding protein, cytoskeletal protein; NMR {Gallus gallus} SCOP: d.109.1.1 PDB: 2vil_A Length = 126 Back     alignment and structure
>1t44_G Chimera of gelsolin domain 1 and C-terminal domain of thymosin beta-4; structural protein; HET: ATP; 2.00A {Homo sapiens} SCOP: d.109.1.1 Length = 147 Back     alignment and structure
>2ff3_A Gelsolin; protein-protein complex, structural protein/contractIle protein complex; HET: ATP; 2.00A {Homo sapiens} SCOP: d.109.1.1 PDB: 2ff6_G* Length = 150 Back     alignment and structure
>1d0n_A Horse plasma gelsolin; mixed alpha-beta structure, actin-binding protein, protein D packing, contractIle protein; 2.50A {Equus caballus} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 PDB: 2fgh_A* 3ffn_A 3ffk_A* 1rgi_G* Length = 729 Back     alignment and structure
>1d0n_A Horse plasma gelsolin; mixed alpha-beta structure, actin-binding protein, protein D packing, contractIle protein; 2.50A {Equus caballus} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 PDB: 2fgh_A* 3ffn_A 3ffk_A* 1rgi_G* Length = 729 Back     alignment and structure
>1d0n_A Horse plasma gelsolin; mixed alpha-beta structure, actin-binding protein, protein D packing, contractIle protein; 2.50A {Equus caballus} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 PDB: 2fgh_A* 3ffn_A 3ffk_A* 1rgi_G* Length = 729 Back     alignment and structure
>1j72_A Macrophage capping protein; actin, human, CAP G, GCAP39, MBHL, GELS structural protein; 2.50A {Homo sapiens} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 PDB: 1jhw_A Length = 347 Back     alignment and structure
>1j72_A Macrophage capping protein; actin, human, CAP G, GCAP39, MBHL, GELS structural protein; 2.50A {Homo sapiens} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 PDB: 1jhw_A Length = 347 Back     alignment and structure
>2fh1_A Gelsolin; calcium, contractIle protein; 1.55A {Homo sapiens} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 PDB: 1p8x_A 2fh2_A 2fh3_A 2fh4_A 1h1v_G* 1nph_A Length = 344 Back     alignment and structure
>3fg7_A Villin-1; actin binding protein, gelsolin, actin capping, actin-binding, calcium, cytoplasm, cytoskeleton, structural protein; 2.00A {Homo sapiens} Length = 398 Back     alignment and structure
>3fg6_A Adseverin, scinderin; C-terminus of adseverin, actin capping, actin-binding, cytos phosphoprotein, actin-binding protein; 3.00A {Homo sapiens} Length = 371 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query82
3cip_G128 Gelsolin; actin, dictyostelium discoideum, actin-a 100.0
2vik_A126 Villin 14T; actin-binding protein, capping protein 100.0
2ff3_A150 Gelsolin; protein-protein complex, structural prot 100.0
1t44_G147 Chimera of gelsolin domain 1 and C-terminal domain 100.0
3tu5_B 297 Gelsolin, protein cordon-BLeu, thymosin beta-4; un 99.97
2fh1_A 344 Gelsolin; calcium, contractIle protein; 1.55A {Hom 99.96
1j72_A 347 Macrophage capping protein; actin, human, CAP G, G 99.96
3fg6_A 371 Adseverin, scinderin; C-terminus of adseverin, act 99.95
1d0n_A 729 Horse plasma gelsolin; mixed alpha-beta structure, 99.95
3fg7_A 398 Villin-1; actin binding protein, gelsolin, actin c 99.95
1d0n_A 729 Horse plasma gelsolin; mixed alpha-beta structure, 99.95
1j72_A 347 Macrophage capping protein; actin, human, CAP G, G 99.22
1kcq_A104 Gelsolin, brevin, ADF, AGEL; alpha-beta structure, 99.17
1svq_A114 Severin; actin-binding; NMR {Dictyostelium discoid 99.04
3fg7_A398 Villin-1; actin binding protein, gelsolin, actin c 98.61
3fg6_A371 Adseverin, scinderin; C-terminus of adseverin, act 98.61
2fh1_A344 Gelsolin; calcium, contractIle protein; 1.55A {Hom 98.56
1x67_A146 Drebrin-like protein; cell-free protein synthesis, 96.23
1cfy_A143 Cofilin; actin-binding, cytoskeleton, actin-bindin 95.54
1f7s_A139 Actin depolymerizing factor (ADF); KINK in alpha-h 95.44
1cnu_A137 Actophorin, ADF, cofilin; actin-binding protein, c 94.98
2xfa_A148 Actin depolymerization factor 2; actin binding pro 94.89
2i2q_A137 Cofilin; N-terminal serine, actin-binding protein; 94.7
1m4j_A142 A6 gene product, twinfilin; mixed beta-sheet, PAIR 94.59
1hqz_1141 ABP1P, actin-binding protein; cofilin homology dom 94.58
1tvj_A166 Cofilin; ADF, actin binding protein, actin depolym 94.43
2vac_A134 Twinfilin-2; transferase, actin binding, phosphory 94.26
2kd5_A144 ADF H, actin severing and dynamics regulatory prot 94.19
2kvk_A144 Actin severing and dynamics regulatory protein; AD 93.69
3q2b_A124 Pfadf1, cofilin/actin-depolymerizing factor homolo 93.31
2lj8_A144 Cofilin/actin depolymerizing factor, putative; pro 92.62
2l72_A139 Tgadf, actin depolymerizing factor, putative; ADF/ 90.76
2w0i_A135 Twinfilin-2; cytoskeleton, actin-binding, actin bi 88.56
1v6f_A151 MGMF-beta, GLIA maturation factor, beta; actin bin 86.77
1t3y_A141 Coactosin-like protein; beta sheet, protein bindin 86.57
1ak6_A174 Destrin; actin depolymerization factor, actin-bind 86.46
1vkk_A154 GMF-gamma, GLIA maturation factor gamma; 15079298, 84.99
2d8b_A166 Twinfilin-1; cell-free protein synthesis, actin-bi 84.11
3daw_B164 Twinfilin-1, protein A6; actin depolymerisation, a 83.61
>3cip_G Gelsolin; actin, dictyostelium discoideum, actin-associated methyl histidine, ATP-binding, cytoskeleton, nucleotide-BIN phosphoprotein; HET: HIC ATP; 1.60A {Homo sapiens} SCOP: d.109.1.1 PDB: 3ci5_G* 1p8z_G* 1d4x_G* 1nlv_G* 1mdu_A* 1nm1_G* 1nmd_G* 1yag_G* 1yvn_G* 3cjb_G* 3cjc_G* 1esv_S* 1eqy_S* 1c0g_S* 1c0f_S* 1dej_S* 3a5l_S* 3a5m_S* 3a5n_S* 3a5o_S* Back     alignment and structure
Probab=100.00  E-value=7.7e-34  Score=187.31  Aligned_cols=79  Identities=46%  Similarity=0.847  Sum_probs=73.9

Q ss_pred             Ccee-eeeeeeC-CceeEEEEEEeCCCCCHHHHHHHHHHHHHHHHHcCCCCeEEEeecCCCChhHHhcccCCEEEEeccc
Q psy13831          3 DAFT-FQPYKVY-GTMEQHIHFWLGKNTSTDEAAVAAYKSVELDNYLNGSPVQHREVQGGESIRFRGYFKNGISYHRKVL   80 (82)
Q Consensus         3 ~~~~-~yty~~~-~~~~~~iy~W~G~~ss~de~~aaa~~a~~ld~~l~~~~vq~Rv~QGkEp~~Fl~lFkg~~ii~~G~~   80 (82)
                      |||| +|||... ++..++||||+|++||+||+++||++|++||++|++.|+|+||+||+||+|||+||+++|+|++|+.
T Consensus        45 d~YIvl~ty~~~~g~~~~~i~~W~G~~ss~de~g~Aa~~aveLd~~lgg~~vq~R~~QG~E~~~Fl~~F~~~iii~~Gg~  124 (128)
T 3cip_G           45 DAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGV  124 (128)
T ss_dssp             CEEEEEEEEECTTSCEEEEEEEEECTTCCHHHHHHHHHHHHHHHHHTTTCEEEEEEETTCCCHHHHTTCTTCCEEESCCC
T ss_pred             CeEEEEEEEecCCCceEEEEEEEcCCCCCcchHHHHHHHHHHHHHHcCCCceEEEeECCCCCHHHHHHhCCCeEEEECCc
Confidence            8987 6888654 5789999999999999999999999999999999999999999999999999999999999999997


Q ss_pred             C
Q psy13831         81 T   81 (82)
Q Consensus        81 ~   81 (82)
                      +
T Consensus       125 ~  125 (128)
T 3cip_G          125 A  125 (128)
T ss_dssp             C
T ss_pred             C
Confidence            5



>2vik_A Villin 14T; actin-binding protein, capping protein, calcium-binding protein, cytoskeletal protein; NMR {Gallus gallus} SCOP: d.109.1.1 PDB: 2vil_A Back     alignment and structure
>2ff3_A Gelsolin; protein-protein complex, structural protein/contractIle protein complex; HET: ATP; 2.00A {Homo sapiens} SCOP: d.109.1.1 PDB: 2ff6_G* Back     alignment and structure
>1t44_G Chimera of gelsolin domain 1 and C-terminal domain of thymosin beta-4; structural protein; HET: ATP; 2.00A {Homo sapiens} SCOP: d.109.1.1 Back     alignment and structure
>3tu5_B Gelsolin, protein cordon-BLeu, thymosin beta-4; unusual hairpin conformation in the D-loop, structural prote binding protein complex; HET: ATP; 3.00A {Homo sapiens} Back     alignment and structure
>2fh1_A Gelsolin; calcium, contractIle protein; 1.55A {Homo sapiens} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 PDB: 1p8x_A 2fh2_A 2fh3_A 2fh4_A 1h1v_G* 1nph_A Back     alignment and structure
>1j72_A Macrophage capping protein; actin, human, CAP G, GCAP39, MBHL, GELS structural protein; 2.50A {Homo sapiens} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 PDB: 1jhw_A Back     alignment and structure
>3fg6_A Adseverin, scinderin; C-terminus of adseverin, actin capping, actin-binding, cytos phosphoprotein, actin-binding protein; 3.00A {Homo sapiens} Back     alignment and structure
>1d0n_A Horse plasma gelsolin; mixed alpha-beta structure, actin-binding protein, protein D packing, contractIle protein; 2.50A {Equus caballus} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 PDB: 2fgh_A* 3ffn_A 3ffk_A* 1rgi_G* Back     alignment and structure
>3fg7_A Villin-1; actin binding protein, gelsolin, actin capping, actin-binding, calcium, cytoplasm, cytoskeleton, structural protein; 2.00A {Homo sapiens} PDB: 2llf_A Back     alignment and structure
>1d0n_A Horse plasma gelsolin; mixed alpha-beta structure, actin-binding protein, protein D packing, contractIle protein; 2.50A {Equus caballus} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 PDB: 2fgh_A* 3ffn_A 3ffk_A* 1rgi_G* Back     alignment and structure
>1j72_A Macrophage capping protein; actin, human, CAP G, GCAP39, MBHL, GELS structural protein; 2.50A {Homo sapiens} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 PDB: 1jhw_A Back     alignment and structure
>1kcq_A Gelsolin, brevin, ADF, AGEL; alpha-beta structure, actin-binding protein, familial amyloi finnish type, cadmium binding, metal binding; 1.65A {Homo sapiens} SCOP: d.109.1.1 Back     alignment and structure
>1svq_A Severin; actin-binding; NMR {Dictyostelium discoideum} SCOP: d.109.1.1 PDB: 1svr_A 1svy_A Back     alignment and structure
>3fg7_A Villin-1; actin binding protein, gelsolin, actin capping, actin-binding, calcium, cytoplasm, cytoskeleton, structural protein; 2.00A {Homo sapiens} PDB: 2llf_A Back     alignment and structure
>3fg6_A Adseverin, scinderin; C-terminus of adseverin, actin capping, actin-binding, cytos phosphoprotein, actin-binding protein; 3.00A {Homo sapiens} Back     alignment and structure
>2fh1_A Gelsolin; calcium, contractIle protein; 1.55A {Homo sapiens} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 PDB: 1p8x_A 2fh2_A 2fh3_A 2fh4_A 1h1v_G* 1nph_A Back     alignment and structure
>1x67_A Drebrin-like protein; cell-free protein synthesis, actin-binding protein, SH3P7, MABP1, T-cell lymphocyte signaling and regulation; NMR {Homo sapiens} Back     alignment and structure
>1cfy_A Cofilin; actin-binding, cytoskeleton, actin-binding protein; 2.30A {Saccharomyces cerevisiae} SCOP: d.109.1.2 PDB: 1cof_A 1qpv_A Back     alignment and structure
>1f7s_A Actin depolymerizing factor (ADF); KINK in alpha-helix 3, plant protein; HET: LDA; 2.00A {Arabidopsis thaliana} SCOP: d.109.1.2 Back     alignment and structure
>1cnu_A Actophorin, ADF, cofilin; actin-binding protein, contractIle; 2.25A {Acanthamoeba polyphaga} SCOP: d.109.1.2 PDB: 1ahq_A Back     alignment and structure
>2xfa_A Actin depolymerization factor 2; actin binding protein, protein binding; 2.10A {Plasmodium berghei} Back     alignment and structure
>2i2q_A Cofilin; N-terminal serine, actin-binding protein; HET: LDA; 1.72A {Schizosaccharomyces pombe} Back     alignment and structure
>1m4j_A A6 gene product, twinfilin; mixed beta-sheet, PAIR of alpha-helices, structural protein; 1.60A {Mus musculus} SCOP: d.109.1.2 Back     alignment and structure
>1hqz_1 ABP1P, actin-binding protein; cofilin homology domain, NEW YORK SGX researc for structural genomics, NYSGXRC, structural genomics, PSI; 2.10A {Saccharomyces cerevisiae} SCOP: d.109.1.2 Back     alignment and structure
>1tvj_A Cofilin; ADF, actin binding protein, actin depolymerizing factor, actin-binding protein; NMR {Gallus gallus} Back     alignment and structure
>2vac_A Twinfilin-2; transferase, actin binding, phosphorylation, cofilin-like, cytoskeleton, actin-binding, protein tyrosine kinase-9; 1.70A {Homo sapiens} Back     alignment and structure
>2kvk_A Actin severing and dynamics regulatory protein; ADF/cofilin, hormone; NMR {Leishmania donovani} Back     alignment and structure
>3q2b_A Pfadf1, cofilin/actin-depolymerizing factor homolog 1; actin regulator, actin-binding protein; HET: TAR; 1.60A {Plasmodium falciparum} PDB: 2xf1_A Back     alignment and structure
>2lj8_A Cofilin/actin depolymerizing factor, putative; protein binding; NMR {Trypanosoma brucei} Back     alignment and structure
>2l72_A Tgadf, actin depolymerizing factor, putative; ADF/cofilin, actin binding, protein binding; NMR {Toxoplasma gondii} Back     alignment and structure
>2w0i_A Twinfilin-2; cytoskeleton, actin-binding, actin binding, cofilin-like, phosphoprotein, phosphorylation, transferase, protein tyros kinase-9; 1.8A {Homo sapiens} Back     alignment and structure
>1v6f_A MGMF-beta, GLIA maturation factor, beta; actin binding protein, cytoskeleton, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.109.1.2 Back     alignment and structure
>1t3y_A Coactosin-like protein; beta sheet, protein binding; 1.15A {Homo sapiens} SCOP: d.109.1.2 PDB: 1t2l_A 1t3x_A 1vfq_A 1tmw_A 1wnj_A 1udm_A 1wm4_A Back     alignment and structure
>1ak6_A Destrin; actin depolymerization factor, actin-binding protein; NMR {Homo sapiens} SCOP: d.109.1.2 PDB: 1ak7_A 1q8g_A 1q8x_A 3j0s_M Back     alignment and structure
>1vkk_A GMF-gamma, GLIA maturation factor gamma; 15079298, structural GEN JCSG, protein structure initiative, PSI, joint center for S genomics; 1.35A {Mus musculus} SCOP: d.109.1.2 PDB: 1wfs_A 3l50_A Back     alignment and structure
>2d8b_A Twinfilin-1; cell-free protein synthesis, actin-binding protein, developmental regulation, cellular remodeling, cytoskeleton, morphology; NMR {Mus musculus} Back     alignment and structure
>3daw_B Twinfilin-1, protein A6; actin depolymerisation, actin binding proteins, cytoskeleton, structural protein/contractIle protein complex; HET: ATP; 2.55A {Mus musculus} PDB: 2hd7_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 82
d1j72a1114 d.109.1.1 (A:11-124) Macrophage capping protein Ca 7e-23
d3cipg1124 d.109.1.1 (G:2-125) Gelsolin {Human (Homo sapiens) 4e-21
d2vika_126 d.109.1.1 (A:) Villin, domain 1 (res. 1-126) {Chic 7e-21
d2fh1a1121 d.109.1.1 (A:412-532) Gelsolin {Human (Homo sapien 7e-20
d1j72a3107 d.109.1.1 (A:241-347) Macrophage capping protein C 2e-08
d1d0na3121 d.109.1.1 (A:263-383) Gelsolin {Horse (Equus cabal 1e-06
>d1j72a1 d.109.1.1 (A:11-124) Macrophage capping protein Cap G {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Gelsolin-like
superfamily: Actin depolymerizing proteins
family: Gelsolin-like
domain: Macrophage capping protein Cap G
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 82.2 bits (203), Expect = 7e-23
 Identities = 30/68 (44%), Positives = 38/68 (55%)

Query: 10  YKVYGTMEQHIHFWLGKNTSTDEAAVAAYKSVELDNYLNGSPVQHREVQGGESIRFRGYF 69
                    H+H W+G+ +S DE    A  +V+LD+YL G PVQHREVQG ES  F  YF
Sbjct: 41  LHNGPEEVSHLHLWIGQQSSRDEQGACAVLAVQLDDYLGGRPVQHREVQGNESDLFMSYF 100

Query: 70  KNGISYHR 77
             G+ Y  
Sbjct: 101 PRGLKYQE 108


>d3cipg1 d.109.1.1 (G:2-125) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d2vika_ d.109.1.1 (A:) Villin, domain 1 (res. 1-126) {Chicken (Gallus gallus) [TaxId: 9031]} Length = 126 Back     information, alignment and structure
>d2fh1a1 d.109.1.1 (A:412-532) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} Length = 121 Back     information, alignment and structure
>d1j72a3 d.109.1.1 (A:241-347) Macrophage capping protein Cap G {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1d0na3 d.109.1.1 (A:263-383) Gelsolin {Horse (Equus caballus) [TaxId: 9796]} Length = 121 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query82
d2fh1a1121 Gelsolin {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2vika_126 Villin, domain 1 (res. 1-126) {Chicken (Gallus gal 100.0
d3cipg1124 Gelsolin {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1j72a1114 Macrophage capping protein Cap G {Human (Homo sapi 99.98
d1j72a3107 Macrophage capping protein Cap G {Human (Homo sapi 99.48
d1d0na3121 Gelsolin {Horse (Equus caballus) [TaxId: 9796]} 99.33
d1svya_102 Severin, domain 2 {Dictyostelium discoideum [TaxId 99.3
d1kcqa_104 Gelsolin {Human (Homo sapiens) [TaxId: 9606]} 99.29
d1j72a2116 Macrophage capping protein Cap G {Human (Homo sapi 99.2
d2fh1a3113 Gelsolin {Human (Homo sapiens) [TaxId: 9606]} 99.02
d2fh1a296 Gelsolin {Human (Homo sapiens) [TaxId: 9606]} 98.93
d1m4ja_133 Adf-H domain of twinfilin isoform-1 {Mouse (Mus mu 95.5
d1f7sa_124 Cofilin (actin depolymerizing factor, ADF) {Plant 93.27
d1t3ya1130 Coactosin-like protein Cotl1 (Clp) {Human (Homo sa 91.53
d1cfya_133 Cofilin (actin depolymerizing factor, ADF) {Baker' 90.52
d1cnua_134 Cofilin (actin depolymerizing factor, ADF) {Acanth 88.8
d1hqz1_139 Cofilin-like domain of actin-binding protein abp1p 85.0
d1q8ga_166 Cofilin (actin depolymerizing factor, ADF) {Human 82.01
>d2fh1a1 d.109.1.1 (A:412-532) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Gelsolin-like
superfamily: Actin depolymerizing proteins
family: Gelsolin-like
domain: Gelsolin
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=7.4e-33  Score=179.49  Aligned_cols=80  Identities=30%  Similarity=0.452  Sum_probs=75.6

Q ss_pred             Cceee-eeeeeCCceeEEEEEEeCCCCCHHHHHHHHHHHHHHHHHcCCCCeEEEeecCCCChhHHhcccCC-EEEEeccc
Q psy13831          3 DAFTF-QPYKVYGTMEQHIHFWLGKNTSTDEAAVAAYKSVELDNYLNGSPVQHREVQGGESIRFRGYFKNG-ISYHRKVL   80 (82)
Q Consensus         3 ~~~~~-yty~~~~~~~~~iy~W~G~~ss~de~~aaa~~a~~ld~~l~~~~vq~Rv~QGkEp~~Fl~lFkg~-~ii~~G~~   80 (82)
                      ||||+ |||..+++..++||||+|++|+.+|+++||.+|++||++|++.|+|+||+||+||++||+||+|+ |||++|+.
T Consensus        34 d~Yiv~~~y~~~g~~~~~iy~W~G~~ss~~e~~~aa~~a~eld~~l~g~~vq~R~~QG~Ep~~Fl~~F~g~~~Ii~~Gg~  113 (121)
T d2fh1a1          34 DSYIILYNYRHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGT  113 (121)
T ss_dssp             SEEEEEEEEEETTEEEEEEEEEECTTCCHHHHHHHHHHHHHHHHHTTSCSEEEEEETTCCCHHHHGGGTTCCEEEESCCC
T ss_pred             CeEEEEEEEEcCCCceEEEEEEECCCCCHHHHHHHHHHHHHHHHHcCCCceEEeccCCCCCHHHHHHhCCCeEEEECCCc
Confidence            88875 78998999999999999999999999999999999999999999999999999999999999987 89999997


Q ss_pred             CC
Q psy13831         81 TH   82 (82)
Q Consensus        81 ~~   82 (82)
                      ++
T Consensus       114 ~~  115 (121)
T d2fh1a1         114 SR  115 (121)
T ss_dssp             CT
T ss_pred             cc
Confidence            64



>d2vika_ d.109.1.1 (A:) Villin, domain 1 (res. 1-126) {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d3cipg1 d.109.1.1 (G:2-125) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j72a1 d.109.1.1 (A:11-124) Macrophage capping protein Cap G {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j72a3 d.109.1.1 (A:241-347) Macrophage capping protein Cap G {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d0na3 d.109.1.1 (A:263-383) Gelsolin {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1svya_ d.109.1.1 (A:) Severin, domain 2 {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1kcqa_ d.109.1.1 (A:) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j72a2 d.109.1.1 (A:125-240) Macrophage capping protein Cap G {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fh1a3 d.109.1.1 (A:629-741) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fh1a2 d.109.1.1 (A:533-628) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m4ja_ d.109.1.2 (A:) Adf-H domain of twinfilin isoform-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f7sa_ d.109.1.2 (A:) Cofilin (actin depolymerizing factor, ADF) {Plant (Arabidopsis thaliana), ADF1 [TaxId: 3702]} Back     information, alignment and structure
>d1t3ya1 d.109.1.2 (A:2-131) Coactosin-like protein Cotl1 (Clp) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfya_ d.109.1.2 (A:) Cofilin (actin depolymerizing factor, ADF) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cnua_ d.109.1.2 (A:) Cofilin (actin depolymerizing factor, ADF) {Acanthamoeba castellanii, actophorin [TaxId: 5755]} Back     information, alignment and structure
>d1hqz1_ d.109.1.2 (1:) Cofilin-like domain of actin-binding protein abp1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q8ga_ d.109.1.2 (A:) Cofilin (actin depolymerizing factor, ADF) {Human (Homo sapiens), non-muscle isoform [TaxId: 9606]} Back     information, alignment and structure