Psyllid ID: psy13969

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------
MITINPGSNFSMPPPSMSGGGHHHHHHPRGYHGQQFHHRPNFNKNFHTPFRPFHKNPNQIMDPDFDGKKLRKSSMRKTVDYNAAVINALEARVWQRDYRDRRALQPDVMYYPHMLPPPSFEDNATNAVTTRFVKAATNKMRCPIFSMTWTPEGRRLAHDCAVRHMVWSHNGLWMVTSDHQGYIKYWQSNMNNVKTFQGHKESIRGISFSPSDSKFATCSDDGTVRVWDFYRCTEEKVLRGHGADVKCVDWHPYKSLIVSGSKDNQQPVKLWDPKAGQALATLHAHKSTVMDLAWNQNGNWLVTASRDHLLKVFDIRNLSSEVQTFRGHKKEASAVAWHPQHEGLFSSGGADGSIMFWHVGADKEVGCIPQAHDNIIWTMAWHPLGHILATGSNDHASKFWTRNRLGDPMRDRYNQKGLAHCITGVYNEEMELNDSAVIPGMGLEDEDSVFPSSEPLNEVGKSTSGPNTNDPSNIPGLDIDSTELQKIIPVKKVPFSKPIPKHFQEAWMNKIIVYDTKVLPVAENDMKALNEAAIKVLMEKVPGTKKIADLNPDAIFVHGKVIKVQKGSELAQVIMRGQKELTRYINSGRIPELEDTVSYIDGEEEWTPQGSGDVDLRGGYPPAMGGRPPGFPGPGGPMFPPGGPPNFPPNFGPGPPGPNFPGGPGPPMFPPGGPGPNFSGSGPPGMFPPGGPPNFGPNGPMGPPSGPSGPMGPPGGPNGPMGPPGGGPGPNFPPGSGGPGNFGPNGPRPNFSGGPKGPNFGPKGPRGPGPNFGPGPNNYGPPNNSGGPPGPNMRDNDDRRGGGGNYNDNSYDNEDGNDWQGGDDNGWGDGGGQNYQNNERYNNDRNNWEEPRRGRGGGKMRGGKRGRGRGGRGKRGM
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccEEEEccccccEEccHHHHHHHHHHcccccccccEEEcccccccccccccccccccccccccccEEEEEcccEEEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEcccccEEEEccccccEEccccccccEEEEEEcccccEEEEccccccEEEEEccccEEEEEcccccccEEEEEEcccccEEEEccccccccEEEEcccccccccccccccccEEEEEEcccccEEEEEEcccEEEEEEcccccccccccccccccEEEEEEccccccEEEEEcccccEEEEEcccccEEccccccccccEEEEEEcccccEEEEccccccEEEEEccccccccccccccccccEEEEEEccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccEEEEEEcccccEEEEcccccEEEEccccccccccccccccccEEEccEEEEEcccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccccccccccccccccccEEEEEccccccEccccccEEEEEcccccEEEEEccccccEEEEEEcccEEEEEcccccEEEEEcccccEEEEEEccccEEEEEEcccccEEEEEcccccccccccEcccccEEEEEccccEEEEEEcccccEEEEEcccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEcccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEccccccEEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEccccEEEEEEccccccEEEEEEcccccEEEEEEcccccEEEEEEccccEEEEEEcccccEEEEEcccccccEEEEEEcccccEEEEEccccEEEEEEccccccEEEEEccccccEEEEEEccccccccccccEEEEcccccEEEEEEccccEEEEEcccccEEEEEEEcccccccccccccccEEEEEEcccccccEEEEcccccEEEEEcccccccccccccccccccccEEEEcccccEEccccccEEEcccccEEEEccccccHHHEEHcHHHHHHHccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
mitinpgsnfsmpppsmsggghhhhhhprgyhgqqfhhrpnfnknfhtpfrpfhknpnqimdpdfdgkklrkssmrkTVDYNAAVINALEARVWQRDyrdrralqpdvmyyphmlpppsfednatnAVTTRFVKAAtnkmrcpifsmtwtpegrrlahDCAVRHMvwshnglwmvtsdHQGYIKYWQSNMNNvktfqghkesirgisfspsdskfatcsddgtvrvWDFYRCTEEkvlrghgadvkcvdwhpykslivsgskdnqqpvklwdpkAGQALATLHAHKSTVMDLawnqngnwLVTASRDHLLKVFDIRNLSSEVQTFrghkkeasavawhpqheglfssggadgsimfwhvgadkevgcipqahdnIIWTmawhplghilatgsndhaskfwtrnrlgdpmrdrynqkglAHCITGVyneemelndsavipgmglededsvfpsseplnevgkstsgpntndpsnipgldidstelqkiipvkkvpfskpipkhFQEAWMNKIIVYDTKVLPVAENDMKALNEAAIKVLMEkvpgtkkiadlnpdaifvHGKVIKVQKGSELAQVIMRGQKELTRYInsgripeledtvsyidgeeewtpqgsgdvdlrggyppamggrppgfpgpggpmfppggppnfppnfgpgppgpnfpggpgppmfppggpgpnfsgsgppgmfppggppnfgpngpmgppsgpsgpmgppggpngpmgppgggpgpnfppgsggpgnfgpngprpnfsggpkgpnfgpkgprgpgpnfgpgpnnygppnnsggppgpnmrdnddrrggggnyndnsydnedgndwqggddngwgdgggqnyqnnerynndrnnweeprrgrgggkmrggkrgrgrggrgkrgm
MITINPGSNFSMPPPSMSGGGHHHHHHPRGYHGQQFHHRPNFNKNFHTPFRPFHKNPNQIMDPDFDGKKLRKSSMRKTVDYNAAVINAlearvwqrdyRDRRALQPDVMYYPHMLPPPSFEDNATNAVTTRFVKaatnkmrcpifsmtwtpEGRRLAHDCAVRHMVWSHNGLWMVTSDHQGYIKYWQSNMNNVKTFQGHKESirgisfspsdskfatcsddgtvRVWDFYRCTEEKvlrghgadvkcvdWHPYKSLIVSGSKDNQQPVKLWDPKAGQALATLHAHKSTVMDLAWNQNGNWLVTASRDHLLKVFDIRNLSSEVQTFRGHKKEASAVAWHPQHEGLFSSGGADGSIMFWHVGADKEVGCIPQAHDNIIWTMAWHPLGHILATGSNDHASKFWTRNRLGDPMRDRYNQKGLAHCITGVYNEEMELNDSAVIPGMGLEDEDSVFPSSEPLNevgkstsgpntndpsniPGLDIDSTELQKIIPVKKVPFSKPIPKHFQEAWMNKIIVYDTKVLPVAENDMKALNEAAIKVLMEKVPGTKKIADLNPDAIFVHGKVIKVQKGSELAQVIMRGQKELtryinsgripelEDTVSYIDGEEEWTPQGSGDVDLRGGYPPAMGGRPPGFPGPGGPMFPPGGPPNFPPNFGPGPPGPNFPGGPGPPMFPPGGPGPNFSGSGPPGMFPPGGPPNFGPNGPMGPPSGPSGPMGPPGGPNGPMGPPGGGPGPNFPPGSGGPGNFGPNGPRPNFSGGPKGPNFGPKGPRGPGPNFGPGPNNYGPPNNSGGPPGPNMRDNDDRRGGGGNYNDNSYDNEDGNDWQGGDDNGWGDGGGQNYQNnerynndrnnweeprrgrgggkmrggkrgrgrggrgkrgm
MITINpgsnfsmpppsmsggghhhhhhprgyhgQQFHHRPNFNKNFHTPFRPFHKNPNQIMDPDFDGKKLRKSSMRKTVDYNAAVINALEARVWQRDYRDRRALQPDVMYYPHMLPPPSFEDNATNAVTTRFVKAATNKMRCPIFSMTWTPEGRRLAHDCAVRHMVWSHNGLWMVTSDHQGYIKYWQSNMNNVKTFQGHKESIRGISFSPSDSKFATCSDDGTVRVWDFYRCTEEKVLRGHGADVKCVDWHPYKSLIVSGSKDNQQPVKLWDPKAGQALATLHAHKSTVMDLAWNQNGNWLVTASRDHLLKVFDIRNLSSEVQTFRGHKKEASAVAWHPQHEGLFSSGGADGSIMFWHVGADKEVGCIPQAHDNIIWTMAWHPLGHILATGSNDHASKFWTRNRLGDPMRDRYNQKGLAHCITGVYNEEMELNDSAVIPGMGLEDEDSVFPSSEPLNEVGKSTSGPNTNDPSNIPGLDIDSTELQKIIPVKKVPFSKPIPKHFQEAWMNKIIVYDTKVLPVAENDMKALNEAAIKVLMEKVPGTKKIADLNPDAIFVHGKVIKVQKGSELAQVIMRGQKELTRYINSGRIPELEDTVSYIDGEEEWTPQGSGDVDLRGGYPPAMggrppgfpgpggpmfppggppnfppnfgpgppgpnfpggpgppmfppggpgpnfsgsgppgmfppggppnfgpngpmgppsgpsgpmgppggpngpmgppgggpgpnfppgsggpgnfgpngprpnfsggpkgpnfgpkgprgpgpnfgpgpnnygppnnsggppgpnmrdnddrrggggnyndnsydnedgndwqggddngwgdgggqnyqnnerynndrnnWEEPrrgrgggkmrggkrgrgrggrgkrgm
*****************************************************************************TVDYNAAVINALEARVWQRDYRDRRALQPDVMYYPHMLPPPSFEDNATNAVTTRFVKAATNKMRCPIFSMTWTPEGRRLAHDCAVRHMVWSHNGLWMVTSDHQGYIKYWQSNMNNVKTFQGHKESIRGISF*****KFATCSDDGTVRVWDFYRCTEEKVLRGHGADVKCVDWHPYKSLIVSGS****QPVKLWDPKAGQALATLHAHKSTVMDLAWNQNGNWLVTASRDHLLKVFDIRNLSSEVQTFRGHKKEASAVAWHPQHEGLFSSGGADGSIMFWHVGADKEVGCIPQAHDNIIWTMAWHPLGHILATGSNDHASKFWTRNRLGDPMRDRYNQKGLAHCITGVYNEEMELN*************************************************ELQKIIPVKKVPFSKPIPKHFQEAWMNKIIVYDTKVLPVAENDMKALNEAAIKVLMEKVPGTKKIADLNPDAIFVHGKVIKVQKGSELAQVIMRGQKELTRYINSGRIPELEDTVSYID************************************************************************************************************************************************************************************************************************************************************************************
***********************************FHHRPNFNKNFHTPFRPFHKNPNQIMDPDFDGKKLRKSSMRKTVDYNAAVINALEARVWQRDYRDRRALQPDVMYYPHMLPPPSFEDNATNAVTTRFVKAATNKMRCPIFSMTWTPEGRRLAHDCAVRHMVWSHNGLWMVTSDHQGYIKYWQSNMNNVKTFQGHKESIRGISFSPSDSKFATCSDDGTVRVWDFYRCTEEKVLRGHGADVKCVDWHPYKSLIVSGSKDNQQPVKLWDPKAGQALATLHAHKSTVMDLAWNQNGNWLVTASRDHLLKVFDIRNLSSEVQTFRGHKKEASAVAWHPQHEGLFSSGGADGSIMFWHVGADKEVGCIPQAHDNIIWTMAWHPLGHILATGSNDHASKFWTRNRLGDPMRDRYNQKGLAHCITGVYNEEMELNDSAVIPGMGLEDEDSVFPSSEPL**************PSNIPGLDIDSTELQKIIPVKKVPFSKPIPKHFQEAWMNKIIVYDTKVLPVAENDMKALNEAAIKVLMEKVP************IFVH**********************LTRYINSG*************************************************************************************************************************************************************************************************************************************************************************************************
MITINPGSNFSMPPP*******************QFHHRPNFNKNFHTPFRPFHKNPNQIMDPDFDGKKLRKSSMRKTVDYNAAVINALEARVWQRDYRDRRALQPDVMYYPHMLPPPSFEDNATNAVTTRFVKAATNKMRCPIFSMTWTPEGRRLAHDCAVRHMVWSHNGLWMVTSDHQGYIKYWQSNMNNVKTFQGHKESIRGISFSPSDSKFATCSDDGTVRVWDFYRCTEEKVLRGHGADVKCVDWHPYKSLIVSGSKDNQQPVKLWDPKAGQALATLHAHKSTVMDLAWNQNGNWLVTASRDHLLKVFDIRNLSSEVQTFRGHKKEASAVAWHPQHEGLFSSGGADGSIMFWHVGADKEVGCIPQAHDNIIWTMAWHPLGHILATGSNDHASKFWTRNRLGDPMRDRYNQKGLAHCITGVYNEEMELNDSAVIPGMGLEDEDSVFPSSE************NTNDPSNIPGLDIDSTELQKIIPVKKVPFSKPIPKHFQEAWMNKIIVYDTKVLPVAENDMKALNEAAIKVLMEKVPGTKKIADLNPDAIFVHGKVIKVQKGSELAQVIMRGQKELTRYINSGRIPELEDTVSYIDGEEEWTPQGSGDVDLRGGYPPAMGGRPPGFPGPGGPMFPPGGPPNFPPNFGPGPPGPNFPGGPGPPMFPPGGPGPNFSGSGPPGMFPPGGPPNFGPNGPMGPPSGPSGPMGPPGGPNGPMGPPGGGPGPNFPPGSGGPGNFGPNGPRPNFSGGPKGPNFGPKGPRGPGPNFGPGPNNYGPPNNSGGPPGPNMRDNDDRRGGGGNYNDNSYDNEDGNDWQGGDDNGWGDGGGQNYQNNERYNNDRNNWEEP**************************
*ITINPGSNFSMPPPSMSGGGHHHHHHPRGYHGQQFHHRPNFNKNFHTPFRPFHKNPNQIMDPDFDGKKLRKSSMRKTVDYNAAVINALEARVWQRDYRDRRALQPDVMYYPHMLPPPSFEDNATNAVTTRFVKAATNKMRCPIFSMTWTPEGRRLAHDCAVRHMVWSHNGLWMVTSDHQGYIKYWQSNMNNVKTFQGHKESIRGISFSPSDSKFATCSDDGTVRVWDFYRCTEEKVLRGHGADVKCVDWHPYKSLIVSGSKDNQQPVKLWDPKAGQALATLHAHKSTVMDLAWNQNGNWLVTASRDHLLKVFDIRNLSSEVQTFRGHKKEASAVAWHPQHEGLFSSGGADGSIMFWHVGADKEVGCIPQAHDNIIWTMAWHPLGHILATGSNDHASKFWTRNRLGDPMRDRYNQKGLAHCITGVYNEEMELNDSAVIPGMGLEDEDSVFPSSEPLNEVGKSTSGPNTNDPSNIPGLDIDSTELQKIIPVKKVPFSKPIPKHFQEAWMNKIIVYDTKVLPVAENDMKALNEAAIKVLMEKVPGTKKIADLNPDAIFVHGKVIKVQKGSELAQVIMRGQKELTRYINSGRIPELEDTVSYI**EEE******GDVDLRGGYPPAMGGRPPGFPGPGGPMFPPGGPPNFPPNFGPGPPGPNFPGGPGPPMFPPG*****FSGSGPPG**PPGGPPNFGPNGPMGPPSGPSG*****GGPNGPMGPPGGGPGPNF***SGGPGNFGPNGPRPNFSGGPKGPNFGPKG*****PNFGP*PNNYGP**N*************************SYDNEDGNDWQGGDDNGWGDGGGQNYQNNERYNNDRNNWEEPRRGRGGGKM*****************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MITINPGSNFSMPPPSMSGGGHHHHHHPRGYHGQQFHHRPNFNKNFHTPFRPFHKNPNQIMDPDFDGKKLRKSSMRKTVDYNAAVINALEARVWQRDYRDRRALQPDVMYYPHMLPPPSFEDNATNAVTTRFVKAATNKMRCPIFSMTWTPEGRRLAHDCAVRHMVWSHNGLWMVTSDHQGYIKYWQSNMNNVKTFQGHKESIRGISFSPSDSKFATCSDDGTVRVWDFYRCTEEKVLRGHGADVKCVDWHPYKSLIVSGSKDNQQPVKLWDPKAGQALATLHAHKSTVMDLAWNQNGNWLVTASRDHLLKVFDIRNLSSEVQTFRGHKKEASAVAWHPQHEGLFSSGGADGSIMFWHVGADKEVGCIPQAHDNIIWTMAWHPLGHILATGSNDHASKFWTRNRLGDPMRDRYNQKGLAHCITGVYNEEMELNDSAVIPGMGLEDEDSVFPSSEPLNEVGKSTSGPNTNDPSNIPGLDIDSTELQKIIPVKKVPFSKPIPKHFQEAWMNKIIVYDTKVLPVAENDMKALNEAAIKVLMEKVPGTKKIADLNPDAIFVHGKVIKVQKGSELAQVIMRGQKELTRYINSGRIPELEDTVSYIDGEEEWTPQGSGDVDLRGGYPPAMGGRPPGFPGPGGPMFPPGGPPNFPPNFGPGPPGPNFPGGPGPPMFPPGGPGPNFSGSGPPGMFPPGGPPNFGPNGPMGPPSGPSGPMGPPGGPNGPMGPPGGGPGPNFPPGSGGPGNFGPNGPRPNFSGGPKGPNFGPKGPRGPGPNFGPGPNNYGPPNNSGGPPGPNMRDNDDRRGGGGNYNDNSYDNEDGNDWQGGDDNGWGDGGGQNYQNNERYNNDRNNWEEPRRGRGGGKMRGGKRGRGRGGRGKRGM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query877 2.2.26 [Sep-21-2011]
Q8K4P0 1330 pre-mRNA 3' end processin yes N/A 0.594 0.391 0.534 1e-174
Q9C0J8 1336 pre-mRNA 3' end processin yes N/A 0.594 0.389 0.534 1e-174
Q6NLV4647 Flowering time control pr yes N/A 0.421 0.571 0.481 1e-109
Q9UTN4509 Polyadenylation factor su yes N/A 0.458 0.789 0.356 6e-76
Q7RY68660 Polyadenylation factor su N/A N/A 0.403 0.536 0.387 1e-75
Q4I7X1612 Polyadenylation factor su yes N/A 0.376 0.539 0.383 8e-72
P0CS47713 Polyadenylation factor su N/A N/A 0.379 0.467 0.366 2e-70
P0CS46712 Polyadenylation factor su yes N/A 0.379 0.467 0.366 2e-70
Q6CGP9532 Polyadenylation factor su yes N/A 0.445 0.734 0.321 2e-64
Q6CP71452 Polyadenylation factor su yes N/A 0.389 0.756 0.367 6e-64
>sp|Q8K4P0|WDR33_MOUSE pre-mRNA 3' end processing protein WDR33 OS=Mus musculus GN=Wdr33 PE=2 SV=1 Back     alignment and function desciption
 Score =  612 bits (1579), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 307/574 (53%), Positives = 392/574 (68%), Gaps = 53/574 (9%)

Query: 35  QFHHRPNFNKNFHTPFRPFHKNPN-----QIMDPDFDGKKLRKSSMRKTVDYNAAVINAL 89
           +F H P F      P + F+K P+      +    FDGK++RK+  RKT+DYN +VI  L
Sbjct: 10  RFFHMPRFQ--HQAPRQLFYKRPDFAQQQAMQQLTFDGKRMRKAVNRKTIDYNPSVIKYL 67

Query: 90  EARVWQRDYRDRRALQPDVMYYPHMLPPPSFEDNATNAVTTRFVKAATNKMRCPIFSMTW 149
           E R+WQRD RD RA+QPD  YY  ++PP    +N  NAVTT+FV+ +TNK++CP+F + W
Sbjct: 68  ENRIWQRDQRDMRAIQPDAGYYNDLVPPIGMLNNPMNAVTTKFVRTSTNKVKCPVFVVRW 127

Query: 150 TPEGRRL------------------------AHDCAVRHMVWSHNGLWMVTSDHQGYIKY 185
           TPEGRRL                        AHD  VR M WSHN +WM+T+DH GY+KY
Sbjct: 128 TPEGRRLVTGASSGEFTLWNGLTFNFETILQAHDSPVRAMTWSHNDMWMLTADHGGYVKY 187

Query: 186 WQSNMNNVKTFQGHKESIRGISFSPSDSKFATCSDDGTVRVWDFYRCTEEKVLRGHGADV 245
           WQSNMNNVK FQ HKE+IR  SFSP+D+KFATCSDDGTVR+WDF RC EE++LRGHGADV
Sbjct: 188 WQSNMNNVKMFQAHKEAIREASFSPTDNKFATCSDDGTVRIWDFLRCHEERILRGHGADV 247

Query: 246 KCVDWHPYKSLIVSGSKDNQQPVKLWDPKAGQALATLHAHKSTVMDLAWNQNGNWLVTAS 305
           KCVDWHP K L+VSGSKD+QQP+K WDPK GQ+LATLHAHK+TVM++  N NGNWL+TAS
Sbjct: 248 KCVDWHPTKGLVVSGSKDSQQPIKFWDPKTGQSLATLHAHKNTVMEVKLNLNGNWLLTAS 307

Query: 306 RDHLLKVFDIRNLSSEVQTFRGHKKEASAVAWHPQHEGLFSSGGADGSIMFWHVGADKEV 365
           RDHL K+FDIRNL  E+Q FRGHKKEA+AVAWHP HEGLF+SGG+DGS++FWHVG +KEV
Sbjct: 308 RDHLCKLFDIRNLKEELQVFRGHKKEATAVAWHPVHEGLFASGGSDGSLLFWHVGVEKEV 367

Query: 366 GCIPQAHDNIIWTMAWHPLGHILATGSNDHASKFWTRNRLGDPMRDRYNQKGL-AHCITG 424
           G +  AH+ +IW++AWHPLGHIL +GSNDH SKFWTRNR GD MRDRYN   L      G
Sbjct: 368 GGMEMAHEGMIWSLAWHPLGHILCSGSNDHTSKFWTRNRPGDKMRDRYNLNLLPGMSEDG 427

Query: 425 VYNEEMELNDSAVIPGMGLEDEDSVFPSSEPLNEVGKSTSGPNTNDPSNIPGLDIDSTEL 484
           V  +++E N  AVIPGMG+ ++  +    E   ++GK  S   +     IPGLD    E+
Sbjct: 428 VEYDDLEPNSLAVIPGMGIPEQLKLAMEQE---QMGKDES---SEIEMTIPGLDWGMEEV 481

Query: 485 ----QKIIPVKKVPFSKPIPKHFQEAWM-NKI-IVYDTKVLPVAENDMKALNEAAIKVLM 538
               QK +P KKVP++KPIP  FQ+AWM NK+ I    +VL   + D+K   +   +  +
Sbjct: 482 MQKDQKKVPQKKVPYAKPIPAQFQQAWMQNKVPIPAPNEVLNDRKEDIKLEEKKKTQAEI 541

Query: 539 EKVPGTKKIADLNPDAIFVHGKVIKVQKGSELAQ 572
           E     +++A L     + + ++++  K   LAQ
Sbjct: 542 E-----QEMATLQ----YTNPQLLEQLKIERLAQ 566
Essential for both cleavage and polyadenylation of pre-mRNA 3' ends.
Mus musculus (taxid: 10090)
>sp|Q9C0J8|WDR33_HUMAN pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens GN=WDR33 PE=1 SV=2 Back     alignment and function description
>sp|Q6NLV4|FY_ARATH Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1 Back     alignment and function description
>sp|Q9UTN4|PFS2_SCHPO Polyadenylation factor subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfs2 PE=4 SV=1 Back     alignment and function description
>sp|Q7RY68|PFS2_NEUCR Polyadenylation factor subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pfs-2 PE=3 SV=2 Back     alignment and function description
>sp|Q4I7X1|PFS2_GIBZE Polyadenylation factor subunit 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PFS2 PE=3 SV=1 Back     alignment and function description
>sp|P0CS47|PFS2_CRYNB Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PFS2 PE=3 SV=1 Back     alignment and function description
>sp|P0CS46|PFS2_CRYNJ Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PFS2 PE=3 SV=1 Back     alignment and function description
>sp|Q6CGP9|PFS2_YARLI Polyadenylation factor subunit 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PFS2 PE=3 SV=1 Back     alignment and function description
>sp|Q6CP71|PFS2_KLULA Polyadenylation factor subunit 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFS2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query877
328778635 1055 PREDICTED: hypothetical protein LOC41361 0.653 0.543 0.573 0.0
340717354 1056 PREDICTED: hypothetical protein LOC10064 0.656 0.545 0.571 0.0
307203105970 WD repeat-containing protein 33 [Harpegn 0.643 0.581 0.584 0.0
383855886 1053 PREDICTED: uncharacterized protein LOC10 0.655 0.546 0.574 0.0
350413348 1056 PREDICTED: hypothetical protein LOC10074 0.656 0.545 0.571 0.0
380015139 1055 PREDICTED: uncharacterized protein LOC10 0.653 0.543 0.572 0.0
91081997805 PREDICTED: similar to wd-repeat protein 0.602 0.655 0.603 0.0
157124496 985 wd-repeat protein [Aedes aegypti] gi|108 0.652 0.580 0.573 0.0
347965747942 AGAP001362-PA [Anopheles gambiae str. PE 0.686 0.639 0.547 0.0
332024505 1100 WD repeat-containing protein 33 [Acromyr 0.654 0.521 0.521 0.0
>gi|328778635|ref|XP_397060.3| PREDICTED: hypothetical protein LOC413618 [Apis mellifera] Back     alignment and taxonomy information
 Score =  720 bits (1859), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/643 (57%), Positives = 446/643 (69%), Gaps = 70/643 (10%)

Query: 9   NFSMPPPSMSG---GGHHHHHHPRGYHGQQFHHRPNFNKNFHTPFRPFHKNP-----NQI 60
           N S PPP+++     G + H +     G          + F  PFRP+H           
Sbjct: 28  NLSAPPPNLTTINTSGSYQHRYTNHRDGA---------RGFFKPFRPYHAPKIVAAGQDT 78

Query: 61  MDPDFDGKKLRKSSMRKTVDYNAAVINALEARVWQRDYRDRRALQPDVMYYPHMLPPPSF 120
           +  +FDGK+LRKS MRKTVDYN+A+I +LE RVWQRDYRDRRALQPDVMYYP +LPPPS+
Sbjct: 79  LQDEFDGKRLRKSVMRKTVDYNSAIIKSLENRVWQRDYRDRRALQPDVMYYPDLLPPPSY 138

Query: 121 EDNATNAVTTRFVKAATNKMRCPIFSMTWTPEGRRL------------------------ 156
            DN  NAVTTRFVK ATNKMRCPIF M WTPEGRRL                        
Sbjct: 139 VDNPINAVTTRFVKTATNKMRCPIFCMAWTPEGRRLVTGASSGEFTLWNGLTFNFETILQ 198

Query: 157 AHDCAVRHMVWSHNGLWMVTSDHQGYIKYWQSNMNNVKTFQGHKESIRGISFSPSDSKFA 216
           AHD  VR MVWSHN  WMVT DH GY+KYWQSNMNNVK FQ HKE+IRG+SFSP+D K A
Sbjct: 199 AHDSPVRTMVWSHNESWMVTGDHAGYVKYWQSNMNNVKMFQAHKEAIRGLSFSPTDHKLA 258

Query: 217 TCSDDGTVRVWDFYRCTEEKVLRGHGADVKCVDWHPYKSLIVSGSKDNQQPVKLWDPKAG 276
           TCSDDGTVR+WDF RC EE++LRGHGADVKCV WHP KSL++SGSKDNQQPVKLWDPK G
Sbjct: 259 TCSDDGTVRIWDFLRCHEERILRGHGADVKCVHWHPQKSLVISGSKDNQQPVKLWDPKTG 318

Query: 277 QALATLHAHKSTVMDLAWNQNGNWLVTASRDHLLKVFDIRNLSSEVQTFRGHKKEASAVA 336
           Q+LATLHAHKSTVMD+ WN+NGNWLVTASRDHLLK+FD+RNLS EVQTFRGHKKEAS+VA
Sbjct: 319 QSLATLHAHKSTVMDVKWNENGNWLVTASRDHLLKLFDLRNLSQEVQTFRGHKKEASSVA 378

Query: 337 WHPQHEGLFSSGGADGSIMFWHVGADKEVGCIPQAHDNIIWTMAWHPLGHILATGSNDHA 396
           WHP HEGLF SGG+DG+I+FWHVGADKEVG I QAHD+I+WT+AWHPLGHIL +GSNDH 
Sbjct: 379 WHPSHEGLFCSGGSDGAILFWHVGADKEVGAIEQAHDSIVWTLAWHPLGHILCSGSNDHT 438

Query: 397 SKFWTRNRLGDPMRDRYNQKGLAHCITGVYNEEMELNDSAVIPGMGLEDEDSVFPSSEPL 456
           SKFWTRNR GD MRD+YN   L     GV + E+  +++AVIPGMG ED   +    EP 
Sbjct: 439 SKFWTRNRPGDLMRDKYNLNTLPAGSAGVDDHEIA-DEAAVIPGMGPEDR--INADGEPE 495

Query: 457 NEVGKSTSGPNTNDPSNIPGLDID-STELQKIIPVKKVPFSKPIPKHFQEAWMNKIIVYD 515
           ++ G             IPGLD+D + +  K    KKVP+SKPIP++FQ  W N++   D
Sbjct: 496 DKSG------------GIPGLDLDHAVDEGKKFANKKVPYSKPIPRNFQAQW-NEMEAED 542

Query: 516 TKVLPVAENDMKALNEAAIKVLMEKVPGTKKIADLNPDAIFVHGKVIKVQKGSELAQVIM 575
            +        ++ALN A +  L+E  PG   + ++ P+ I ++GK+I V+ GS+LA+ I 
Sbjct: 543 ME-------QVEALN-AFVNQLIETTPGAVPLNEVTPNGIILYGKMIPVEPGSKLAEAIS 594

Query: 576 RGQKELTRYINSGRIPELEDTV---SYIDGEEEWTPQGSGDVD 615
           +G   + + + SG I EL D V     +D  EE+  Q  G++D
Sbjct: 595 KGNDAINKLVFSGEIEELRDVVGPPDNMDDSEEYL-QDDGEID 636

Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|340717354|ref|XP_003397149.1| PREDICTED: hypothetical protein LOC100646419 [Bombus terrestris] Back     alignment and taxonomy information
>gi|307203105|gb|EFN82285.1| WD repeat-containing protein 33 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|383855886|ref|XP_003703441.1| PREDICTED: uncharacterized protein LOC100879004 [Megachile rotundata] Back     alignment and taxonomy information
>gi|350413348|ref|XP_003489966.1| PREDICTED: hypothetical protein LOC100748166 [Bombus impatiens] Back     alignment and taxonomy information
>gi|380015139|ref|XP_003691567.1| PREDICTED: uncharacterized protein LOC100862976 [Apis florea] Back     alignment and taxonomy information
>gi|91081997|ref|XP_969187.1| PREDICTED: similar to wd-repeat protein [Tribolium castaneum] gi|270007376|gb|EFA03824.1| hypothetical protein TcasGA2_TC013939 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|157124496|ref|XP_001654074.1| wd-repeat protein [Aedes aegypti] gi|108873965|gb|EAT38190.1| AAEL009887-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|347965747|ref|XP_321783.5| AGAP001362-PA [Anopheles gambiae str. PEST] gi|333470371|gb|EAA01087.5| AGAP001362-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|332024505|gb|EGI64703.1| WD repeat-containing protein 33 [Acromyrmex echinatior] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query877
UNIPROTKB|F1LT09 1327 Wdr33 "Protein Wdr33" [Rattus 0.444 0.293 0.599 1.9e-164
UNIPROTKB|E1BCT7 1336 WDR33 "Uncharacterized protein 0.464 0.304 0.584 3.1e-164
UNIPROTKB|F1PV59 1336 WDR33 "Uncharacterized protein 0.464 0.304 0.584 3.1e-164
UNIPROTKB|Q9C0J8 1336 WDR33 "pre-mRNA 3' end process 0.445 0.292 0.598 4e-164
MGI|MGI:1921570 1330 Wdr33 "WD repeat domain 33" [M 0.445 0.293 0.596 4e-164
UNIPROTKB|E1BT84 1323 WDR33 "Uncharacterized protein 0.399 0.264 0.649 5.1e-164
FB|FBgn0046222807 CG1109 [Drosophila melanogaste 0.497 0.540 0.562 7.7e-135
UNIPROTKB|I3LTD5 1471 WDR33 "Uncharacterized protein 0.464 0.276 0.584 2.4e-131
WB|WBGene00011051809 pfs-2 [Caenorhabditis elegans 0.397 0.431 0.490 3.1e-120
DICTYBASE|DDB_G0295793657 DDB_G0295793 "WD40 repeat-cont 0.335 0.447 0.548 5.4e-115
UNIPROTKB|F1LT09 Wdr33 "Protein Wdr33" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 1290 (459.2 bits), Expect = 1.9e-164, Sum P(2) = 1.9e-164
 Identities = 244/407 (59%), Positives = 300/407 (73%)

Query:   157 AHDCAVRHMVWSHNGLWMVTSDHQGYIKYWQSNMNNVKTFQGHKESIRGISFSPSDSKFA 216
             AHD  VR M WSHN +WM+T+DH GY+KYWQSNMNNVK FQ HKE+IR  SFSP+D+KFA
Sbjct:   155 AHDSPVRAMTWSHNDMWMLTADHGGYVKYWQSNMNNVKMFQAHKEAIREASFSPTDNKFA 214

Query:   217 TCSDDGTVRVWDFYRCTEEKVLRGHGADVKCVDWHPYKSLIVSGSKDNQQPVKLWDPKAG 276
             TCSDDGTVR+WDF RC EE++LRGHGADVKCVDWHP K L+VSGSKD+QQP+K WDPK G
Sbjct:   215 TCSDDGTVRIWDFLRCHEERILRGHGADVKCVDWHPTKGLVVSGSKDSQQPIKFWDPKTG 274

Query:   277 QALATLHAHKSTVMDLAWNQNGNWLVTASRDHLLKVFDIRNLSSEVQTFRGHKKEASAVA 336
             Q+LATLHAHK+TVM++  N NGNWL+TASRDHL K+FDIRNL  E+Q FRGHKKEA+AVA
Sbjct:   275 QSLATLHAHKNTVMEVKLNLNGNWLLTASRDHLCKLFDIRNLKEELQVFRGHKKEATAVA 334

Query:   337 WHPQHEGLFSSGGADGSIMFWHVGADKEVGCIPQAHDNIIWTMAWHPLGHILATGSNDHA 396
             WHP HEGLF+SGG+DGS++FWHVG +KEVG +  AH+ +IW++AWHPLGHIL +GSNDH 
Sbjct:   335 WHPVHEGLFASGGSDGSLLFWHVGVEKEVGGMEMAHEGMIWSLAWHPLGHILCSGSNDHT 394

Query:   397 SKFWTRNRLGDPMRDRYNQKGLAHCIT-GVYNEEMELNDSAVIPGMGLEDEDSVFPSSEP 455
             SKFWTRNR GD MRDRYN   L      GV  +++E N  AVIPGMG+ ++  +    E 
Sbjct:   395 SKFWTRNRPGDKMRDRYNLNLLPGMSEDGVEYDDLEPNSLAVIPGMGIPEQLKLAMEQE- 453

Query:   456 LNEVGKSTSGPNTND-PSNIPGLDIDSTEL----QKIIPVKKVPFSKPIPKHFQEAWM-N 509
               ++GK  S    ND    IPGLD    E+    QK +P KKVP++KPIP  FQ+AWM N
Sbjct:   454 --QMGKDES----NDIEMTIPGLDWGMEEVMQKDQKKVPQKKVPYAKPIPAQFQQAWMQN 507

Query:   510 KI-IVYDTKVLPVAENDMKALNEAAIKVLMEKVPGTKKIADLNPDAI 555
             K+ I    +VL   + D+K   +   +  +E+   T +    NP  +
Sbjct:   508 KVPIPAPNEVLNDRKEDIKLEEKKKTQAEIEQEMATLQYT--NPQLL 552
GO:0005634 "nucleus" evidence=IEA
UNIPROTKB|E1BCT7 WDR33 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PV59 WDR33 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9C0J8 WDR33 "pre-mRNA 3' end processing protein WDR33" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1921570 Wdr33 "WD repeat domain 33" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1BT84 WDR33 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0046222 CG1109 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|I3LTD5 WDR33 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
WB|WBGene00011051 pfs-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0295793 DDB_G0295793 "WD40 repeat-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9C0J8WDR33_HUMANNo assigned EC number0.53480.59400.3899yesN/A
Q8K4P0WDR33_MOUSENo assigned EC number0.53480.59400.3917yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query877
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 1e-65
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 1e-58
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 3e-49
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 6e-44
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 1e-37
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 3e-37
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 5e-35
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 3e-34
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 6e-15
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 2e-11
smart0032040 smart00320, WD40, WD40 repeats 3e-11
PTZ00421493 PTZ00421, PTZ00421, coronin; Provisional 8e-11
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 2e-10
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 4e-10
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 6e-09
COG5651490 COG5651, COG5651, PPE-repeat proteins [Cell motili 1e-08
PHA03378991 PHA03378, PHA03378, EBNA-3B; Provisional 1e-08
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 2e-08
smart0032040 smart00320, WD40, WD40 repeats 2e-08
PTZ00421493 PTZ00421, PTZ00421, coronin; Provisional 3e-08
PRK12678 672 PRK12678, PRK12678, transcription termination fact 3e-08
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 6e-08
smart0032040 smart00320, WD40, WD40 repeats 8e-08
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 9e-08
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 1e-07
pfam04652315 pfam04652, DUF605, Vta1 like 1e-07
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 4e-07
PHA03169413 PHA03169, PHA03169, hypothetical protein; Provisio 5e-07
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 7e-07
PHA03378991 PHA03378, PHA03378, EBNA-3B; Provisional 1e-06
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 1e-06
pfam07271279 pfam07271, Cytadhesin_P30, Cytadhesin P30/P32 1e-06
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 2e-06
PHA03378991 PHA03378, PHA03378, EBNA-3B; Provisional 3e-06
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 3e-06
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 4e-06
PLN00181793 PLN00181, PLN00181, protein SPA1-RELATED; Provisio 4e-06
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 6e-06
PRK12678 672 PRK12678, PRK12678, transcription termination fact 6e-06
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 7e-06
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 7e-06
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 7e-06
PRK14086 617 PRK14086, dnaA, chromosomal replication initiation 8e-06
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 9e-06
pfam09606 768 pfam09606, Med15, ARC105 or Med15 subunit of Media 9e-06
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 1e-05
smart0032040 smart00320, WD40, WD40 repeats 1e-05
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 1e-05
PTZ00421493 PTZ00421, PTZ00421, coronin; Provisional 2e-05
COG5180654 COG5180, PBP1, Protein interacting with poly(A)-bi 2e-05
PTZ00420568 PTZ00420, PTZ00420, coronin; Provisional 2e-05
pfam12938238 pfam12938, M_domain, M domain of GW182 4e-05
pfam04652315 pfam04652, DUF605, Vta1 like 6e-05
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 7e-05
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 7e-05
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 8e-05
pfam09849234 pfam09849, DUF2076, Uncharacterized protein conser 8e-05
pfam06682317 pfam06682, DUF1183, Protein of unknown function (D 8e-05
COG5651490 COG5651, COG5651, PPE-repeat proteins [Cell motili 9e-05
smart0032040 smart00320, WD40, WD40 repeats 1e-04
COG5651490 COG5651, COG5651, PPE-repeat proteins [Cell motili 1e-04
pfam07271279 pfam07271, Cytadhesin_P30, Cytadhesin P30/P32 2e-04
PRK12678 672 PRK12678, PRK12678, transcription termination fact 3e-04
pfam09606 768 pfam09606, Med15, ARC105 or Med15 subunit of Media 3e-04
pfam07223357 pfam07223, DUF1421, Protein of unknown function (D 3e-04
pfam04652315 pfam04652, DUF605, Vta1 like 4e-04
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 5e-04
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 5e-04
pfam07415 489 pfam07415, Herpes_LMP2, Gammaherpesvirus latent me 6e-04
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 7e-04
pfam04959211 pfam04959, ARS2, Arsenite-resistance protein 2 8e-04
COG5651490 COG5651, COG5651, PPE-repeat proteins [Cell motili 0.001
pfam09606 768 pfam09606, Med15, ARC105 or Med15 subunit of Media 0.001
pfam09606 768 pfam09606, Med15, ARC105 or Med15 subunit of Media 0.001
PTZ00420568 PTZ00420, PTZ00420, coronin; Provisional 0.001
pfam04959211 pfam04959, ARS2, Arsenite-resistance protein 2 0.001
pfam06003264 pfam06003, SMN, Survival motor neuron protein (SMN 0.001
pfam05518753 pfam05518, Totivirus_coat, Totivirus coat protein 0.001
TIGR01649481 TIGR01649, hnRNP-L_PTB, hnRNP-L/PTB/hephaestus spl 0.001
pfam03154 979 pfam03154, Atrophin-1, Atrophin-1 family 0.001
pfam07271279 pfam07271, Cytadhesin_P30, Cytadhesin P30/P32 0.002
pfam09606 768 pfam09606, Med15, ARC105 or Med15 subunit of Media 0.002
pfam06003264 pfam06003, SMN, Survival motor neuron protein (SMN 0.003
pfam05518753 pfam05518, Totivirus_coat, Totivirus coat protein 0.003
PHA03264416 PHA03264, PHA03264, envelope glycoprotein D; Provi 0.003
pfam06682317 pfam06682, DUF1183, Protein of unknown function (D 0.004
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information 
 Score =  221 bits (564), Expect = 1e-65
 Identities = 79/287 (27%), Positives = 133/287 (46%), Gaps = 34/287 (11%)

Query: 141 RCPIFSMTWTPEGRRLA------------------------HDCAVRHMVWSHNGLWMVT 176
              +  + ++P+G+ LA                        H   VR +  S +G ++ +
Sbjct: 9   TGGVTCVAFSPDGKLLATGSGDGTIKVWDLETGELLRTLKGHTGPVRDVAASADGTYLAS 68

Query: 177 S--DHQGYIKYWQSNMNN-VKTFQGHKESIRGISFSPSDSKFATCSDDGTVRVWDFYRCT 233
              D    I+ W       V+T  GH   +  ++FSP     ++ S D T++VWD     
Sbjct: 69  GSSDKT--IRLWDLETGECVRTLTGHTSYVSSVAFSPDGRILSSSSRDKTIKVWDVETGK 126

Query: 234 EEKVLRGHGADVKCVDWHPYKSLIVSGSKDNQQPVKLWDPKAGQALATLHAHKSTVMDLA 293
               LRGH   V  V + P  + + S S+D    +KLWD + G+ +ATL  H   V  +A
Sbjct: 127 CLTTLRGHTDWVNSVAFSPDGTFVASSSQDGT--IKLWDLRTGKCVATLTGHTGEVNSVA 184

Query: 294 WNQNGNWLVTASRDHLLKVFDIRNLSSEVQTFRGHKKEASAVAWHPQHEGLFSSGGADGS 353
           ++ +G  L+++S D  +K++D+      + T RGH+   ++VA+ P    L +SG  DG+
Sbjct: 185 FSPDGEKLLSSSSDGTIKLWDLST-GKCLGTLRGHENGVNSVAFSP-DGYLLASGSEDGT 242

Query: 354 IMFWHVGADKEVGCIPQAHDNIIWTMAWHPLGHILATGSNDHASKFW 400
           I  W +   + V  +   H N + ++AW P G  LA+GS D   + W
Sbjct: 243 IRVWDLRTGECVQTL-SGHTNSVTSLAWSPDGKRLASGSADGTIRIW 288

Length = 289
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|173611 PTZ00421, PTZ00421, coronin; Provisional Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|227938 COG5651, COG5651, PPE-repeat proteins [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|173611 PTZ00421, PTZ00421, coronin; Provisional Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|219358 pfam07271, Cytadhesin_P30, Cytadhesin P30/P32 Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|177776 PLN00181, PLN00181, protein SPA1-RELATED; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|220309 pfam09606, Med15, ARC105 or Med15 subunit of Mediator complex non-fungal Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|173611 PTZ00421, PTZ00421, coronin; Provisional Back     alignment and domain information
>gnl|CDD|227507 COG5180, PBP1, Protein interacting with poly(A)-binding protein [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|240412 PTZ00420, PTZ00420, coronin; Provisional Back     alignment and domain information
>gnl|CDD|221868 pfam12938, M_domain, M domain of GW182 Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|220441 pfam09849, DUF2076, Uncharacterized protein conserved in bacteria (DUF2076) Back     alignment and domain information
>gnl|CDD|219133 pfam06682, DUF1183, Protein of unknown function (DUF1183) Back     alignment and domain information
>gnl|CDD|227938 COG5651, COG5651, PPE-repeat proteins [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|227938 COG5651, COG5651, PPE-repeat proteins [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|219358 pfam07271, Cytadhesin_P30, Cytadhesin P30/P32 Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|220309 pfam09606, Med15, ARC105 or Med15 subunit of Mediator complex non-fungal Back     alignment and domain information
>gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|219404 pfam07415, Herpes_LMP2, Gammaherpesvirus latent membrane protein (LMP2) protein Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|218350 pfam04959, ARS2, Arsenite-resistance protein 2 Back     alignment and domain information
>gnl|CDD|227938 COG5651, COG5651, PPE-repeat proteins [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|220309 pfam09606, Med15, ARC105 or Med15 subunit of Mediator complex non-fungal Back     alignment and domain information
>gnl|CDD|220309 pfam09606, Med15, ARC105 or Med15 subunit of Mediator complex non-fungal Back     alignment and domain information
>gnl|CDD|240412 PTZ00420, PTZ00420, coronin; Provisional Back     alignment and domain information
>gnl|CDD|218350 pfam04959, ARS2, Arsenite-resistance protein 2 Back     alignment and domain information
>gnl|CDD|114709 pfam06003, SMN, Survival motor neuron protein (SMN) Back     alignment and domain information
>gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein Back     alignment and domain information
>gnl|CDD|233508 TIGR01649, hnRNP-L_PTB, hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|219358 pfam07271, Cytadhesin_P30, Cytadhesin P30/P32 Back     alignment and domain information
>gnl|CDD|220309 pfam09606, Med15, ARC105 or Med15 subunit of Mediator complex non-fungal Back     alignment and domain information
>gnl|CDD|114709 pfam06003, SMN, Survival motor neuron protein (SMN) Back     alignment and domain information
>gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein Back     alignment and domain information
>gnl|CDD|223029 PHA03264, PHA03264, envelope glycoprotein D; Provisional Back     alignment and domain information
>gnl|CDD|219133 pfam06682, DUF1183, Protein of unknown function (DUF1183) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 877
KOG0284|consensus464 100.0
KOG0271|consensus480 100.0
KOG0272|consensus459 100.0
KOG0271|consensus480 100.0
KOG0272|consensus459 100.0
KOG0286|consensus343 100.0
KOG0279|consensus315 100.0
KOG0273|consensus524 100.0
KOG0286|consensus343 100.0
KOG0295|consensus406 100.0
KOG0285|consensus460 100.0
KOG0263|consensus707 100.0
KOG0284|consensus464 100.0
KOG0318|consensus603 100.0
KOG0279|consensus315 100.0
KOG0645|consensus312 100.0
KOG0645|consensus312 100.0
KOG0265|consensus338 100.0
KOG0291|consensus893 100.0
KOG0315|consensus311 100.0
KOG0266|consensus456 100.0
KOG0273|consensus524 100.0
KOG0276|consensus794 100.0
KOG0281|consensus499 100.0
KOG0291|consensus893 100.0
KOG0315|consensus311 100.0
KOG0295|consensus406 100.0
KOG0263|consensus707 99.98
KOG0277|consensus311 99.98
KOG0318|consensus603 99.98
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.97
KOG0282|consensus503 99.97
PLN00181793 protein SPA1-RELATED; Provisional 99.97
KOG0292|consensus 1202 99.97
KOG0266|consensus456 99.97
KOG0285|consensus460 99.97
KOG0316|consensus307 99.97
KOG0277|consensus311 99.97
KOG0265|consensus338 99.97
KOG0319|consensus775 99.97
KOG0296|consensus399 99.97
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.97
KOG0319|consensus775 99.97
KOG0313|consensus423 99.97
KOG0293|consensus519 99.97
KOG0293|consensus519 99.97
KOG0296|consensus399 99.97
KOG0275|consensus508 99.97
KOG0313|consensus423 99.97
KOG0276|consensus794 99.97
KOG0283|consensus712 99.96
KOG0643|consensus327 99.96
KOG0264|consensus422 99.96
KOG0310|consensus487 99.96
PLN00181793 protein SPA1-RELATED; Provisional 99.96
KOG0268|consensus433 99.96
KOG0299|consensus479 99.96
KOG0306|consensus888 99.96
KOG0316|consensus307 99.96
KOG0292|consensus 1202 99.96
KOG1407|consensus313 99.96
KOG0281|consensus499 99.96
PTZ00421493 coronin; Provisional 99.96
KOG0310|consensus487 99.96
KOG0278|consensus334 99.95
KOG0973|consensus 942 99.95
KOG0282|consensus503 99.95
KOG0305|consensus484 99.95
KOG0278|consensus334 99.95
KOG0641|consensus350 99.95
KOG0306|consensus888 99.95
KOG0640|consensus430 99.95
PTZ00421493 coronin; Provisional 99.95
KOG1446|consensus311 99.95
KOG0641|consensus350 99.95
KOG1407|consensus313 99.95
KOG0643|consensus327 99.95
KOG0274|consensus537 99.95
KOG0772|consensus641 99.95
KOG0973|consensus 942 99.94
KOG0305|consensus484 99.94
KOG0647|consensus347 99.94
KOG0289|consensus506 99.94
KOG0288|consensus459 99.94
KOG0264|consensus422 99.94
KOG0308|consensus735 99.94
PTZ00420568 coronin; Provisional 99.94
KOG0274|consensus537 99.94
KOG0772|consensus641 99.94
KOG0300|consensus481 99.94
KOG0275|consensus508 99.94
KOG0294|consensus362 99.94
KOG0288|consensus459 99.93
KOG1332|consensus299 99.93
KOG1036|consensus323 99.93
KOG0283|consensus712 99.93
PTZ00420568 coronin; Provisional 99.93
KOG0640|consensus430 99.93
KOG0289|consensus506 99.93
KOG0294|consensus362 99.93
KOG0301|consensus745 99.93
KOG0269|consensus839 99.93
KOG0269|consensus839 99.92
KOG0639|consensus705 99.92
KOG0267|consensus825 99.92
KOG1332|consensus299 99.92
KOG0308|consensus735 99.92
KOG1446|consensus311 99.92
KOG0639|consensus705 99.91
KOG0268|consensus433 99.91
KOG1408|consensus1080 99.91
KOG0299|consensus479 99.91
KOG3546|consensus 1167 99.91
KOG0300|consensus481 99.91
KOG0647|consensus347 99.91
KOG4328|consensus498 99.91
KOG1274|consensus 933 99.91
KOG2096|consensus420 99.91
KOG1036|consensus323 99.91
KOG4283|consensus397 99.9
KOG2445|consensus361 99.9
KOG4378|consensus673 99.9
KOG0301|consensus745 99.9
KOG0302|consensus440 99.89
KOG0646|consensus476 99.89
KOG0270|consensus463 99.89
KOG1273|consensus405 99.89
KOG1408|consensus1080 99.89
KOG3546|consensus 1167 99.89
KOG2048|consensus691 99.89
KOG0267|consensus 825 99.89
KOG1539|consensus910 99.89
KOG0646|consensus476 99.89
KOG0321|consensus720 99.88
KOG4283|consensus397 99.88
KOG2106|consensus626 99.88
KOG2055|consensus514 99.88
KOG0650|consensus733 99.88
KOG0270|consensus463 99.88
KOG1063|consensus764 99.87
KOG0321|consensus720 99.87
KOG0307|consensus 1049 99.87
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.87
KOG1539|consensus910 99.87
KOG0302|consensus440 99.87
KOG2055|consensus514 99.87
KOG1587|consensus555 99.87
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.87
KOG2106|consensus626 99.87
KOG1007|consensus370 99.86
KOG1063|consensus764 99.86
KOG2445|consensus361 99.86
KOG1445|consensus1012 99.86
KOG2096|consensus420 99.86
KOG1273|consensus405 99.86
KOG2919|consensus406 99.85
KOG4328|consensus498 99.85
KOG1274|consensus 933 99.84
KOG1034|consensus385 99.84
KOG1009|consensus434 99.84
KOG1007|consensus370 99.83
KOG0290|consensus364 99.82
KOG0307|consensus 1049 99.82
KOG0650|consensus733 99.82
KOG4227|consensus609 99.82
KOG2048|consensus691 99.82
KOG2321|consensus703 99.81
KOG4378|consensus673 99.81
KOG1034|consensus385 99.81
KOG2919|consensus406 99.81
KOG0290|consensus364 99.8
COG2319466 FOG: WD40 repeat [General function prediction only 99.79
KOG0642|consensus577 99.79
KOG1538|consensus 1081 99.78
KOG1538|consensus 1081 99.78
KOG0303|consensus472 99.78
KOG0303|consensus472 99.77
KOG0649|consensus325 99.77
KOG1188|consensus376 99.76
KOG0322|consensus323 99.76
COG2319466 FOG: WD40 repeat [General function prediction only 99.76
KOG1524|consensus737 99.76
KOG0644|consensus 1113 99.75
KOG1524|consensus737 99.74
KOG1587|consensus555 99.73
KOG1517|consensus1387 99.71
KOG4227|consensus609 99.71
KOG1445|consensus1012 99.71
KOG0771|consensus398 99.71
PRK11028330 6-phosphogluconolactonase; Provisional 99.71
KOG2110|consensus391 99.7
KOG1188|consensus376 99.7
KOG1272|consensus545 99.7
KOG0644|consensus 1113 99.69
PRK11028330 6-phosphogluconolactonase; Provisional 99.69
KOG1517|consensus1387 99.69
KOG1240|consensus1431 99.68
KOG2110|consensus391 99.68
KOG1963|consensus792 99.68
KOG1523|consensus361 99.68
KOG0642|consensus577 99.67
PRK01742429 tolB translocation protein TolB; Provisional 99.67
KOG1310|consensus758 99.67
KOG1009|consensus434 99.67
KOG1523|consensus361 99.66
KOG0771|consensus398 99.66
KOG0649|consensus325 99.64
PRK01742429 tolB translocation protein TolB; Provisional 99.63
KOG2139|consensus445 99.62
KOG1310|consensus758 99.62
KOG1963|consensus792 99.61
KOG2111|consensus346 99.61
KOG1272|consensus545 99.61
PRK03629429 tolB translocation protein TolB; Provisional 99.59
KOG2394|consensus636 99.58
PRK05137435 tolB translocation protein TolB; Provisional 99.57
PRK03629429 tolB translocation protein TolB; Provisional 99.55
KOG2394|consensus636 99.55
PRK04922433 tolB translocation protein TolB; Provisional 99.55
PRK02889427 tolB translocation protein TolB; Provisional 99.55
KOG2139|consensus445 99.54
KOG0322|consensus323 99.54
KOG1334|consensus559 99.53
KOG1354|consensus433 99.53
KOG3881|consensus412 99.53
KOG4497|consensus447 99.52
PRK04922433 tolB translocation protein TolB; Provisional 99.52
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.51
PRK05137435 tolB translocation protein TolB; Provisional 99.5
KOG3881|consensus412 99.5
PRK02889427 tolB translocation protein TolB; Provisional 99.5
KOG4497|consensus447 99.49
KOG0280|consensus339 99.46
KOG1240|consensus1431 99.46
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.46
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.45
KOG1334|consensus559 99.43
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.42
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.42
KOG2111|consensus346 99.4
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.4
KOG0280|consensus339 99.39
PRK00178430 tolB translocation protein TolB; Provisional 99.39
PRK04792448 tolB translocation protein TolB; Provisional 99.39
KOG0974|consensus 967 99.38
PRK01029428 tolB translocation protein TolB; Provisional 99.38
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.38
PRK00178430 tolB translocation protein TolB; Provisional 99.37
KOG4547|consensus541 99.36
KOG2315|consensus566 99.36
KOG2321|consensus703 99.35
PRK04792448 tolB translocation protein TolB; Provisional 99.34
PRK01029428 tolB translocation protein TolB; Provisional 99.33
KOG1354|consensus433 99.33
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.32
KOG1409|consensus404 99.31
KOG2314|consensus698 99.31
KOG0974|consensus 967 99.3
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 99.27
KOG0309|consensus 1081 99.22
KOG1409|consensus404 99.22
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.2
KOG4547|consensus541 99.2
KOG2315|consensus566 99.2
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 99.18
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.18
KOG4532|consensus344 99.17
COG4946668 Uncharacterized protein related to the periplasmic 99.13
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.12
PLN029191057 haloacid dehalogenase-like hydrolase family protei 99.1
KOG1064|consensus2439 99.09
KOG0309|consensus 1081 99.09
PF04762928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.08
KOG1064|consensus2439 99.05
KOG2041|consensus 1189 99.05
PRK04043419 tolB translocation protein TolB; Provisional 99.05
KOG4532|consensus344 99.04
PRK04043419 tolB translocation protein TolB; Provisional 99.03
KOG4714|consensus319 99.0
KOG2314|consensus698 99.0
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.99
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.98
KOG4714|consensus319 98.96
KOG1912|consensus 1062 98.96
PF04762928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.95
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.92
KOG4190|consensus1034 98.91
KOG4190|consensus1034 98.9
COG4946668 Uncharacterized protein related to the periplasmic 98.89
KOG2041|consensus 1189 98.85
KOG0882|consensus558 98.85
KOG2695|consensus425 98.85
KOG3914|consensus390 98.83
KOG3914|consensus390 98.83
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.81
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.78
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.74
KOG1275|consensus 1118 98.73
KOG2066|consensus846 98.73
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.73
KOG1832|consensus1516 98.7
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 98.69
KOG1008|consensus783 98.69
KOG1645|consensus463 98.68
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.67
KOG2114|consensus 933 98.66
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.65
KOG1912|consensus 1062 98.64
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.64
KOG1832|consensus1516 98.64
KOG2695|consensus425 98.57
KOG1275|consensus 1118 98.54
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.54
KOG1645|consensus463 98.53
KOG1920|consensus 1265 98.49
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.46
KOG2066|consensus 846 98.41
KOG0882|consensus558 98.4
KOG2114|consensus 933 98.37
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 98.34
PRK02888635 nitrous-oxide reductase; Validated 98.28
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.26
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 98.26
KOG1920|consensus 1265 98.25
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.23
KOG3617|consensus 1416 98.22
KOG1008|consensus783 98.2
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.19
KOG3621|consensus726 98.19
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 98.17
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 98.17
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.16
COG0823425 TolB Periplasmic component of the Tol biopolymer t 98.15
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 98.12
COG0823425 TolB Periplasmic component of the Tol biopolymer t 98.1
PRK02888635 nitrous-oxide reductase; Validated 98.09
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.08
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 98.06
KOG4649|consensus354 98.05
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.03
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 98.01
KOG4649|consensus354 98.01
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.92
COG3391381 Uncharacterized conserved protein [Function unknow 97.91
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.89
COG3386307 Gluconolactonase [Carbohydrate transport and metab 97.88
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.87
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.85
KOG3621|consensus726 97.78
KOG3617|consensus 1416 97.76
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.75
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.74
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 97.7
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.65
COG3391381 Uncharacterized conserved protein [Function unknow 97.6
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.55
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.45
KOG2444|consensus238 97.39
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.39
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 97.31
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.29
COG5276370 Uncharacterized conserved protein [Function unknow 97.27
KOG4640|consensus665 97.26
PRK10115686 protease 2; Provisional 97.23
COG3490366 Uncharacterized protein conserved in bacteria [Fun 97.23
PRK13616591 lipoprotein LpqB; Provisional 97.22
PRK13616591 lipoprotein LpqB; Provisional 97.21
KOG2395|consensus644 97.21
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 97.2
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 97.18
KOG2079|consensus 1206 97.11
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 97.09
KOG4640|consensus665 97.05
PF15390671 DUF4613: Domain of unknown function (DUF4613) 97.05
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 96.97
KOG1897|consensus1096 96.96
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 96.96
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.84
KOG2395|consensus644 96.82
COG3386307 Gluconolactonase [Carbohydrate transport and metab 96.82
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 96.82
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 96.81
COG3490366 Uncharacterized protein conserved in bacteria [Fun 96.8
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.74
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.73
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 96.71
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 96.69
PRK10115686 protease 2; Provisional 96.69
COG3204316 Uncharacterized protein conserved in bacteria [Fun 96.68
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.64
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 96.56
COG3204316 Uncharacterized protein conserved in bacteria [Fun 96.48
PF15390671 DUF4613: Domain of unknown function (DUF4613) 96.4
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 96.36
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 96.35
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 96.32
KOG4499|consensus310 96.3
KOG3630|consensus 1405 96.29
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 96.2
KOG1897|consensus1096 96.12
PHA02713557 hypothetical protein; Provisional 96.08
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 96.05
KOG2444|consensus238 96.04
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 96.03
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 95.92
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 95.81
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 95.81
KOG2079|consensus 1206 95.78
KOG3630|consensus 1405 95.74
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 95.67
KOG4499|consensus310 95.65
KOG4441|consensus571 95.38
PHA02713557 hypothetical protein; Provisional 95.26
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 95.22
PF10214765 Rrn6: RNA polymerase I-specific transcription-init 95.2
KOG1916|consensus 1283 95.17
PF10214765 Rrn6: RNA polymerase I-specific transcription-init 95.14
KOG2280|consensus829 94.96
TIGR03074764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 94.61
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 94.48
KOG4441|consensus571 94.42
COG5276370 Uncharacterized conserved protein [Function unknow 94.31
PF14727418 PHTB1_N: PTHB1 N-terminus 94.29
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 94.24
PHA03098534 kelch-like protein; Provisional 94.22
PF12234631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 94.21
PRK13684334 Ycf48-like protein; Provisional 93.99
PF08728717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 93.99
PF10395670 Utp8: Utp8 family; InterPro: IPR018843 Utp8 is an 93.89
TIGR03074764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 93.89
KOG2377|consensus657 93.79
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 93.77
PF12234631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 93.69
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 93.65
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 93.42
KOG2377|consensus657 93.38
COG5167776 VID27 Protein involved in vacuole import and degra 93.31
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 93.29
PHA03098534 kelch-like protein; Provisional 93.25
PF10395670 Utp8: Utp8 family; InterPro: IPR018843 Utp8 is an 93.17
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 93.08
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 92.84
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 92.79
PF08728717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 92.67
PRK13684334 Ycf48-like protein; Provisional 92.66
KOG2247|consensus615 92.51
COG5167776 VID27 Protein involved in vacuole import and degra 92.43
PLN02153341 epithiospecifier protein 92.33
KOG1916|consensus 1283 92.15
TIGR03606454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 92.1
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 92.08
KOG1983|consensus 993 92.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 91.92
PHA02790480 Kelch-like protein; Provisional 91.91
PF13449326 Phytase-like: Esterase-like activity of phytase 91.76
PLN00033398 photosystem II stability/assembly factor; Provisio 91.53
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 91.5
KOG2280|consensus 829 91.25
PF13449326 Phytase-like: Esterase-like activity of phytase 91.18
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 90.89
PF10433504 MMS1_N: Mono-functional DNA-alkylating methyl meth 90.65
COG5290 1243 IkappaB kinase complex, IKAP component [Transcript 90.64
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 90.59
KOG2247|consensus615 90.52
PF05935477 Arylsulfotrans: Arylsulfotransferase (ASST); Inter 90.48
PF14269299 Arylsulfotran_2: Arylsulfotransferase (ASST) 90.33
COG5290 1243 IkappaB kinase complex, IKAP component [Transcript 89.97
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 89.97
KOG1898|consensus1205 89.94
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 89.71
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 89.64
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 89.56
PLN02193470 nitrile-specifier protein 89.52
KOG4460|consensus741 88.91
KOG4659|consensus 1899 88.82
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 87.95
COG4590733 ABC-type uncharacterized transport system, permeas 87.91
KOG1900|consensus 1311 87.59
COG3823262 Glutamine cyclotransferase [Posttranslational modi 87.5
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 87.41
PLN02153341 epithiospecifier protein 87.35
KOG4460|consensus741 87.32
PHA02790480 Kelch-like protein; Provisional 87.3
PLN00033398 photosystem II stability/assembly factor; Provisio 87.11
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 87.02
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 86.7
KOG1900|consensus 1311 86.37
smart00036302 CNH Domain found in NIK1-like kinases, mouse citro 86.05
KOG2109|consensus788 85.94
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 85.86
PF12768281 Rax2: Cortical protein marker for cell polarity 85.33
smart00036302 CNH Domain found in NIK1-like kinases, mouse citro 85.2
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 85.11
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 84.57
COG3823262 Glutamine cyclotransferase [Posttranslational modi 84.21
COG4590733 ABC-type uncharacterized transport system, permeas 83.57
TIGR01063800 gyrA DNA gyrase, A subunit. This model describes t 83.55
TIGR03606454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 82.81
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 82.8
PF12657173 TFIIIC_delta: Transcription factor IIIC subunit de 82.71
>KOG0284|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.2e-51  Score=415.96  Aligned_cols=348  Identities=58%  Similarity=1.060  Sum_probs=329.4

Q ss_pred             CCCCCchhhcccccCcceeechhhHHHHHHHhchhhcccCCccCCCccccccCCCCCCCcccccccceeeeEEecccCCc
Q psy13969         61 MDPDFDGKKLRKSSMRKTVDYNAAVINALEARVWQRDYRDRRALQPDVMYYPHMLPPPSFEDNATNAVTTRFVKAATNKM  140 (877)
Q Consensus        61 ~~~~~~~~~~~~~~~~~~~~y~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  140 (877)
                      ....+++++|+|...|+.++|++.+.++.+.|.|+.. ++...+.++..|.-++.++-.+..+..++.+.+|..+..++.
T Consensus        17 ~~~~~~g~rlrk~~~Rr~VDy~s~v~~~~~nR~~~~~-~d~~~~~p~~~~~~~~~pp~~~~~dp~~~~~tKf~h~s~NKv   95 (464)
T KOG0284|consen   17 PNRKEDGKRLRKPVARRTVDYNSPVCNYRQNRRWQYD-RDRALLQPDSSYIIDLVPPSLYLDDPSSAFTTKFVHTSSNKV   95 (464)
T ss_pred             ccccccCccccchhhhcccCCCcHHHHHHHHHhhccc-ccccccCCCchhhhcccChhhccCCcccccccceEecccccc
Confidence            3456778999999999999999999999999999998 788889999999999999988888889999999999999999


Q ss_pred             cCCeEEEEEccCCcee------------------------eccCCEEEEEEcCCCCEEEEEeCCCeEEEEeCCCcceEEE
Q psy13969        141 RCPIFSMTWTPEGRRL------------------------AHDCAVRHMVWSHNGLWMVTSDHQGYIKYWQSNMNNVKTF  196 (877)
Q Consensus       141 ~~~i~~~~~sp~g~~l------------------------~h~~~V~~l~~spd~~~l~sg~~dg~v~iwd~~~~~~~~~  196 (877)
                      ++.|..+.|+|+|++|                        +|+++|+++.|++++.++++++.+|.|++|+.+.+.++.+
T Consensus        96 kc~V~~v~WtPeGRRLltgs~SGEFtLWNg~~fnFEtilQaHDs~Vr~m~ws~~g~wmiSgD~gG~iKyWqpnmnnVk~~  175 (464)
T KOG0284|consen   96 KCPVNVVRWTPEGRRLLTGSQSGEFTLWNGTSFNFETILQAHDSPVRTMKWSHNGTWMISGDKGGMIKYWQPNMNNVKII  175 (464)
T ss_pred             ccceeeEEEcCCCceeEeecccccEEEecCceeeHHHHhhhhcccceeEEEccCCCEEEEcCCCceEEecccchhhhHHh
Confidence            9999999999999888                        5999999999999999999999999999999999999988


Q ss_pred             ccCC-CCeeEEEEcCCCCEEEEEECCCcEEEEeccCCeeeEEeccCCCCeEEEEEcCCCCEEEEEecCCcccEEEEcCCC
Q psy13969        197 QGHK-ESIRGISFSPSDSKFATCSDDGTVRVWDFYRCTEEKVLRGHGADVKCVDWHPYKSLIVSGSKDNQQPVKLWDPKA  275 (877)
Q Consensus       197 ~~h~-~~V~~i~~sp~~~~l~sgs~Dg~I~iwd~~~~~~~~~l~~h~~~v~~v~~sp~~~~l~sgs~dg~~~I~iwd~~~  275 (877)
                      ..|. ..|++++|+|++..|++||+|++|+|||....+..+.|.+|...|.|++|+|...+||+++.|..  |++||.++
T Consensus       176 ~ahh~eaIRdlafSpnDskF~t~SdDg~ikiWdf~~~kee~vL~GHgwdVksvdWHP~kgLiasgskDnl--VKlWDprS  253 (464)
T KOG0284|consen  176 QAHHAEAIRDLAFSPNDSKFLTCSDDGTIKIWDFRMPKEERVLRGHGWDVKSVDWHPTKGLIASGSKDNL--VKLWDPRS  253 (464)
T ss_pred             hHhhhhhhheeccCCCCceeEEecCCCeEEEEeccCCchhheeccCCCCcceeccCCccceeEEccCCce--eEeecCCC
Confidence            8776 89999999999999999999999999999999999999999999999999999999999999998  99999999


Q ss_pred             CceeEEeccCCCCeeEEEEccCCCeEEEEeCCCeEEEEEcCCCCcceEEEecCCCCeEEEEEcCCCCcEEEEEeCCCcEE
Q psy13969        276 GQALATLHAHKSTVMDLAWNQNGNWLVTASRDHLLKVFDIRNLSSEVQTFRGHKKEASAVAWHPQHEGLFSSGGADGSIM  355 (877)
Q Consensus       276 ~~~~~~~~~h~~~V~~l~~sp~g~~l~s~s~Dg~I~iwd~~~~~~~~~~~~~h~~~v~~i~~~p~~~~~l~sgs~dg~I~  355 (877)
                      +.++.++..|+..|..+.|++++++|+++|.|..+++||+++ -+.+.++++|+..|++++|+|-...+|++++.|+.|.
T Consensus       254 g~cl~tlh~HKntVl~~~f~~n~N~Llt~skD~~~kv~DiR~-mkEl~~~r~Hkkdv~~~~WhP~~~~lftsgg~Dgsvv  332 (464)
T KOG0284|consen  254 GSCLATLHGHKNTVLAVKFNPNGNWLLTGSKDQSCKVFDIRT-MKELFTYRGHKKDVTSLTWHPLNESLFTSGGSDGSVV  332 (464)
T ss_pred             cchhhhhhhccceEEEEEEcCCCCeeEEccCCceEEEEehhH-hHHHHHhhcchhhheeeccccccccceeeccCCCceE
Confidence            999999999999999999999999999999999999999996 4678899999999999999999999999999999999


Q ss_pred             EEEcCCCceeEEecCcCCCCEEEEEEcCCCCEEEEEEcCCeEEEEeCCCCCCCcccc
Q psy13969        356 FWHVGADKEVGCIPQAHDNIIWTMAWHPLGHILATGSNDHASKFWTRNRLGDPMRDR  412 (877)
Q Consensus       356 iwd~~~~~~~~~~~~~h~~~V~~v~~sp~g~~l~sg~~dg~v~iwd~~~~~~~~~~~  412 (877)
                      +|.+...+++..+..+|+..|++++|+|-|++|++++.|.++++|..+++++.....
T Consensus       333 h~~v~~~~p~~~i~~AHd~~iwsl~~hPlGhil~tgsnd~t~rfw~r~rp~d~~~~~  389 (464)
T KOG0284|consen  333 HWVVGLEEPLGEIPPAHDGEIWSLAYHPLGHILATGSNDRTVRFWTRNRPGDKNADD  389 (464)
T ss_pred             EEeccccccccCCCcccccceeeeeccccceeEeecCCCcceeeeccCCCCCccccc
Confidence            999998888988989999999999999999999999999999999999887765443

>KOG0271|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG3546|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG3546|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF10214 Rrn6: RNA polymerase I-specific transcription-initiation factor; InterPro: IPR019350 RNA polymerase I-specific transcription-initiation factor Rrn6 and Rrn7 represent components of a multisubunit transcription factor essential for the initiation of rDNA transcription by Pol I [] Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>PF10214 Rrn6: RNA polymerase I-specific transcription-initiation factor; InterPro: IPR019350 RNA polymerase I-specific transcription-initiation factor Rrn6 and Rrn7 represent components of a multisubunit transcription factor essential for the initiation of rDNA transcription by Pol I [] Back     alignment and domain information
>KOG2280|consensus Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PF10395 Utp8: Utp8 family; InterPro: IPR018843 Utp8 is an essential component of the nuclear tRNA export machinery in Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PF10395 Utp8: Utp8 family; InterPro: IPR018843 Utp8 is an essential component of the nuclear tRNA export machinery in Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>KOG2247|consensus Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>KOG1983|consensus Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>KOG2280|consensus Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>PF10433 MMS1_N: Mono-functional DNA-alkylating methyl methanesulfonate N-term; PDB: 2B5M_A 4A0K_C 4A0B_C 3I7L_A 2B5N_C 3I8E_A 4A09_A 4A0A_A 3EI4_C 2B5L_A Back     alignment and domain information
>COG5290 IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>KOG2247|consensus Back     alignment and domain information
>PF05935 Arylsulfotrans: Arylsulfotransferase (ASST); InterPro: IPR010262 This family consists of several bacterial arylsulphotransferase proteins Back     alignment and domain information
>PF14269 Arylsulfotran_2: Arylsulfotransferase (ASST) Back     alignment and domain information
>COG5290 IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>KOG1898|consensus Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>KOG4460|consensus Back     alignment and domain information
>KOG4659|consensus Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>COG4590 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>KOG1900|consensus Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>KOG4460|consensus Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>KOG1900|consensus Back     alignment and domain information
>smart00036 CNH Domain found in NIK1-like kinases, mouse citron and yeast ROM1, ROM2 Back     alignment and domain information
>KOG2109|consensus Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>smart00036 CNH Domain found in NIK1-like kinases, mouse citron and yeast ROM1, ROM2 Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4590 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>TIGR01063 gyrA DNA gyrase, A subunit Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query877
2ymu_A577 Structure Of A Highly Repetitive Propeller Structur 5e-24
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 2e-23
2gnq_A336 Structure Of Wdr5 Length = 336 2e-23
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 4e-23
2h9l_A329 Wdr5delta23 Length = 329 5e-23
2g99_A308 Structural Basis For The Specific Recognition Of Me 5e-23
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 5e-23
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 5e-23
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 5e-23
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 5e-23
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 6e-23
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 6e-23
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 7e-23
2g9a_A311 Structural Basis For The Specific Recognition Of Me 7e-23
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 8e-23
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 1e-22
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 5e-22
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 6e-22
1vyh_C410 Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 2e-18
3fm0_A345 Crystal Structure Of Wd40 Protein Ciao1 Length = 34 3e-18
1erj_A393 Crystal Structure Of The C-Terminal Wd40 Domain Of 5e-16
2pbi_B354 The Multifunctional Nature Of Gbeta5RGS9 REVEALED F 1e-15
2xyi_A430 Crystal Structure Of Nurf55 In Complex With A H4 Pe 2e-14
3c99_A432 Structural Basis Of Histone H4 Recognition By P55 L 2e-14
2yba_A422 Crystal Structure Of Nurf55 In Complex With Histone 3e-14
3gfc_A425 Crystal Structure Of Histone-Binding Protein Rbbp4 3e-14
3izb_a319 Localization Of The Small Subunit Ribosomal Protein 3e-14
1trj_A314 Homology Model Of Yeast Rack1 Protein Fitted Into 1 3e-14
3rfg_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 3e-14
3jyv_R313 Structure Of The 40s Rrna And Proteins And PE TRNA 3e-14
3rfh_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 4e-14
2ovp_B445 Structure Of The Skp1-Fbw7 Complex Length = 445 4e-14
2ovp_B445 Structure Of The Skp1-Fbw7 Complex Length = 445 4e-08
2hes_X330 Cytosolic Iron-sulphur Assembly Protein- 1 Length = 1e-13
2hes_X330 Cytosolic Iron-sulphur Assembly Protein- 1 Length = 4e-04
3cfs_B414 Structural Basis Of The Interaction Of Rbap46RBAP48 2e-13
3cfv_B414 Structural Basis Of The Interaction Of Rbap46RBAP48 2e-13
2yno_A310 Yeast Betaprime Cop 1-304h6 Length = 310 1e-12
2ynn_A304 Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 1e-12
4aez_A401 Crystal Structure Of Mitotic Checkpoint Complex Len 2e-12
3frx_A319 Crystal Structure Of The Yeast Orthologue Of Rack1, 2e-12
2ynp_A604 Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 4e-12
3mkq_A814 Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subco 5e-12
3dm0_A694 Maltose Binding Protein Fusion With Rack1 From A. T 7e-12
3dm0_A694 Maltose Binding Protein Fusion With Rack1 From A. T 3e-06
3iz6_a380 Localization Of The Small Subunit Ribosomal Protein 1e-11
3iz6_a380 Localization Of The Small Subunit Ribosomal Protein 2e-10
1p22_A435 Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex 2e-11
1got_B340 Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimer 7e-11
1gg2_B340 G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Bet 7e-11
1a0r_B340 Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA- 7e-11
2bcj_B340 Crystal Structure Of G Protein-coupled Receptor Kin 7e-11
3sn6_B351 Crystal Structure Of The Beta2 Adrenergic Receptor- 8e-11
2b4e_A402 Crystal Structure Of Murine Coronin-1: Monoclinic F 1e-10
2aq5_A402 Crystal Structure Of Murine Coronin-1 Length = 402 1e-10
3shf_A1256 Crystal Structure Of The R265s Mutant Of Full-Lengt 3e-10
3sfz_A1249 Crystal Structure Of Full-Length Murine Apaf-1 Leng 3e-10
3zey_7318 High-resolution Cryo-electron Microscopy Structure 6e-10
3zey_7318 High-resolution Cryo-electron Microscopy Structure 3e-07
3iza_B1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 1e-09
2pm9_A416 Crystal Structure Of Yeast Sec1331 VERTEX ELEMENT O 2e-09
2zkq_a317 Structure Of A Mammalian Ribosomal 40s Subunit With 4e-09
4aow_A340 Crystal Structure Of The Human Rack1 Protein At A R 4e-09
4ggd_A431 Structural Analysis Of Human Cdc20 Supports Multisi 3e-08
4ggd_A431 Structural Analysis Of Human Cdc20 Supports Multisi 2e-04
4gga_A420 Structural Analysis Of Human Cdc20 Supports Multi-S 3e-08
4gga_A420 Structural Analysis Of Human Cdc20 Supports Multi-S 2e-04
3ow8_A321 Crystal Structure Of The Wd Repeat-Containing Prote 5e-08
4gqb_B344 Crystal Structure Of The Human Prmt5:mep50 Complex 7e-08
4ggc_A318 Structural Analysis Of Human Cdc20 Supports Multi-S 2e-07
4ggc_A318 Structural Analysis Of Human Cdc20 Supports Multi-S 9e-04
4e54_B435 Damaged Dna Induced Uv-Damaged Dna-Binding Protein 2e-07
4e5z_B436 Damaged Dna Induced Uv-Damaged Dna-Binding Protein 2e-07
3ei4_B436 Structure Of The Hsddb1-Hsddb2 Complex Length = 436 3e-07
2xzm_R343 Crystal Structure Of The Eukaryotic 40s Ribosomal S 5e-07
2xzm_R343 Crystal Structure Of The Eukaryotic 40s Ribosomal S 2e-05
4g56_B357 Crystal Structure Of Full Length Prmt5/mep50 Comple 5e-07
4g56_B357 Crystal Structure Of Full Length Prmt5/mep50 Comple 2e-05
3jro_A753 Nup84-Nup145c-Sec13 Edge Element Of The Npc Lattice 7e-07
3jrp_A379 Sec13 With Nup145c (Aa109-179) Insertion Blade Leng 2e-06
3mks_B464 Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH 4e-06
2pm6_B297 Crystal Structure Of Yeast Sec1331 EDGE ELEMENT OF 4e-06
3odt_A313 Crystal Structure Of Wd40 Beta Propeller Domain Of 5e-06
3odt_A313 Crystal Structure Of Wd40 Beta Propeller Domain Of 7e-06
2pm9_B297 Crystal Structure Of Yeast Sec1331 VERTEX ELEMENT O 5e-06
3bg0_A316 Architecture Of A Coat For The Nuclear Pore Membran 7e-06
1nex_B464 Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Comp 7e-06
1gxr_A337 Wd40 Region Of Human Groucho/tle1 Length = 337 7e-06
1r5m_A425 Crystal Structure Of The C-Terminal Wd40 Domain Of 4e-05
2pm7_B297 Crystal Structure Of Yeast Sec1331 EDGE ELEMENT OF 4e-05
3acp_A417 Crystal Structure Of Yeast Rpn14, A Chaperone Of Th 1e-04
3vl1_A420 Crystal Structure Of Yeast Rpn14 Length = 420 1e-04
4a11_B408 Structure Of The Hsddb1-Hscsa Complex Length = 408 1e-04
1nr0_A611 Two Seven-Bladed Beta-Propeller Domains Revealed By 2e-04
1nr0_A611 Two Seven-Bladed Beta-Propeller Domains Revealed By 3e-04
3zwl_B369 Structure Of Eukaryotic Translation Initiation Fact 2e-04
1pgu_A615 Yeast Actin Interacting Protein 1 (aip1), Se-met Pr 3e-04
1pi6_A615 Yeast Actin Interacting Protein 1 (Aip1), Orthorhom 4e-04
3mmy_A368 Structural And Functional Analysis Of The Interacti 5e-04
>pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 Back     alignment and structure 
Iteration: 1

 Score =  110 bits (274), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 76/250 (30%), Positives = 128/250 (51%), Gaps = 9/250 (3%)
Query: 154 RRLAHDCAVRHMVWSHNGLWMVTSDHQGYIKYWQSNMNNVKTFQGHKESIRGISFSPSDS 213
           R  AH  +VR + +S +G  + ++     +K W  N   ++T  GH  S+ G++FSP   
Sbjct: 11  RLEAHSSSVRGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVWGVAFSPDGQ 70
Query: 214 KFATCSDDGTVRVWDFYRCTEEKVLRGHGADVKCVDWHPYKSLIVSGSKDNQQPVKLWDP 273
             A+ SDD TV++W+       + L GH + V+ V + P    I S S D  + VKLW+ 
Sbjct: 71  TIASASDDKTVKLWN-RNGQLLQTLTGHSSSVRGVAFSPDGQTIASASDD--KTVKLWN- 126
Query: 274 KAGQALATLHAHKSTVMDLAWNQNGNWLVTASRDHLLKVFDIRNLSSEVQTFRGHKKEAS 333
           + GQ L TL  H S+V  +A++ +G  + +AS D  +K+++ RN    +QT  GH     
Sbjct: 127 RNGQLLQTLTGHSSSVWGVAFSPDGQTIASASDDKTVKLWN-RN-GQLLQTLTGHSSSVW 184
Query: 334 AVAWHPQHEGLFSSGGADGSIMFWHVGADKEVGCIPQAHDNIIWTMAWHPLGHILATGSN 393
            VA+ P  +   +S   D ++  W+   + ++      H + +  +A+ P G  +A+ S+
Sbjct: 185 GVAFSPDGQ-TIASASDDKTVKLWN--RNGQLLQTLTGHSSSVRGVAFSPDGQTIASASD 241
Query: 394 DHASKFWTRN 403
           D   K W RN
Sbjct: 242 DKTVKLWNRN 251
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|1VYH|C Chain C, Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 Back     alignment and structure
>pdb|3FM0|A Chain A, Crystal Structure Of Wd40 Protein Ciao1 Length = 345 Back     alignment and structure
>pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393 Back     alignment and structure
>pdb|2PBI|B Chain B, The Multifunctional Nature Of Gbeta5RGS9 REVEALED FROM ITS CRYSTAL Structure Length = 354 Back     alignment and structure
>pdb|2XYI|A Chain A, Crystal Structure Of Nurf55 In Complex With A H4 Peptide Length = 430 Back     alignment and structure
>pdb|3C99|A Chain A, Structural Basis Of Histone H4 Recognition By P55 Length = 432 Back     alignment and structure
>pdb|2YBA|A Chain A, Crystal Structure Of Nurf55 In Complex With Histone H3 Length = 422 Back     alignment and structure
>pdb|3GFC|A Chain A, Crystal Structure Of Histone-Binding Protein Rbbp4 Length = 425 Back     alignment and structure
>pdb|3IZB|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 319 Back     alignment and structure
>pdb|1TRJ|A Chain A, Homology Model Of Yeast Rack1 Protein Fitted Into 11.7a Cryo-em Map Of Yeast 80s Ribosome Length = 314 Back     alignment and structure
>pdb|3RFG|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P63 Length = 319 Back     alignment and structure
>pdb|3JYV|R Chain R, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 313 Back     alignment and structure
>pdb|3RFH|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P21 Length = 319 Back     alignment and structure
>pdb|2OVP|B Chain B, Structure Of The Skp1-Fbw7 Complex Length = 445 Back     alignment and structure
>pdb|2OVP|B Chain B, Structure Of The Skp1-Fbw7 Complex Length = 445 Back     alignment and structure
>pdb|2HES|X Chain X, Cytosolic Iron-sulphur Assembly Protein- 1 Length = 330 Back     alignment and structure
>pdb|2HES|X Chain X, Cytosolic Iron-sulphur Assembly Protein- 1 Length = 330 Back     alignment and structure
>pdb|3CFS|B Chain B, Structural Basis Of The Interaction Of Rbap46RBAP48 WITH Histone H4 Length = 414 Back     alignment and structure
>pdb|3CFV|B Chain B, Structural Basis Of The Interaction Of Rbap46RBAP48 WITH Histone H4 Length = 414 Back     alignment and structure
>pdb|2YNO|A Chain A, Yeast Betaprime Cop 1-304h6 Length = 310 Back     alignment and structure
>pdb|2YNN|A Chain A, Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 304 Back     alignment and structure
>pdb|4AEZ|A Chain A, Crystal Structure Of Mitotic Checkpoint Complex Length = 401 Back     alignment and structure
>pdb|3FRX|A Chain A, Crystal Structure Of The Yeast Orthologue Of Rack1, Asc1. Length = 319 Back     alignment and structure
>pdb|2YNP|A Chain A, Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 604 Back     alignment and structure
>pdb|3MKQ|A Chain A, Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subcomplex Of The Copi Vesicular Coat Length = 814 Back     alignment and structure
>pdb|3DM0|A Chain A, Maltose Binding Protein Fusion With Rack1 From A. Thaliana Length = 694 Back     alignment and structure
>pdb|3DM0|A Chain A, Maltose Binding Protein Fusion With Rack1 From A. Thaliana Length = 694 Back     alignment and structure
>pdb|3IZ6|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 380 Back     alignment and structure
>pdb|3IZ6|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 380 Back     alignment and structure
>pdb|1P22|A Chain A, Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex: Destruction Motif Binding And Lysine Specificity On The Scfbeta-Trcp1 Ubiquitin Ligase Length = 435 Back     alignment and structure
>pdb|1GOT|B Chain B, Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimera And The Gt-Beta-Gamma Subunits Length = 340 Back     alignment and structure
>pdb|1GG2|B Chain B, G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Beta_1 Gamma_2 With Gdp Bound Length = 340 Back     alignment and structure
>pdb|1A0R|B Chain B, Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA-Gamma Length = 340 Back     alignment and structure
>pdb|2BCJ|B Chain B, Crystal Structure Of G Protein-coupled Receptor Kinase 2 In Complex With Galpha-q And Gbetagamma Subunits Length = 340 Back     alignment and structure
>pdb|3SN6|B Chain B, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex Length = 351 Back     alignment and structure
>pdb|2B4E|A Chain A, Crystal Structure Of Murine Coronin-1: Monoclinic Form Length = 402 Back     alignment and structure
>pdb|2AQ5|A Chain A, Crystal Structure Of Murine Coronin-1 Length = 402 Back     alignment and structure
>pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 Back     alignment and structure
>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 Back     alignment and structure
>pdb|3ZEY|7 Chain 7, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 318 Back     alignment and structure
>pdb|3ZEY|7 Chain 7, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 318 Back     alignment and structure
>pdb|2PM9|A Chain A, Crystal Structure Of Yeast Sec1331 VERTEX ELEMENT OF THE Copii Vesicular Coat Length = 416 Back     alignment and structure
>pdb|2ZKQ|AA Chain a, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 317 Back     alignment and structure
>pdb|4AOW|A Chain A, Crystal Structure Of The Human Rack1 Protein At A Resolution Of 2.45 Angstrom Length = 340 Back     alignment and structure
>pdb|4GGD|A Chain A, Structural Analysis Of Human Cdc20 Supports Multisite Degron Recognition By ApcC. Length = 431 Back     alignment and structure
>pdb|4GGD|A Chain A, Structural Analysis Of Human Cdc20 Supports Multisite Degron Recognition By ApcC. Length = 431 Back     alignment and structure
>pdb|4GGA|A Chain A, Structural Analysis Of Human Cdc20 Supports Multi-Site Degron Recognition By ApcC Length = 420 Back     alignment and structure
>pdb|4GGA|A Chain A, Structural Analysis Of Human Cdc20 Supports Multi-Site Degron Recognition By ApcC Length = 420 Back     alignment and structure
>pdb|3OW8|A Chain A, Crystal Structure Of The Wd Repeat-Containing Protein 61 Length = 321 Back     alignment and structure
>pdb|4GQB|B Chain B, Crystal Structure Of The Human Prmt5:mep50 Complex Length = 344 Back     alignment and structure
>pdb|4GGC|A Chain A, Structural Analysis Of Human Cdc20 Supports Multi-Site Degron Recognition By ApcC Length = 318 Back     alignment and structure
>pdb|4GGC|A Chain A, Structural Analysis Of Human Cdc20 Supports Multi-Site Degron Recognition By ApcC Length = 318 Back     alignment and structure
>pdb|4E54|B Chain B, Damaged Dna Induced Uv-Damaged Dna-Binding Protein (Uv-Ddb) Dimerization And Its Roles In Chromatinized Dna Repair Length = 435 Back     alignment and structure
>pdb|4E5Z|B Chain B, Damaged Dna Induced Uv-Damaged Dna-Binding Protein (Uv-Ddb) Dimerization And Its Roles In Chromatinized Dna Repair Length = 436 Back     alignment and structure
>pdb|3EI4|B Chain B, Structure Of The Hsddb1-Hsddb2 Complex Length = 436 Back     alignment and structure
>pdb|2XZM|R Chain R, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit In Complex With Initiation Factor 1. This File Contains The 40s Subunit And Initiation Factor For Molecule 1 Length = 343 Back     alignment and structure
>pdb|2XZM|R Chain R, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit In Complex With Initiation Factor 1. This File Contains The 40s Subunit And Initiation Factor For Molecule 1 Length = 343 Back     alignment and structure
>pdb|4G56|B Chain B, Crystal Structure Of Full Length Prmt5/mep50 Complexes From Xenopus Laevis Length = 357 Back     alignment and structure
>pdb|4G56|B Chain B, Crystal Structure Of Full Length Prmt5/mep50 Complexes From Xenopus Laevis Length = 357 Back     alignment and structure
>pdb|3JRO|A Chain A, Nup84-Nup145c-Sec13 Edge Element Of The Npc Lattice Length = 753 Back     alignment and structure
>pdb|3JRP|A Chain A, Sec13 With Nup145c (Aa109-179) Insertion Blade Length = 379 Back     alignment and structure
>pdb|3MKS|B Chain B, Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH AN ALLOSTERIC Inhibitor Scf-I2 Length = 464 Back     alignment and structure
>pdb|2PM6|B Chain B, Crystal Structure Of Yeast Sec1331 EDGE ELEMENT OF THE Copii Vesicular Coat, Native Version Length = 297 Back     alignment and structure
>pdb|3ODT|A Chain A, Crystal Structure Of Wd40 Beta Propeller Domain Of Doa1 Length = 313 Back     alignment and structure
>pdb|3ODT|A Chain A, Crystal Structure Of Wd40 Beta Propeller Domain Of Doa1 Length = 313 Back     alignment and structure
>pdb|2PM9|B Chain B, Crystal Structure Of Yeast Sec1331 VERTEX ELEMENT OF THE Copii Vesicular Coat Length = 297 Back     alignment and structure
>pdb|3BG0|A Chain A, Architecture Of A Coat For The Nuclear Pore Membrane Length = 316 Back     alignment and structure
>pdb|1NEX|B Chain B, Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Complex Length = 464 Back     alignment and structure
>pdb|1GXR|A Chain A, Wd40 Region Of Human Groucho/tle1 Length = 337 Back     alignment and structure
>pdb|1R5M|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Sif2 Length = 425 Back     alignment and structure
>pdb|2PM7|B Chain B, Crystal Structure Of Yeast Sec1331 EDGE ELEMENT OF THE Copii Vesicular Coat, Selenomethionine Version Length = 297 Back     alignment and structure
>pdb|3ACP|A Chain A, Crystal Structure Of Yeast Rpn14, A Chaperone Of The 19s Reg Particle Of The Proteasome Length = 417 Back     alignment and structure
>pdb|3VL1|A Chain A, Crystal Structure Of Yeast Rpn14 Length = 420 Back     alignment and structure
>pdb|4A11|B Chain B, Structure Of The Hsddb1-Hscsa Complex Length = 408 Back     alignment and structure
>pdb|1NR0|A Chain A, Two Seven-Bladed Beta-Propeller Domains Revealed By The Structure Of A C. Elegans Homologue Of Yeast Actin Interacting Protein 1 (Aip1). Length = 611 Back     alignment and structure
>pdb|1NR0|A Chain A, Two Seven-Bladed Beta-Propeller Domains Revealed By The Structure Of A C. Elegans Homologue Of Yeast Actin Interacting Protein 1 (Aip1). Length = 611 Back     alignment and structure
>pdb|3ZWL|B Chain B, Structure Of Eukaryotic Translation Initiation Factor Eif3i Complex With Eif3b C-Terminus (655-700) Length = 369 Back     alignment and structure
>pdb|1PGU|A Chain A, Yeast Actin Interacting Protein 1 (aip1), Se-met Protein, Monoclinic Crystal Form Length = 615 Back     alignment and structure
>pdb|1PI6|A Chain A, Yeast Actin Interacting Protein 1 (Aip1), Orthorhombic Crystal Form Length = 615 Back     alignment and structure
>pdb|3MMY|A Chain A, Structural And Functional Analysis Of The Interaction Between The Nucleoporin Nup98 And The Mrna Export Factor Rae1 Length = 368 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query877
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 100.0
3jrp_A379 Fusion protein of protein transport protein SEC13 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
2xyi_A430 Probable histone-binding protein CAF1; transcripti 100.0
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 100.0
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.98
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.98
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.97
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.97
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.97
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.97
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.97
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.97
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.97
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.97
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.97
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 99.97
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 99.97
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 99.97
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.97
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.97
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.97
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.97
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.97
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 99.97
3jro_A753 Fusion protein of protein transport protein SEC13 99.97
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.97
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.97
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.97
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.97
3jrp_A379 Fusion protein of protein transport protein SEC13 99.97
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.97
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.97
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.97
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.97
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.97
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.97
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.96
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.96
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.96
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.96
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.96
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.96
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.96
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.96
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.95
3jro_A753 Fusion protein of protein transport protein SEC13 99.95
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.95
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.95
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.95
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.95
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.95
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.94
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.93
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.93
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.93
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.91
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.9
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.9
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.9
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.89
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.89
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.89
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.89
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.89
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.88
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.88
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.87
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.87
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.87
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.87
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.86
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.86
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.85
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.85
1k32_A1045 Tricorn protease; protein degradation, substrate g 99.84
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.84
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.84
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.83
1k32_A1045 Tricorn protease; protein degradation, substrate g 99.83
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.83
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.83
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.82
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.82
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.81
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.81
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.8
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.79
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.79
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.79
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.77
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.76
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.74
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.72
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.71
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.7
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.7
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.7
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.7
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.69
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.67
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.67
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.67
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.66
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.65
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.65
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.65
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.64
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.63
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.62
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.59
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 99.59
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.58
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.57
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.56
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.56
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.55
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.55
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.55
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.53
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.53
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.53
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.52
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 99.51
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.51
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.5
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.49
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.48
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.47
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.44
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.43
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.43
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.4
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.38
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.36
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.36
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.36
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.36
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.35
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.33
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.28
2qe8_A343 Uncharacterized protein; structural genomics, join 99.28
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.27
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.26
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.22
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.22
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.2
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.17
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.14
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.09
2ece_A462 462AA long hypothetical selenium-binding protein; 99.02
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.01
2qe8_A343 Uncharacterized protein; structural genomics, join 98.97
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 98.95
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.93
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.91
2ece_A462 462AA long hypothetical selenium-binding protein; 98.91
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.87
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.83
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 98.83
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.82
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.82
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.82
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 98.8
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 98.78
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 98.77
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.76
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.74
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.73
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.67
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.67
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.67
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 98.65
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.63
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.62
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.62
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.61
4a2l_A795 BT_4663, two-component system sensor histidine kin 98.59
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.53
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.53
4a2l_A795 BT_4663, two-component system sensor histidine kin 98.52
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.5
3v65_B386 Low-density lipoprotein receptor-related protein; 98.5
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.48
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.48
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.47
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 98.46
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.46
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 98.44
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.43
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 98.37
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.37
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.35
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 98.34
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.32
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 98.23
3v9f_A781 Two-component system sensor histidine kinase/RESP 98.22
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.22
3v9f_A781 Two-component system sensor histidine kinase/RESP 98.17
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.16
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 98.15
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 98.14
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.14
3v65_B386 Low-density lipoprotein receptor-related protein; 98.12
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 98.11
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 98.1
3kya_A496 Putative phosphatase; structural genomics, joint c 98.1
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 98.09
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.09
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 98.08
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 98.05
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 97.99
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 97.98
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 97.97
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 97.96
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 97.9
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 97.9
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 97.9
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 97.89
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 97.88
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 97.84
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 97.82
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 97.82
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 97.8
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.79
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 97.76
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 97.71
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.69
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 97.69
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 97.65
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 97.6
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 97.6
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 97.59
3kya_A496 Putative phosphatase; structural genomics, joint c 97.57
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 97.53
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 97.52
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 97.43
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 97.34
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 97.3
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 97.24
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 97.15
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 97.14
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 97.12
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 97.12
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 96.97
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 96.9
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 96.81
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 96.8
3ott_A758 Two-component system sensor histidine kinase; beta 96.74
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 96.74
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 96.68
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 96.68
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 96.64
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 96.63
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 96.62
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 96.26
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 96.16
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 96.03
3ott_A758 Two-component system sensor histidine kinase; beta 96.03
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 95.99
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 95.95
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 95.95
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 95.85
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 95.8
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 95.79
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 95.46
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 95.44
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 95.41
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 95.16
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 95.09
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 95.06
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 94.82
3qhy_B282 Beta-lactamase inhibitory protein II; enyzme-inhib 94.73
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 94.6
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 94.4
3qhy_B282 Beta-lactamase inhibitory protein II; enyzme-inhib 94.16
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 94.06
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 93.96
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 93.71
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 93.52
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 93.44
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 92.56
1suu_A312 DNA gyrase subunit A; topoisomerase,DNA gyrase, be 91.79
4hvt_A711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 91.7
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 91.35
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 91.11
3uc1_A327 DNA gyrase subunit A; DNA binding protein, topoiso 90.39
3kci_A389 Probable E3 ubiquitin-protein ligase HERC2; WD40, 89.39
3kci_A389 Probable E3 ubiquitin-protein ligase HERC2; WD40, 88.79
1suu_A312 DNA gyrase subunit A; topoisomerase,DNA gyrase, be 87.47
3no0_A276 DNA gyrase subunit A; DNA topology, topoisomerase, 86.48
3l6v_A370 GYRA, DNA gyrase subunit A; gyrase A C-terminal do 86.14
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 84.77
3uc1_A327 DNA gyrase subunit A; DNA binding protein, topoiso 83.9
1wp5_A323 Topoisomerase IV; broken beta-propeller, hairpin-i 83.45
4hvt_A711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 83.24
3no0_A276 DNA gyrase subunit A; DNA topology, topoisomerase, 81.27
1sqj_A789 OXG-RCBH, oligoxyloglucan reducing-END-specific ce 81.03
4d9s_A406 UVB-resistance protein UVR8; UV resistance, UV-B p 80.75
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
Probab=100.00  E-value=1.2e-38  Score=359.45  Aligned_cols=286  Identities=24%  Similarity=0.436  Sum_probs=260.5

Q ss_pred             eeeccCCEEEEEEcCCCCEEEEEeCCCeEEEEeCCCc-ceEEEccCCCCeeEEEEcCCCCEEEEEECCCcEEEEeccCCe
Q psy13969        155 RLAHDCAVRHMVWSHNGLWMVTSDHQGYIKYWQSNMN-NVKTFQGHKESIRGISFSPSDSKFATCSDDGTVRVWDFYRCT  233 (877)
Q Consensus       155 ~l~h~~~V~~l~~spd~~~l~sg~~dg~v~iwd~~~~-~~~~~~~h~~~V~~i~~sp~~~~l~sgs~Dg~I~iwd~~~~~  233 (877)
                      +.+|...|++++|+|++.+|++++.|++|+|||+.+. .+..+..|...|++|+|++++++|++++.|++|+|||+.+.+
T Consensus       104 l~gh~~~V~~~~~~p~~~~l~s~s~Dg~i~vwd~~~~~~~~~l~~h~~~V~~v~~~~~~~~l~sgs~D~~i~iwd~~~~~  183 (410)
T 1vyh_C          104 LSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQGFE  183 (410)
T ss_dssp             EECCSSCEEEEEECSSSSEEEEEESSSCEEEEETTTCCCCEEECCCSSCEEEEEECTTSSEEEEEETTSCCCEEETTSSC
T ss_pred             ecccCCcEEEEEEcCCCCEEEEEeCCCeEEEEECCCCcEEEEEeccCCcEEEEEEcCCCCEEEEEeCCCeEEEEeCCCCc
Confidence            3479999999999999999999999999999997664 567889999999999999999999999999999999999999


Q ss_pred             eeEEeccCCCCeEEEEEcCCCCEEEEEecCCcccEEEEcCCCCceeEEeccCCCCeeEEEEccCCCeEEEEeCCCeEEEE
Q psy13969        234 EEKVLRGHGADVKCVDWHPYKSLIVSGSKDNQQPVKLWDPKAGQALATLHAHKSTVMDLAWNQNGNWLVTASRDHLLKVF  313 (877)
Q Consensus       234 ~~~~l~~h~~~v~~v~~sp~~~~l~sgs~dg~~~I~iwd~~~~~~~~~~~~h~~~V~~l~~sp~g~~l~s~s~Dg~I~iw  313 (877)
                      ++..+.+|...|.+++|+|++++|++++.|+.  |++||++++.++..+..|...|.+++|++++.+|++++.|++|+||
T Consensus       184 ~~~~~~~h~~~V~~v~~~p~~~~l~s~s~D~~--i~~wd~~~~~~~~~~~~h~~~v~~~~~~~~g~~l~s~s~D~~v~vw  261 (410)
T 1vyh_C          184 CIRTMHGHDHNVSSVSIMPNGDHIVSASRDKT--IKMWEVQTGYCVKTFTGHREWVRMVRPNQDGTLIASCSNDQTVRVW  261 (410)
T ss_dssp             EEECCCCCSSCEEEEEECSSSSEEEEEETTSE--EEEEETTTCCEEEEEECCSSCEEEEEECTTSSEEEEEETTSCEEEE
T ss_pred             eeEEEcCCCCCEEEEEEeCCCCEEEEEeCCCe--EEEEECCCCcEEEEEeCCCccEEEEEECCCCCEEEEEcCCCeEEEE
Confidence            99999999999999999999999999999998  9999999999999999999999999999999999999999999999


Q ss_pred             EcCCCCcceEEEecCCCCeEEEEEcCCC-------------------CcEEEEEeCCCcEEEEEcCCCceeEEecCcCCC
Q psy13969        314 DIRNLSSEVQTFRGHKKEASAVAWHPQH-------------------EGLFSSGGADGSIMFWHVGADKEVGCIPQAHDN  374 (877)
Q Consensus       314 d~~~~~~~~~~~~~h~~~v~~i~~~p~~-------------------~~~l~sgs~dg~I~iwd~~~~~~~~~~~~~h~~  374 (877)
                      |+++ ......+..|...|.+++|+|+.                   ..+|++++.|++|+|||++++.++..+ ..|..
T Consensus       262 d~~~-~~~~~~~~~h~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~l~sgs~D~~i~iwd~~~~~~~~~~-~~h~~  339 (410)
T 1vyh_C          262 VVAT-KECKAELREHRHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTL-VGHDN  339 (410)
T ss_dssp             ETTT-CCEEEEECCCSSCEEEEEECCSCGGGGGGGCCSCC-------CCEEEEEETTSEEEEEETTTTEEEEEE-ECCSS
T ss_pred             ECCC-CceeeEecCCCceEEEEEEcCcccccchhhhccccccccCCCCCEEEEEeCCCeEEEEECCCCceEEEE-ECCCC
Confidence            9988 56778899999999999999963                   238999999999999999999988887 68999


Q ss_pred             CEEEEEEcCCCCEEEEEEcCCeEEEEeCCCCCCCcccccccCCcceeeeeeeeeeccCCCCeEEeccCCCCeeeecCC
Q psy13969        375 IIWTMAWHPLGHILATGSNDHASKFWTRNRLGDPMRDRYNQKGLAHCITGVYNEEMELNDSAVIPGMGLEDEDSVFPS  452 (877)
Q Consensus       375 ~V~~v~~sp~g~~l~sg~~dg~v~iwd~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~d~~~l~~~~g~d~~~~~~~~  452 (877)
                      .|++++|++++++|++++.|++|+|||+.... .      ...+..|...|.+++|+++..++++++ .|+.+++|+.
T Consensus       340 ~v~~v~~~~~g~~l~s~s~D~~i~vwd~~~~~-~------~~~~~~h~~~v~~l~~~~~~~~l~sgs-~D~~i~vW~~  409 (410)
T 1vyh_C          340 WVRGVLFHSGGKFILSCADDKTLRVWDYKNKR-C------MKTLNAHEHFVTSLDFHKTAPYVVTGS-VDQTVKVWEC  409 (410)
T ss_dssp             CEEEEEECSSSSCEEEEETTTEEEEECCTTSC-C------CEEEECCSSCEEEEEECSSSSCEEEEE-TTSEEEEEC-
T ss_pred             cEEEEEEcCCCCEEEEEeCCCeEEEEECCCCc-e------EEEEcCCCCcEEEEEEcCCCCEEEEEe-CCCcEEEEeC
Confidence            99999999999999999999999999986532 1      122345666799999999999999875 7999999975
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>3qhy_B Beta-lactamase inhibitory protein II; enyzme-inhibitor complex, beta-propeller, protein:protein interaction; 2.06A {Streptomyces exfoliatus} PDB: 3qi0_A 1jtd_B Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3qhy_B Beta-lactamase inhibitory protein II; enyzme-inhibitor complex, beta-propeller, protein:protein interaction; 2.06A {Streptomyces exfoliatus} PDB: 3qi0_A 1jtd_B Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1suu_A DNA gyrase subunit A; topoisomerase,DNA gyrase, beta-propeller, beta-pinwheel, ISO; HET: DNA; 1.75A {Borrelia burgdorferi} SCOP: b.68.10.1 Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>3uc1_A DNA gyrase subunit A; DNA binding protein, topoisomerase, isomerase; HET: DNA; 1.65A {Mycobacterium tuberculosis} Back     alignment and structure
>3kci_A Probable E3 ubiquitin-protein ligase HERC2; WD40, RCC1, structural genomics consortium, SGC, coiled coil, metal-binding, phosphoprotein; 1.80A {Homo sapiens} Back     alignment and structure
>3kci_A Probable E3 ubiquitin-protein ligase HERC2; WD40, RCC1, structural genomics consortium, SGC, coiled coil, metal-binding, phosphoprotein; 1.80A {Homo sapiens} Back     alignment and structure
>1suu_A DNA gyrase subunit A; topoisomerase,DNA gyrase, beta-propeller, beta-pinwheel, ISO; HET: DNA; 1.75A {Borrelia burgdorferi} SCOP: b.68.10.1 Back     alignment and structure
>3no0_A DNA gyrase subunit A; DNA topology, topoisomerase, C-terminal DO gyrase, DNA binding protein, isomerase; HET: DNA GOL; 1.30A {Aquifex aeolicus} Back     alignment and structure
>3l6v_A GYRA, DNA gyrase subunit A; gyrase A C-terminal domain, GYRA C-terminal domain, DNA wrapping, beta-strand-bearing proline, ATP-binding; HET: DNA; 2.19A {Xanthomonas campestris PV} Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3uc1_A DNA gyrase subunit A; DNA binding protein, topoisomerase, isomerase; HET: DNA; 1.65A {Mycobacterium tuberculosis} Back     alignment and structure
>1wp5_A Topoisomerase IV; broken beta-propeller, hairpin-invaded beta-propeller, six- bladed beta-propeller; 1.79A {Geobacillus stearothermophilus} SCOP: b.68.10.1 Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>3no0_A DNA gyrase subunit A; DNA topology, topoisomerase, C-terminal DO gyrase, DNA binding protein, isomerase; HET: DNA GOL; 1.30A {Aquifex aeolicus} Back     alignment and structure
>1sqj_A OXG-RCBH, oligoxyloglucan reducing-END-specific cellobiohydrolase; beta-propeller; 2.20A {Geotrichum SP} SCOP: b.69.13.1 b.69.13.1 PDB: 2ebs_A* Back     alignment and structure
>4d9s_A UVB-resistance protein UVR8; UV resistance, UV-B photoreceptor, tryptophan chromophores, homodimer, COP1, chromatin-binding protein; 1.70A {Arabidopsis thaliana} PDB: 4dnw_A 4dnu_A 4dnv_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 877
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-32
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 6e-31
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 3e-29
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-27
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 4e-21
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 3e-31
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 1e-29
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 3e-25
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 4e-23
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 8e-23
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 2e-22
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 3e-17
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 2e-06
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 5e-23
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 6e-21
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 3e-18
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 2e-16
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 5e-12
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 2e-06
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 4e-20
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 6e-17
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 4e-16
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 2e-13
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 2e-11
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 2e-11
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 1e-19
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 5e-15
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 7e-13
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 1e-08
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 9e-05
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 9e-18
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 2e-16
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 2e-16
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 2e-15
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 7e-09
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 3e-17
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 5e-12
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 4e-09
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 7e-08
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 4e-17
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 2e-14
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 8e-12
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 3e-10
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 6e-10
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 1e-09
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 2e-08
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 5e-17
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 3e-14
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 3e-13
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 8e-13
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 1e-06
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 2e-05
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 8e-15
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 5e-10
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 3e-08
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 3e-08
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 6e-08
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 2e-06
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 5e-14
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 1e-12
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 5e-11
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 7e-11
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 1e-10
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 1e-10
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 6e-07
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 3e-12
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 4e-11
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 1e-10
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 2e-04
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 6e-12
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 6e-11
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 2e-10
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 1e-08
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 7e-07
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 2e-04
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 2e-11
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 1e-10
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 2e-10
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 5e-10
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 2e-08
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 3e-09
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 3e-08
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 2e-06
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 2e-05
d1qksa2432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 3e-09
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 2e-08
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 3e-08
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 2e-06
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 7e-07
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 0.001
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 1e-06
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 2e-05
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 0.001
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 0.003
d1hzua2426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 5e-05
d1ri6a_333 b.69.11.1 (A:) Putative isomerase YbhE {Escherichi 5e-05
d1ri6a_333 b.69.11.1 (A:) Putative isomerase YbhE {Escherichi 0.001
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]

 Score =  126 bits (317), Expect = 1e-32
 Identities = 58/239 (24%), Positives = 101/239 (42%), Gaps = 25/239 (10%)

Query: 140 MRCPIFSMTWTPEGRRLAHDCAVRHMVWSHNGLWMVTSDHQGYIK-YWQSNMNNVKTFQG 198
                    +        HD  V  +    NG  +V++     IK +       VKTF G
Sbjct: 82  TIKLWDFQGFECIRTMHGHDHNVSSVSIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTG 141

Query: 199 HKESIRGISFSPSDSKFATCSDDGTVRVWDFYRCTEEKVLRGHGADVKCVDWHPYKS--- 255
           H+E +R +  +   +  A+CS+D TVRVW       +  LR H   V+C+ W P  S   
Sbjct: 142 HREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHRHVVECISWAPESSYSS 201

Query: 256 -----------------LIVSGSKDNQQPVKLWDPKAGQALATLHAHKSTVMDLAWNQNG 298
                             ++SGS+D    +K+WD   G  L TL  H + V  + ++  G
Sbjct: 202 ISEATGSETKKSGKPGPFLLSGSRDKT--IKMWDVSTGMCLMTLVGHDNWVRGVLFHSGG 259

Query: 299 NWLVTASRDHLLKVFDIRNLSSEVQTFRGHKKEASAVAWHPQHEGLFSSGGADGSIMFW 357
            ++++ + D  L+V+D +N    ++T   H+   +++ +H        +G  D ++  W
Sbjct: 260 KFILSCADDKTLRVWDYKN-KRCMKTLNAHEHFVTSLDFHK-TAPYVVTGSVDQTVKVW 316
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Length = 333 Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Length = 333 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query877
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.98
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.97
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.97
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.97
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.97
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.96
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.96
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.96
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.95
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.94
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.94
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.94
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.93
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.93
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.93
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.93
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.91
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.91
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.91
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.9
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.86
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.84
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.83
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.83
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.81
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.81
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.77
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.72
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.72
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.71
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.66
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.65
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.63
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.6
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.48
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.47
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.42
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.37
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.32
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.25
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.22
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.2
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.14
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.14
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.13
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.11
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.06
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.05
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.0
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.99
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.82
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.82
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.76
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.75
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.74
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.72
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.69
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.65
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.48
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 98.46
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.27
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 98.08
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 97.87
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 97.87
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 97.77
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.75
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 97.72
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 97.51
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 97.49
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 97.42
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 96.96
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 96.88
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 96.55
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 96.33
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 95.98
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 95.68
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 95.65
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 95.59
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 95.27
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 95.09
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 94.99
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 94.49
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 94.44
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 94.35
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 94.24
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 94.12
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 93.09
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 93.0
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 92.1
d1jtdb_273 beta-lactamase inhibitor protein-II, BLIP-II {Stre 91.37
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 91.12
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 90.8
d1jtdb_273 beta-lactamase inhibitor protein-II, BLIP-II {Stre 90.79
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 90.74
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 89.39
d1wp5a_323 Topoisomerase IV subunit A, ParC, C-terminal domai 83.09
d1wp5a_323 Topoisomerase IV subunit A, ParC, C-terminal domai 81.84
d2hu7a1313 Acylamino-acid-releasing enzyme, N-terminal donain 80.17
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Groucho/tle1, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=9.8e-35  Score=315.53  Aligned_cols=280  Identities=15%  Similarity=0.276  Sum_probs=243.3

Q ss_pred             eeccCCEEEEEEcCCCCEEEEEeCCCeEEEEeCCCcc------eEEEccCCCCeeEEEEcCCCCEEEEEECCCcEEEEec
Q psy13969        156 LAHDCAVRHMVWSHNGLWMVTSDHQGYIKYWQSNMNN------VKTFQGHKESIRGISFSPSDSKFATCSDDGTVRVWDF  229 (877)
Q Consensus       156 l~h~~~V~~l~~spd~~~l~sg~~dg~v~iwd~~~~~------~~~~~~h~~~V~~i~~sp~~~~l~sgs~Dg~I~iwd~  229 (877)
                      +.|...|+||+|++++++|++++ |+.|+|||+....      ......|...|++|+|+|++++|++++.|++|+|||+
T Consensus        48 ~~H~~~V~~v~fs~~g~~latg~-dg~V~iWd~~~~~~~~~~~~~~~~~h~~~I~~v~~s~dg~~l~s~~~dg~i~iwd~  126 (337)
T d1gxra_          48 LNHGEVVCAVTISNPTRHVYTGG-KGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDL  126 (337)
T ss_dssp             ECCSSCCCEEEECSSSSEEEEEC-BSEEEEEETTSTTCCSCSEEEECSCTTSBEEEEEECTTSSEEEEEESSSEEEEEEC
T ss_pred             CCCCCcEEEEEECCCCCEEEEEE-CCEEEEEEccCCcccceeEEeeecCCCCcEEEEEEcCCCCEEEEeecccccccccc
Confidence            36899999999999999999987 8999999975421      2234579999999999999999999999999999998


Q ss_pred             cCC--eeeEEeccCCCCeEEEEEcCCCCEEEEEecCCcccEEEEcCCCCceeEEeccCCCCeeEEEEccCCCeEEEEeCC
Q psy13969        230 YRC--TEEKVLRGHGADVKCVDWHPYKSLIVSGSKDNQQPVKLWDPKAGQALATLHAHKSTVMDLAWNQNGNWLVTASRD  307 (877)
Q Consensus       230 ~~~--~~~~~l~~h~~~v~~v~~sp~~~~l~sgs~dg~~~I~iwd~~~~~~~~~~~~h~~~V~~l~~sp~g~~l~s~s~D  307 (877)
                      ...  +....+..|...|.+++|++++.+|++++.|+.  |++||+++.+....+..|...|++++|++++.++++++.|
T Consensus       127 ~~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~s~~~d~~--i~~~~~~~~~~~~~~~~~~~~v~~l~~s~~~~~~~~~~~d  204 (337)
T d1gxra_         127 AAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGN--IAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLD  204 (337)
T ss_dssp             CCC--EEEEEEECSSSCEEEEEECTTSSEEEEEETTSC--EEEEETTTTEEEEEECCCSSCEEEEEECTTSSEEEEEETT
T ss_pred             cccccccccccccccccccccccccccccccccccccc--cccccccccccccccccccccccccccccccccccccccc
Confidence            743  456677889999999999999999999999998  9999999999999999999999999999999999999999


Q ss_pred             CeEEEEEcCCCCcceEEEecCCCCeEEEEEcCCCCcEEEEEeCCCcEEEEEcCCCceeEEecCcCCCCEEEEEEcCCCCE
Q psy13969        308 HLLKVFDIRNLSSEVQTFRGHKKEASAVAWHPQHEGLFSSGGADGSIMFWHVGADKEVGCIPQAHDNIIWTMAWHPLGHI  387 (877)
Q Consensus       308 g~I~iwd~~~~~~~~~~~~~h~~~v~~i~~~p~~~~~l~sgs~dg~I~iwd~~~~~~~~~~~~~h~~~V~~v~~sp~g~~  387 (877)
                      +.|++||+++ ...+..+ .|...|++++|++++. +|++++.|+.|++||+++.+....  ..|...|++++|++++++
T Consensus       205 ~~v~i~d~~~-~~~~~~~-~~~~~i~~l~~~~~~~-~l~~~~~d~~i~i~d~~~~~~~~~--~~~~~~i~~v~~s~~g~~  279 (337)
T d1gxra_         205 NTVRSWDLRE-GRQLQQH-DFTSQIFSLGYCPTGE-WLAVGMESSNVEVLHVNKPDKYQL--HLHESCVLSLKFAYCGKW  279 (337)
T ss_dssp             SEEEEEETTT-TEEEEEE-ECSSCEEEEEECTTSS-EEEEEETTSCEEEEETTSSCEEEE--CCCSSCEEEEEECTTSSE
T ss_pred             cccccccccc-ceeeccc-ccccceEEEEEccccc-ccceeccccccccccccccccccc--cccccccceEEECCCCCE
Confidence            9999999987 4445444 4889999999999987 788999999999999998877654  478999999999999999


Q ss_pred             EEEEEcCCeEEEEeCCCCCCCcccccccCCcceeeeeeeeeeccCCCCeEEeccCCCCeeeecCC
Q psy13969        388 LATGSNDHASKFWTRNRLGDPMRDRYNQKGLAHCITGVYNEEMELNDSAVIPGMGLEDEDSVFPS  452 (877)
Q Consensus       388 l~sg~~dg~v~iwd~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~d~~~l~~~~g~d~~~~~~~~  452 (877)
                      |++++.|+.|++||+...... .       ...+...|.+++|++++.+|++++ .|+.+++|+.
T Consensus       280 l~s~s~Dg~i~iwd~~~~~~~-~-------~~~~~~~v~~~~~s~d~~~l~t~s-~D~~I~vWdl  335 (337)
T d1gxra_         280 FVSTGKDNLLNAWRTPYGASI-F-------QSKESSSVLSCDISVDDKYIVTGS-GDKKATVYEV  335 (337)
T ss_dssp             EEEEETTSEEEEEETTTCCEE-E-------EEECSSCEEEEEECTTSCEEEEEE-TTSCEEEEEE
T ss_pred             EEEEeCCCeEEEEECCCCCEE-E-------EccCCCCEEEEEEeCCCCEEEEEe-CCCeEEEEEE
Confidence            999999999999998764222 1       123456688999999999998864 7899999964
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1jtdb_ b.69.5.2 (B:) beta-lactamase inhibitor protein-II, BLIP-II {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jtdb_ b.69.5.2 (B:) beta-lactamase inhibitor protein-II, BLIP-II {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1wp5a_ b.68.10.1 (A:) Topoisomerase IV subunit A, ParC, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1wp5a_ b.68.10.1 (A:) Topoisomerase IV subunit A, ParC, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2hu7a1 b.69.7.2 (A:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure