Psyllid ID: psy14015


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------32
MASSDSAPDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGQERTRGELIPFLTETIYDEDEVLLALAEQLGTFTPNVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRLISAQHSPHDLEAHFVPLVQRLASGDWFTSRTSACGLFSVCYPRVTAGVKAELRSHFRNLCQDDTPMQQGHVWECGSGVKAELRSHFRNLCQDDTPMVRRAAAGKLGELAKVVEVDYLKTDIIPMFVNLAQDEQDSVRLLAVEACVSIASLLSQSDVEQLVMPTLRQCSVQIVDHKFCPNNEFHPLELHVISATTLRLMRHVT
cccccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcHHHHHHHccccccHHHHHHHHHHHHHHcccc
ccccccccccccHHHHHHHHHcccccHHHHHHHHHcHHHHHHHccHHHHHHcHHHHHHHcccccHHHHHHHHHHHccccHHHcccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccHHHHHHcHHHHHHHHHccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccHHHHHHHHHcHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccHHHHccHHHHHHHHHHHccHHHHHHHcHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHccccc
massdsapddslyPIAVLIDELKNEDVQLRLNSIKKLSTIALALGqertrgelipfltetiyDEDEVLLALAEQLgtftpnvggpeyvhcllppleslatvEETVVRDKAVESLRLISaqhsphdleaHFVPLVqrlasgdwftsrtsacglfsvcyprvtAGVKAELRSHFRnlcqddtpmqqghvwecgsgVKAELRSHFRNLCQDDTPMVRRAAAGKLGELAKVVEVDYLKTDIIPMFVNLAQDEQDSVRLLAVEACVSIASLLSQSDVEQLVMPTLRQCSvqivdhkfcpnnefhpleLHVISATTLRLMRHVT
massdsapddslYPIAVLIDELKNEDVQLRLNSIKKLSTIAlalgqertrgelIPFLTETIYDEDEVLLALAEQLGTFTPNVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRLISAQHSPHDLEAHFVPLVQRLASGDWFTSRTSACGLFSVCYPRVTAGVKAELRSHFRNLCQDDTPMQQGHVWECGSGVKAELRSHFRNLCQDDTPMVRRAAAGKLGELAKVVEVDYLKTDIIPMFVNLAQDEQDSVRLLAVEACVSIASLLSQSDVEQLVMPTLRQCSVQIVDHKFCPNNEFHPLELHVISATTLRLMRHVT
MASSDSAPDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGQERTRGELIPFLTETIYDEDEVLLALAEQLGTFTPNVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRLISAQHSPHDLEAHFVPLVQRLASGDWFTSRTSACGLFSVCYPRVTAGVKAELRSHFRNLCQDDTPMQQGHVWECGSGVKAELRSHFRNLCQDDTPMVRRAAAGKLGELAKVVEVDYLKTDIIPMFVNLAQDEQDSVRLLAVEACVSIASLLSQSDVEQLVMPTLRQCSVQIVDHKFCPNNEFHPLELHVISATTLRLMRHVT
***********LYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGQERTRGELIPFLTETIYDEDEVLLALAEQLGTFTPNVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRLISAQHSPHDLEAHFVPLVQRLASGDWFTSRTSACGLFSVCYPRVTAGVKAELRSHFRNLCQDDTPMQQGHVWECGSGVKAELRSHFRNLCQDDTPMVRRAAAGKLGELAKVVEVDYLKTDIIPMFVNLAQDEQDSVRLLAVEACVSIASLLSQSDVEQLVMPTLRQCSVQIVDHKFCPNNEFHPLELHVISATTLRL*****
**********SLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGQERTRGELIPFLTETIYDEDEVLLALAEQLGTFTPNVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRLISAQHSPHDLEAHFVPLVQRLASGDWFTSRTSACGLFSVCYPRVTAGVKAELRSHFRNLCQDDTPMQQGHVWECGSGVKAELRSHFRNLCQDDTPMVRRAAAGKLGELAKVVEVDYLKTDIIPMFVNLAQDEQDSVRLLAVEACVSIASLLSQSDVEQLVMPTLRQCSVQIVDHKFCPNNEFHPLELHVISATTLRLMRHV*
*********DSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGQERTRGELIPFLTETIYDEDEVLLALAEQLGTFTPNVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRLISAQHSPHDLEAHFVPLVQRLASGDWFTSRTSACGLFSVCYPRVTAGVKAELRSHFRNLCQDDTPMQQGHVWECGSGVKAELRSHFRNLCQDDTPMVRRAAAGKLGELAKVVEVDYLKTDIIPMFVNLAQDEQDSVRLLAVEACVSIASLLSQSDVEQLVMPTLRQCSVQIVDHKFCPNNEFHPLELHVISATTLRLMRHVT
*********DSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGQERTRGELIPFLTETIYDEDEVLLALAEQLGTFTPNVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRLISAQHSPHDLEAHFVPLVQRLASGDWFTSRTSACGLFSVCYPRVTAGVKAELRSHFRNLCQDDTPMQQGHVWECGSGVKAELRSHFRNLCQDDTPMVRRAAAGKLGELAKVVEVDYLKTDIIPMFVNLAQDEQDSVRLLAVEACVSIASLLSQSDVEQLVMPTLRQCSVQIVDHKFCPNNEFHPLELHVISATTLRLMRHV*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASSDSAPDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGQERTRGELIPFLTETIYDEDEVLLALAEQLGTFTPNVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRLISAQHSPHDLEAHFVPLVQRLASGDWFTSRTSACGLFSVCYPRVTAGVKAELRSHFRNLCQDDTPMQQGHVWECGSGVKAELRSHFRNLCQDDTPMVRRAAAGKLGELAKVVEVDYLKTDIIPMFVNLAQDEQDSVRLLAVEACVSIASLLSQSDVEQLVMPTLRQCSVQIVDHKFCPNNEFHPLELHVISATTLRLMRHVT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query318 2.2.26 [Sep-21-2011]
P54612 589 Serine/threonine-protein yes N/A 0.792 0.427 0.746 1e-114
Q76MZ3 589 Serine/threonine-protein yes N/A 0.792 0.427 0.746 1e-114
P30153 589 Serine/threonine-protein yes N/A 0.792 0.427 0.746 1e-114
Q32PI5 589 Serine/threonine-protein yes N/A 0.792 0.427 0.746 1e-114
P36179 591 Serine/threonine-protein yes N/A 0.798 0.429 0.728 1e-112
Q4QQT4 601 Serine/threonine-protein no N/A 0.773 0.409 0.735 1e-111
P54613 602 Serine/threonine-protein no N/A 0.773 0.408 0.731 1e-110
Q7TNP2 601 Serine/threonine-protein no N/A 0.764 0.404 0.732 1e-109
P30154 601 Serine/threonine-protein no N/A 0.767 0.405 0.715 1e-107
Q09543 590 Probable serine/threonine yes N/A 0.808 0.435 0.591 2e-89
>sp|P54612|2AAA_PIG Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Sus scrofa GN=PPP2R1A PE=2 SV=2 Back     alignment and function desciption
 Score =  413 bits (1061), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 212/284 (74%), Positives = 230/284 (80%), Gaps = 32/284 (11%)

Query: 1   MASSDSAPDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGQERTRGELIPFLTET 60
           MA++D   DDSLYPIAVLIDEL+NEDVQLRLNSIKKLSTIALALG ERTR EL+PFLT+T
Sbjct: 1   MAAADG--DDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDT 58

Query: 61  IYDEDEVLLALAEQLGTFTPNVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRLISAQ 120
           IYDEDEVLLALAEQLGTFT  VGGPEYVHCLLPPLESLATVEETVVRDKAVESLR IS +
Sbjct: 59  IYDEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHE 118

Query: 121 HSPHDLEAHFVPLVQRLASGDWFTSRTSACGLFSVCYPRVTAGVKAELRSHFRNLCQDDT 180
           HSP DLEAHFVPLV+RLA GDWFTSRTSACGLFSVCYPRV++ VKAELR +FRNLC DDT
Sbjct: 119 HSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDT 178

Query: 181 PMQQGHVWECGSGVKAELRSHFRNLCQDDTPMVRRAAAGKLGELAKVVEVDYLKTDIIPM 240
                                         PMVRRAAA KLGE AKV+E+D +K++IIPM
Sbjct: 179 ------------------------------PMVRRAAASKLGEFAKVLELDNVKSEIIPM 208

Query: 241 FVNLAQDEQDSVRLLAVEACVSIASLLSQSDVEQLVMPTLRQCS 284
           F NLA DEQDSVRLLAVEACV+IA LL Q D+E LVMPTLRQ +
Sbjct: 209 FSNLASDEQDSVRLLAVEACVNIAQLLPQEDLEALVMPTLRQAA 252




The PR65 subunit of protein phosphatase 2A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit. Required for proper chromosome segregation and for centromeric localization of SGOL1 in mitosis.
Sus scrofa (taxid: 9823)
>sp|Q76MZ3|2AAA_MOUSE Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Mus musculus GN=Ppp2r1a PE=1 SV=3 Back     alignment and function description
>sp|P30153|2AAA_HUMAN Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Homo sapiens GN=PPP2R1A PE=1 SV=4 Back     alignment and function description
>sp|Q32PI5|2AAA_BOVIN Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Bos taurus GN=PPP2R1A PE=1 SV=1 Back     alignment and function description
>sp|P36179|2AAA_DROME Serine/threonine-protein phosphatase PP2A 65 kDa regulatory subunit OS=Drosophila melanogaster GN=Pp2A-29B PE=2 SV=4 Back     alignment and function description
>sp|Q4QQT4|2AAB_RAT Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Rattus norvegicus GN=Ppp2r1b PE=2 SV=1 Back     alignment and function description
>sp|P54613|2AAB_PIG Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform (Fragment) OS=Sus scrofa GN=PPP2R1B PE=2 SV=1 Back     alignment and function description
>sp|Q7TNP2|2AAB_MOUSE Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Mus musculus GN=Ppp2r1b PE=1 SV=2 Back     alignment and function description
>sp|P30154|2AAB_HUMAN Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Homo sapiens GN=PPP2R1B PE=1 SV=3 Back     alignment and function description
>sp|Q09543|2AAA_CAEEL Probable serine/threonine-protein phosphatase PP2A regulatory subunit OS=Caenorhabditis elegans GN=paa-1 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query318
307189141 601 Serine/threonine-protein phosphatase 2A 0.798 0.422 0.788 1e-122
322787434 589 hypothetical protein SINV_04974 [Solenop 0.798 0.431 0.785 1e-121
332020375 603 Serine/threonine-protein phosphatase 2A 0.798 0.421 0.785 1e-121
307201783 590 Serine/threonine-protein phosphatase 2A 0.798 0.430 0.785 1e-121
156547500 590 PREDICTED: serine/threonine-protein phos 0.798 0.430 0.785 1e-120
318087110302 putative protein phosphatase 2A regulato 0.798 0.841 0.760 1e-116
86515392 590 protein phosphatase 2, regulatory subuni 0.798 0.430 0.75 1e-116
332376827 600 unknown [Dendroctonus ponderosae] 0.798 0.423 0.75 1e-116
242024239 566 serine/threonine-protein phosphatase PP2 0.795 0.446 0.759 1e-115
328782568 590 PREDICTED: serine/threonine-protein phos 0.798 0.430 0.75 1e-115
>gi|307189141|gb|EFN73589.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform [Camponotus floridanus] Back     alignment and taxonomy information
 Score =  444 bits (1141), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 224/284 (78%), Positives = 238/284 (83%), Gaps = 30/284 (10%)

Query: 1   MASSDSAPDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGQERTRGELIPFLTET 60
           MA+SDS  DDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALG ERTR ELIPFLTET
Sbjct: 1   MAASDSTTDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGIERTRSELIPFLTET 60

Query: 61  IYDEDEVLLALAEQLGTFTPNVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRLISAQ 120
           IYDEDEVLLALAEQLGTFTP VGGPEYVHCLLPPLESLATVEETVVRDKAVESLR I++Q
Sbjct: 61  IYDEDEVLLALAEQLGTFTPLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRNIASQ 120

Query: 121 HSPHDLEAHFVPLVQRLASGDWFTSRTSACGLFSVCYPRVTAGVKAELRSHFRNLCQDDT 180
           HSP DLE HFVPLVQRLASGDWFTSRTSACGLFSVCYPRV+  +KAELR+HFR+LCQDD 
Sbjct: 121 HSPADLEEHFVPLVQRLASGDWFTSRTSACGLFSVCYPRVSPAIKAELRNHFRSLCQDD- 179

Query: 181 PMQQGHVWECGSGVKAELRSHFRNLCQDDTPMVRRAAAGKLGELAKVVEVDYLKTDIIPM 240
                                        TPM RR+AA KLGE AKVVE++YLK+D+IPM
Sbjct: 180 -----------------------------TPMARRSAASKLGEFAKVVEIEYLKSDLIPM 210

Query: 241 FVNLAQDEQDSVRLLAVEACVSIASLLSQSDVEQLVMPTLRQCS 284
           FV LAQDEQDSVRLLAVEACVSIA+LL Q DVEQLVMPTLRQC+
Sbjct: 211 FVILAQDEQDSVRLLAVEACVSIAALLQQEDVEQLVMPTLRQCA 254




Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|322787434|gb|EFZ13522.1| hypothetical protein SINV_04974 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|332020375|gb|EGI60796.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307201783|gb|EFN81456.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|156547500|ref|XP_001600229.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|318087110|gb|ADV40147.1| putative protein phosphatase 2A regulatory subunit A [Latrodectus hesperus] Back     alignment and taxonomy information
>gi|86515392|ref|NP_001034525.1| protein phosphatase 2, regulatory subunit A, alpha isoform [Tribolium castaneum] gi|60098058|emb|CAI45288.1| phosphatase [Tribolium castaneum] gi|270013845|gb|EFA10293.1| hypothetical protein TcasGA2_TC012508 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|332376827|gb|AEE63553.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|242024239|ref|XP_002432536.1| serine/threonine-protein phosphatase PP2A 65 kDa regulatory subunit, putative [Pediculus humanus corporis] gi|212517988|gb|EEB19798.1| serine/threonine-protein phosphatase PP2A 65 kDa regulatory subunit, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|328782568|ref|XP_001120202.2| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform-like [Apis mellifera] gi|380013196|ref|XP_003690652.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform-like [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query318
UNIPROTKB|Q32PI5 589 PPP2R1A "Serine/threonine-prot 0.896 0.483 0.593 4.4e-84
UNIPROTKB|A5D973 589 PPP2R1A "Alpha isoform of regu 0.896 0.483 0.593 4.4e-84
UNIPROTKB|F1PX75 589 PPP2R1A "Uncharacterized prote 0.896 0.483 0.593 4.4e-84
UNIPROTKB|P30153 589 PPP2R1A "Serine/threonine-prot 0.896 0.483 0.593 4.4e-84
UNIPROTKB|P54612 589 PPP2R1A "Serine/threonine-prot 0.896 0.483 0.593 4.4e-84
MGI|MGI:1926334 589 Ppp2r1a "protein phosphatase 2 0.896 0.483 0.593 4.4e-84
RGD|620907 589 Ppp2r1a "protein phosphatase 2 0.896 0.483 0.593 4.4e-84
RGD|1304764 601 Ppp2r1b "protein phosphatase 2 0.874 0.462 0.600 1.4e-80
ZFIN|ZDB-GENE-040426-2700 589 ppp2r1a "protein phosphatase 2 0.896 0.483 0.586 1.4e-80
MGI|MGI:1920949 601 Ppp2r1b "protein phosphatase 2 0.874 0.462 0.597 3.7e-80
UNIPROTKB|Q32PI5 PPP2R1A "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 842 (301.5 bits), Expect = 4.4e-84, P = 4.4e-84
 Identities = 178/300 (59%), Positives = 217/300 (72%)

Query:     1 MASSDSAPDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGQERTRGELIPFLTET 60
             MA++D   DDSLYPIAVLIDEL+NEDVQLRLNSIKKLSTIALALG ERTR EL+PFLT+T
Sbjct:     1 MAAADG--DDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDT 58

Query:    61 IYDEDEVLLALAEQLGTFTPNVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRLISAQ 120
             IYDEDEVLLALAEQLGTFT  VGGPEYVHCLLPPLESLATVEETVVRDKAVESLR IS +
Sbjct:    59 IYDEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHE 118

Query:   121 HSPHDLEAHFVPLVQRLASGDWFTSRTSACGLFSVCYPRVTAGVKAELRSHFRNLCQDDT 180
             HSP DLEAHFVPLV+RLA GDWFTSRTSACGLFSVCYPRV++ VKAELR +FRNLC DDT
Sbjct:   119 HSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDT 178

Query:   181 PM-QQGHVWECGS--------GVKAELRSHFRNLCQDDTPMVRRAAAGKLGELAKVVEVD 231
             PM ++    + G          VK+E+   F NL  D+   VR  A      +A+++  +
Sbjct:   179 PMVRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQE 238

Query:   232 YLKTDIIPMFVNLAQDEQDSVRLLAVEACV----SIASLLSQSDVEQLVMPTLRQCSVQI 287
              L+  ++P     A+D+   VR +  +       ++   ++++D+       ++ C  ++
Sbjct:   239 DLEALVMPTLRQAAEDKSWRVRYMVADKFTELHKAVGPEITKTDLVPAFQNLMKDCEAEV 298


GO:0005737 "cytoplasm" evidence=IDA
GO:0000775 "chromosome, centromeric region" evidence=IEA
GO:0007059 "chromosome segregation" evidence=IEA
UNIPROTKB|A5D973 PPP2R1A "Alpha isoform of regulatory subunit A, protein phosphatase 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PX75 PPP2R1A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P30153 PPP2R1A "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P54612 PPP2R1A "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1926334 Ppp2r1a "protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 65), alpha isoform" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|620907 Ppp2r1a "protein phosphatase 2, regulatory subunit A, alpha" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|1304764 Ppp2r1b "protein phosphatase 2, regulatory subunit A, beta" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2700 ppp2r1a "protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 65), alpha isoform" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1920949 Ppp2r1b "protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 65), beta isoform" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q32PI52AAA_BOVINNo assigned EC number0.74640.79240.4278yesN/A
P301532AAA_HUMANNo assigned EC number0.74640.79240.4278yesN/A
P361792AAA_DROMENo assigned EC number0.72880.79870.4297yesN/A
Q76MZ32AAA_MOUSENo assigned EC number0.74640.79240.4278yesN/A
Q095432AAA_CAEELNo assigned EC number0.59100.80810.4355yesN/A
Q389502AAB_ARATHNo assigned EC number0.54900.77040.4173yesN/A
P546122AAA_PIGNo assigned EC number0.74640.79240.4278yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query318
pfam1351355 pfam13513, HEAT_EZ, HEAT-like repeat 0.002
>gnl|CDD|205691 pfam13513, HEAT_EZ, HEAT-like repeat Back     alignment and domain information
 Score = 35.5 bits (82), Expect = 0.002
 Identities = 18/55 (32%), Positives = 25/55 (45%), Gaps = 2/55 (3%)

Query: 211 PMVRRAAAGKLGELAKVVE--VDYLKTDIIPMFVNLAQDEQDSVRLLAVEACVSI 263
             VR AAA  LG LA      +     +++P  + L +D+ D VR  A  A   I
Sbjct: 1   WEVREAAALALGALAGGGPELLRPAVPELLPALLPLLKDDDDEVREAAAWALGRI 55


The HEAT repeat family is related to armadillo/beta-catenin-like repeats (see pfam00514). These EZ repeats are found in subunits of cyanobacterial phycocyanin lyase and other proteins and probably carry out a scaffolding role. Length = 55

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 318
KOG0211|consensus 759 99.92
KOG0211|consensus 759 99.81
PRK09687280 putative lyase; Provisional 99.79
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 99.72
PRK09687280 putative lyase; Provisional 99.7
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 99.68
KOG1240|consensus 1431 99.61
KOG2171|consensus 1075 99.54
KOG2023|consensus 885 99.46
KOG2171|consensus 1075 99.45
KOG1240|consensus 1431 99.41
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 99.33
KOG1243|consensus 690 99.23
KOG1242|consensus 569 99.23
KOG2023|consensus 885 99.19
COG1413335 FOG: HEAT repeat [Energy production and conversion 99.14
KOG1242|consensus569 99.1
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 99.07
KOG2259|consensus 823 99.06
PTZ00429 746 beta-adaptin; Provisional 99.03
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 99.02
COG1413335 FOG: HEAT repeat [Energy production and conversion 99.02
TIGR02270410 conserved hypothetical protein. Members are found 99.0
KOG0166|consensus514 98.98
PF01602526 Adaptin_N: Adaptin N terminal region; InterPro: IP 98.98
TIGR02270410 conserved hypothetical protein. Members are found 98.97
KOG1243|consensus 690 98.94
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 98.92
KOG1824|consensus 1233 98.9
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 98.9
KOG1241|consensus 859 98.89
PTZ00429 746 beta-adaptin; Provisional 98.84
KOG0166|consensus 514 98.82
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 98.82
PF10508503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 98.76
KOG1241|consensus 859 98.76
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 98.76
KOG0213|consensus1172 98.68
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 98.64
COG5181 975 HSH155 U2 snRNP spliceosome subunit [RNA processin 98.61
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 98.57
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 98.53
KOG0213|consensus 1172 98.53
KOG0567|consensus289 98.45
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 98.4
KOG4224|consensus 550 98.37
KOG1824|consensus1233 98.37
KOG0212|consensus 675 98.36
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 98.36
KOG0915|consensus 1702 98.35
KOG0915|consensus 1702 98.35
COG5181975 HSH155 U2 snRNP spliceosome subunit [RNA processin 98.35
KOG2137|consensus 700 98.35
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 98.34
KOG1060|consensus 968 98.32
KOG2956|consensus516 98.31
KOG2259|consensus 823 98.29
KOG0212|consensus 675 98.27
COG5215 858 KAP95 Karyopherin (importin) beta [Intracellular t 98.25
KOG1060|consensus 968 98.25
KOG1820|consensus 815 98.25
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 98.25
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 98.22
KOG4224|consensus550 98.21
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 98.21
KOG0567|consensus289 98.18
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 98.17
COG5064 526 SRP1 Karyopherin (importin) alpha [Intracellular t 98.16
KOG1820|consensus 815 98.14
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 98.11
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 98.07
KOG1061|consensus 734 98.07
KOG2062|consensus 929 98.06
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 98.06
KOG1059|consensus 877 98.05
KOG2032|consensus533 97.97
COG5215 858 KAP95 Karyopherin (importin) beta [Intracellular t 97.96
KOG4653|consensus982 97.95
KOG1062|consensus 866 97.95
PF05918 556 API5: Apoptosis inhibitory protein 5 (API5); Inter 97.92
KOG2032|consensus533 97.92
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 97.89
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 97.86
COG5096 757 Vesicle coat complex, various subunits [Intracellu 97.83
KOG2137|consensus 700 97.82
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 97.79
KOG1078|consensus 865 97.74
KOG4653|consensus982 97.73
COG5096 757 Vesicle coat complex, various subunits [Intracellu 97.69
PF05004309 IFRD: Interferon-related developmental regulator ( 97.68
KOG1949|consensus 1005 97.61
PF05004309 IFRD: Interferon-related developmental regulator ( 97.6
KOG2025|consensus 892 97.56
KOG1943|consensus 1133 97.54
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 97.53
PF14500262 MMS19_N: Dos2-interacting transcription regulator 97.52
KOG1949|consensus 1005 97.5
KOG2062|consensus 929 97.47
COG5116 926 RPN2 26S proteasome regulatory complex component [ 97.46
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 97.4
KOG1248|consensus 1176 97.36
KOG1061|consensus 734 97.33
KOG2956|consensus516 97.3
KOG1517|consensus 1387 97.29
KOG1059|consensus 877 97.28
KOG1062|consensus 866 97.17
KOG1078|consensus 865 97.13
PF05918 556 API5: Apoptosis inhibitory protein 5 (API5); Inter 97.11
KOG1967|consensus1030 97.05
KOG2933|consensus334 96.93
KOG1248|consensus 1176 96.91
KOG0168|consensus 1051 96.89
COG5218 885 YCG1 Chromosome condensation complex Condensin, su 96.82
KOG2025|consensus 892 96.78
KOG1967|consensus1030 96.74
KOG1058|consensus 948 96.73
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 96.72
PF01347618 Vitellogenin_N: Lipoprotein amino terminal region; 96.63
KOG1517|consensus 1387 96.6
KOG1943|consensus 1133 96.55
KOG1077|consensus 938 96.51
COG5116 926 RPN2 26S proteasome regulatory complex component [ 96.49
COG5218 885 YCG1 Chromosome condensation complex Condensin, su 96.46
PF01347618 Vitellogenin_N: Lipoprotein amino terminal region; 96.3
KOG4413|consensus 524 96.27
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 96.21
PF05804708 KAP: Kinesin-associated protein (KAP) 96.19
KOG0414|consensus 1251 96.16
PF13001501 Ecm29: Proteasome stabiliser; InterPro: IPR024372 95.95
KOG0946|consensus 970 95.82
smart00638574 LPD_N Lipoprotein N-terminal Domain. 95.78
PF0757192 DUF1546: Protein of unknown function (DUF1546); In 95.77
KOG0414|consensus 1251 95.77
KOG1058|consensus 948 95.63
KOG1077|consensus 938 95.59
KOG4535|consensus 728 95.53
COG5098 1128 Chromosome condensation complex Condensin, subunit 95.44
KOG0413|consensus 1529 95.35
KOG0946|consensus 970 95.33
KOG0392|consensus 1549 95.33
KOG2933|consensus334 95.26
PF14500262 MMS19_N: Dos2-interacting transcription regulator 95.22
smart00638574 LPD_N Lipoprotein N-terminal Domain. 95.15
PF12530234 DUF3730: Protein of unknown function (DUF3730) ; I 95.13
PF04118307 Dopey_N: Dopey, N-terminal; InterPro: IPR007249 Do 95.0
PF12530234 DUF3730: Protein of unknown function (DUF3730) ; I 94.98
KOG1293|consensus678 94.96
PF12074339 DUF3554: Domain of unknown function (DUF3554); Int 94.85
KOG1822|consensus 2067 94.82
PF13251182 DUF4042: Domain of unknown function (DUF4042) 94.8
KOG1525|consensus 1266 94.75
PF08506370 Cse1: Cse1; InterPro: IPR013713 The exchange of ma 94.74
PF1036392 DUF2435: Protein of unknown function (DUF2435) 94.71
COG5098 1128 Chromosome condensation complex Condensin, subunit 94.65
KOG1020|consensus 1692 94.57
PF1036392 DUF2435: Protein of unknown function (DUF2435) 94.54
PLN03076 1780 ARF guanine nucleotide exchange factor (ARF-GEF); 94.51
KOG1822|consensus 2067 94.45
KOG1525|consensus 1266 94.35
KOG2213|consensus 460 94.31
KOG0392|consensus 1549 94.3
KOG1020|consensus 1692 94.3
KOG1991|consensus 1010 94.22
PF05804 708 KAP: Kinesin-associated protein (KAP) 94.06
KOG1293|consensus678 93.96
PF08389148 Xpo1: Exportin 1-like protein; InterPro: IPR013598 93.78
KOG1993|consensus 978 93.77
KOG1991|consensus 1010 93.75
PF11865160 DUF3385: Domain of unknown function (DUF3385); Int 93.45
PF10521282 DUF2454: Protein of unknown function (DUF2454); In 93.44
KOG0413|consensus 1529 93.43
PF08506370 Cse1: Cse1; InterPro: IPR013713 The exchange of ma 93.3
PF11701157 UNC45-central: Myosin-binding striated muscle asse 93.05
KOG4413|consensus 524 92.93
smart0056730 EZ_HEAT E-Z type HEAT repeats. Present in subunits 92.75
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 92.7
KOG4535|consensus728 92.63
PF10274183 ParcG: Parkin co-regulated protein; InterPro: IPR0 92.56
KOG0168|consensus 1051 92.43
PF1276542 Cohesin_HEAT: HEAT repeat associated with sister c 92.28
PF11865160 DUF3385: Domain of unknown function (DUF3385); Int 91.85
PF12830187 Nipped-B_C: Sister chromatid cohesion C-terminus 91.67
PF12054441 DUF3535: Domain of unknown function (DUF3535); Int 91.43
KOG2011|consensus 1048 91.41
KOG2274|consensus 1005 91.25
PF10521282 DUF2454: Protein of unknown function (DUF2454); In 91.15
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 91.06
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 90.52
cd03569142 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p s 90.47
KOG2160|consensus342 90.44
KOG2160|consensus342 90.3
KOG1992|consensus 960 90.28
KOG2274|consensus 1005 90.18
KOG1848|consensus 1610 89.76
cd08050343 TAF6 TATA Binding Protein (TBP) Associated Factor 89.74
PF0313027 HEAT_PBS: PBS lyase HEAT-like repeat; InterPro: IP 89.73
PF08389148 Xpo1: Exportin 1-like protein; InterPro: IPR013598 89.57
PF13001501 Ecm29: Proteasome stabiliser; InterPro: IPR024372 89.34
PF10274183 ParcG: Parkin co-regulated protein; InterPro: IPR0 89.33
PF08713213 DNA_alkylation: DNA alkylation repair enzyme; Inte 89.24
cd03568144 VHS_STAM VHS domain family, STAM subfamily; member 89.16
PF12830187 Nipped-B_C: Sister chromatid cohesion C-terminus 89.03
PF08713213 DNA_alkylation: DNA alkylation repair enzyme; Inte 88.81
PF0757192 DUF1546: Protein of unknown function (DUF1546); In 88.6
cd08050343 TAF6 TATA Binding Protein (TBP) Associated Factor 88.52
KOG2149|consensus393 88.41
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 87.64
KOG2973|consensus 353 87.3
KOG2081|consensus559 87.17
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 86.71
smart0056730 EZ_HEAT E-Z type HEAT repeats. Present in subunits 86.42
KOG3036|consensus293 86.29
KOG1851|consensus1710 86.28
KOG1837|consensus1621 86.1
cd07064208 AlkD_like_1 A new structural DNA glycosylase conta 85.06
PF08167165 RIX1: rRNA processing/ribosome biogenesis 84.5
PF1276542 Cohesin_HEAT: HEAT repeat associated with sister c 83.83
cd03568144 VHS_STAM VHS domain family, STAM subfamily; member 83.8
PF12074339 DUF3554: Domain of unknown function (DUF3554); Int 83.55
PF00790140 VHS: VHS domain; InterPro: IPR002014 The VHS domai 83.22
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 83.07
PF12054 441 DUF3535: Domain of unknown function (DUF3535); Int 82.81
KOG2549|consensus 576 82.76
cd06561197 AlkD_like A new structural DNA glycosylase. This d 82.67
PF08167165 RIX1: rRNA processing/ribosome biogenesis 82.22
PF13251182 DUF4042: Domain of unknown function (DUF4042) 82.18
KOG1848|consensus 1610 82.08
KOG2149|consensus 393 81.98
KOG2213|consensus 460 80.55
KOG2005|consensus 878 80.29
>KOG0211|consensus Back     alignment and domain information
Probab=99.92  E-value=5.7e-24  Score=208.68  Aligned_cols=283  Identities=49%  Similarity=0.691  Sum_probs=258.6

Q ss_pred             CCCCchHHHHHHHhcCccHHHHHHHHHhHHHHHHhhChHhHhhchhhhhhhhcCChHHHHHHHHHHHcccccCcCcccch
Q psy14015          9 DDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGQERTRGELIPFLTETIYDEDEVLLALAEQLGTFTPNVGGPEYV   88 (318)
Q Consensus         9 ~~~l~~i~~l~~~l~~~~~~~R~~~~~~L~~ia~~lg~~~~~~~llp~l~~l~~D~~~VR~~aa~~L~~l~~~~~~~~~~   88 (318)
                      ++++.||+.+++.+..++.+.|...++.+..++.++|++.++.+++|++.+.+.|+.+|...++.+++.+.+.+|++.+.
T Consensus        78 ~~~~~~ia~l~~e~~~~di~~r~~~~~~l~~~a~~~~~~~tr~~lipf~~e~~~~~dev~~~~a~~~~~~~~~v~~~~~~  157 (759)
T KOG0211|consen   78 EDSLYPIAVLIDELSNTDIQLRLNSGRKLSNLALALGVERTRLELIPFLTEAEDDEDEVLLDLAEQLGTFLPDVGGPEYA  157 (759)
T ss_pred             ccccccHHHHhhccCchhhhhhhhhhccccchhhhcccchhhhhhhhHHHHhccchhHHHHHHHHHhcccchhccchhHH
Confidence            34699999999999999999999999999999999999988999999999999667779999999999999999999999


Q ss_pred             hccchHHhhhccCchhHHHHHHHHHHHHHHhhCChhHHhhhHHHHHHHhhcCCCchhhhhhhhhhhhhccccC-cchHHH
Q psy14015         89 HCLLPPLESLATVEETVVRDKAVESLRLISAQHSPHDLEAHFVPLVQRLASGDWFTSRTSACGLFSVCYPRVT-AGVKAE  167 (318)
Q Consensus        89 ~~llp~l~~l~~d~~~~VR~~a~~~l~~l~~~~~~~~~~~~ilp~~~~l~~d~~~~vR~~a~~~l~~~~~~~~-~~~~~~  167 (318)
                      ..++|.+..++.+++..||+++++++..++...+++...++++|++.++..++++..|.+++++++..+..+. ..++.+
T Consensus       158 ~~ll~~le~l~~~eet~vr~k~ve~l~~v~~~~~~~~~~~~lv~l~~~l~~~d~~~sr~sacglf~~~~~~~~~~~vk~e  237 (759)
T KOG0211|consen  158 HMLLPPLELLATVEETGVREKAVESLLKVAVGLPKEKLREHLVPLLKRLATGDWFQSRLSACGLFGKLYVSLPDDAVKRE  237 (759)
T ss_pred             HHhhHHHHhhhHHHHHHHHHHHHHHHHHHHHhcChHHHHHHHHHHHHHccchhhhhcchhhhhhhHHhccCCChHHHHHH
Confidence            9999999999999999999999999999999999988888999999999999878899999999999999988 668999


Q ss_pred             HHHHHHhhccCCCcccccchh----hcC-----ccchHHHHHHHHHhhcCCCHHHHHHHHHhhHHHHHHhchh-hhHhhH
Q psy14015        168 LRSHFRNLCQDDTPMQQGHVW----ECG-----SGVKAELRSHFRNLCQDDTPMVRRAAAGKLGELAKVVEVD-YLKTDI  237 (318)
Q Consensus       168 l~~~~~~l~~~~~~~vR~~v~----~~~-----~~~~~~ll~~l~~l~~D~~~~VR~~aa~~L~~l~~~~~~~-~~~~~l  237 (318)
                      +...+.++|.|..|+||..+.    ..+     ...++.++|.+.++..|+...||.+|..++..+...+..+ .....+
T Consensus       238 lr~~~~~lc~d~~~~Vr~~~a~~l~~~a~~~~~~~~~s~v~~~~~~L~~DdqdsVr~~a~~~~~~l~~l~~~~~d~~~~~  317 (759)
T KOG0211|consen  238 LRPIVQSLCQDDTPMVRRAVASNLGNIAKVLESEIVKSEVLPTLIQLLRDDQDSVREAAVESLVSLLDLLDDDDDVVKSL  317 (759)
T ss_pred             HHHHHHhhccccchhhHHHHHhhhHHHHHHHHHHHHHhhccHHHhhhhhcchhhHHHHHHHHHHHHHHhcCCchhhhhhh
Confidence            999999999999999998432    111     2456788999999999999999999999999999999877 777889


Q ss_pred             HHHHHHhhcCCcHHHHHHHHHHHHHHHhhCChhhhhHhhHHHHHHhcccccccc
Q psy14015        238 IPMFVNLAQDEQDSVRLLAVEACVSIASLLSQSDVEQLVMPTLRQCSVQIVDHK  291 (318)
Q Consensus       238 lp~l~~ll~D~~~~VR~aa~~~l~~l~~~l~~~~~~~~l~p~l~~ll~D~~~~~  291 (318)
                      .+.+.++.+|++|.||..++..+..+...+|++.....+.|....+++|..+.+
T Consensus       318 ~~~l~~~~~d~~~~v~~~~~~~~~~L~~~~~~~~~~~~~~~~~~~l~~~~~~e~  371 (759)
T KOG0211|consen  318 TESLVQAVEDGSWRVSYMVADKFSELSSAVGPSATRTQLVPPVSNLLKDEEWEV  371 (759)
T ss_pred             hHHHHHHhcChhHHHHHHHhhhhhhHHHHhccccCcccchhhHHHHhcchhhhh
Confidence            999999999999999999999999999999997667788999999999944433



>KOG0211|consensus Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG2171|consensus Back     alignment and domain information
>KOG2023|consensus Back     alignment and domain information
>KOG2171|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1243|consensus Back     alignment and domain information
>KOG1242|consensus Back     alignment and domain information
>KOG2023|consensus Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>KOG1242|consensus Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>KOG2259|consensus Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>KOG0166|consensus Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>KOG1243|consensus Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>KOG1824|consensus Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>KOG1241|consensus Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>KOG0166|consensus Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>KOG1241|consensus Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0213|consensus Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>KOG0213|consensus Back     alignment and domain information
>KOG0567|consensus Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>KOG4224|consensus Back     alignment and domain information
>KOG1824|consensus Back     alignment and domain information
>KOG0212|consensus Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>KOG0915|consensus Back     alignment and domain information
>KOG0915|consensus Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>KOG2137|consensus Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>KOG1060|consensus Back     alignment and domain information
>KOG2956|consensus Back     alignment and domain information
>KOG2259|consensus Back     alignment and domain information
>KOG0212|consensus Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1060|consensus Back     alignment and domain information
>KOG1820|consensus Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>KOG4224|consensus Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>KOG0567|consensus Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1820|consensus Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1061|consensus Back     alignment and domain information
>KOG2062|consensus Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG1059|consensus Back     alignment and domain information
>KOG2032|consensus Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4653|consensus Back     alignment and domain information
>KOG1062|consensus Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>KOG2032|consensus Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2137|consensus Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>KOG1078|consensus Back     alignment and domain information
>KOG4653|consensus Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>KOG1949|consensus Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>KOG2025|consensus Back     alignment and domain information
>KOG1943|consensus Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>PF14500 MMS19_N: Dos2-interacting transcription regulator of RNA-Pol-II Back     alignment and domain information
>KOG1949|consensus Back     alignment and domain information
>KOG2062|consensus Back     alignment and domain information
>COG5116 RPN2 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>KOG1248|consensus Back     alignment and domain information
>KOG1061|consensus Back     alignment and domain information
>KOG2956|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG1059|consensus Back     alignment and domain information
>KOG1062|consensus Back     alignment and domain information
>KOG1078|consensus Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>KOG1967|consensus Back     alignment and domain information
>KOG2933|consensus Back     alignment and domain information
>KOG1248|consensus Back     alignment and domain information
>KOG0168|consensus Back     alignment and domain information
>COG5218 YCG1 Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG2025|consensus Back     alignment and domain information
>KOG1967|consensus Back     alignment and domain information
>KOG1058|consensus Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>PF01347 Vitellogenin_N: Lipoprotein amino terminal region; InterPro: IPR001747 This entry represents a conserved region found in several lipid transport proteins, including vitellogenin, microsomal triglyceride transfer protein and apolipoprotein B-100 [] Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG1943|consensus Back     alignment and domain information
>KOG1077|consensus Back     alignment and domain information
>COG5116 RPN2 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5218 YCG1 Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>PF01347 Vitellogenin_N: Lipoprotein amino terminal region; InterPro: IPR001747 This entry represents a conserved region found in several lipid transport proteins, including vitellogenin, microsomal triglyceride transfer protein and apolipoprotein B-100 [] Back     alignment and domain information
>KOG4413|consensus Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>KOG0414|consensus Back     alignment and domain information
>PF13001 Ecm29: Proteasome stabiliser; InterPro: IPR024372 The proteasome (or macropain) (3 Back     alignment and domain information
>KOG0946|consensus Back     alignment and domain information
>smart00638 LPD_N Lipoprotein N-terminal Domain Back     alignment and domain information
>PF07571 DUF1546: Protein of unknown function (DUF1546); InterPro: IPR011442 These proteins are associated with IPR004823 from INTERPRO in transcription initiation factor TFIID subunit 6 (TAF6) Back     alignment and domain information
>KOG0414|consensus Back     alignment and domain information
>KOG1058|consensus Back     alignment and domain information
>KOG1077|consensus Back     alignment and domain information
>KOG4535|consensus Back     alignment and domain information
>COG5098 Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0413|consensus Back     alignment and domain information
>KOG0946|consensus Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>KOG2933|consensus Back     alignment and domain information
>PF14500 MMS19_N: Dos2-interacting transcription regulator of RNA-Pol-II Back     alignment and domain information
>smart00638 LPD_N Lipoprotein N-terminal Domain Back     alignment and domain information
>PF12530 DUF3730: Protein of unknown function (DUF3730) ; InterPro: IPR022542 This domain is found in eukaryotes, and is typically between 220 and 262 amino acids in length Back     alignment and domain information
>PF04118 Dopey_N: Dopey, N-terminal; InterPro: IPR007249 DopA is the founding member of the Dopey family and is required for correct cell morphology and spatiotemporal organisation of multicellular structures in the filamentous fungus Emericella nidulans (Aspergillus nidulans) Back     alignment and domain information
>PF12530 DUF3730: Protein of unknown function (DUF3730) ; InterPro: IPR022542 This domain is found in eukaryotes, and is typically between 220 and 262 amino acids in length Back     alignment and domain information
>KOG1293|consensus Back     alignment and domain information
>PF12074 DUF3554: Domain of unknown function (DUF3554); InterPro: IPR022716 This presumed domain is functionally uncharacterised Back     alignment and domain information
>KOG1822|consensus Back     alignment and domain information
>PF13251 DUF4042: Domain of unknown function (DUF4042) Back     alignment and domain information
>KOG1525|consensus Back     alignment and domain information
>PF08506 Cse1: Cse1; InterPro: IPR013713 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane Back     alignment and domain information
>PF10363 DUF2435: Protein of unknown function (DUF2435) Back     alignment and domain information
>COG5098 Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1020|consensus Back     alignment and domain information
>PF10363 DUF2435: Protein of unknown function (DUF2435) Back     alignment and domain information
>PLN03076 ARF guanine nucleotide exchange factor (ARF-GEF); Provisional Back     alignment and domain information
>KOG1822|consensus Back     alignment and domain information
>KOG1525|consensus Back     alignment and domain information
>KOG2213|consensus Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>KOG1020|consensus Back     alignment and domain information
>KOG1991|consensus Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>KOG1293|consensus Back     alignment and domain information
>PF08389 Xpo1: Exportin 1-like protein; InterPro: IPR013598 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane Back     alignment and domain information
>KOG1993|consensus Back     alignment and domain information
>KOG1991|consensus Back     alignment and domain information
>PF11865 DUF3385: Domain of unknown function (DUF3385); InterPro: IPR024585 This uncharacterised domain is is typically between 160 to 172 amino acids in length Back     alignment and domain information
>PF10521 DUF2454: Protein of unknown function (DUF2454); InterPro: IPR018870 Putative protein of unknown function; subunit of the ASTRA complex which is part of the chromatin remodeling machinery; similar to Schizosaccharomyces pombe (Fission yeast) Tti2p; may interact with Rsm23p [] Back     alignment and domain information
>KOG0413|consensus Back     alignment and domain information
>PF08506 Cse1: Cse1; InterPro: IPR013713 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>KOG4413|consensus Back     alignment and domain information
>smart00567 EZ_HEAT E-Z type HEAT repeats Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>KOG4535|consensus Back     alignment and domain information
>PF10274 ParcG: Parkin co-regulated protein; InterPro: IPR019399 This family of proteins is transcribed anti-sense along the DNA to the Parkin gene product and the two appear to be transcribed under the same promoter Back     alignment and domain information
>KOG0168|consensus Back     alignment and domain information
>PF12765 Cohesin_HEAT: HEAT repeat associated with sister chromatid cohesion Back     alignment and domain information
>PF11865 DUF3385: Domain of unknown function (DUF3385); InterPro: IPR024585 This uncharacterised domain is is typically between 160 to 172 amino acids in length Back     alignment and domain information
>PF12830 Nipped-B_C: Sister chromatid cohesion C-terminus Back     alignment and domain information
>PF12054 DUF3535: Domain of unknown function (DUF3535); InterPro: IPR022707 This presumed domain is functionally uncharacterised Back     alignment and domain information
>KOG2011|consensus Back     alignment and domain information
>KOG2274|consensus Back     alignment and domain information
>PF10521 DUF2454: Protein of unknown function (DUF2454); InterPro: IPR018870 Putative protein of unknown function; subunit of the ASTRA complex which is part of the chromatin remodeling machinery; similar to Schizosaccharomyces pombe (Fission yeast) Tti2p; may interact with Rsm23p [] Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>cd03569 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p subfamily; composed of Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and its yeast homolog Vps27p (vacuolar protein sorting) Back     alignment and domain information
>KOG2160|consensus Back     alignment and domain information
>KOG2160|consensus Back     alignment and domain information
>KOG1992|consensus Back     alignment and domain information
>KOG2274|consensus Back     alignment and domain information
>KOG1848|consensus Back     alignment and domain information
>cd08050 TAF6 TATA Binding Protein (TBP) Associated Factor 6 (TAF6) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>PF03130 HEAT_PBS: PBS lyase HEAT-like repeat; InterPro: IPR004155 These proteins contain a short bi-helical repeat that is related to HEAT Back     alignment and domain information
>PF08389 Xpo1: Exportin 1-like protein; InterPro: IPR013598 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane Back     alignment and domain information
>PF13001 Ecm29: Proteasome stabiliser; InterPro: IPR024372 The proteasome (or macropain) (3 Back     alignment and domain information
>PF10274 ParcG: Parkin co-regulated protein; InterPro: IPR019399 This family of proteins is transcribed anti-sense along the DNA to the Parkin gene product and the two appear to be transcribed under the same promoter Back     alignment and domain information
>PF08713 DNA_alkylation: DNA alkylation repair enzyme; InterPro: IPR014825 These proteins are predicted to be DNA alkylation repair enzymes Back     alignment and domain information
>cd03568 VHS_STAM VHS domain family, STAM subfamily; members include STAM (Signal Transducing Adaptor Molecule), EAST (EGFR-associated protein with SH3 and TAM domains) and Hbp (Hrs-binding protein) Back     alignment and domain information
>PF12830 Nipped-B_C: Sister chromatid cohesion C-terminus Back     alignment and domain information
>PF08713 DNA_alkylation: DNA alkylation repair enzyme; InterPro: IPR014825 These proteins are predicted to be DNA alkylation repair enzymes Back     alignment and domain information
>PF07571 DUF1546: Protein of unknown function (DUF1546); InterPro: IPR011442 These proteins are associated with IPR004823 from INTERPRO in transcription initiation factor TFIID subunit 6 (TAF6) Back     alignment and domain information
>cd08050 TAF6 TATA Binding Protein (TBP) Associated Factor 6 (TAF6) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>KOG2149|consensus Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG2973|consensus Back     alignment and domain information
>KOG2081|consensus Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>smart00567 EZ_HEAT E-Z type HEAT repeats Back     alignment and domain information
>KOG3036|consensus Back     alignment and domain information
>KOG1851|consensus Back     alignment and domain information
>KOG1837|consensus Back     alignment and domain information
>cd07064 AlkD_like_1 A new structural DNA glycosylase containing HEAT-like repeats Back     alignment and domain information
>PF08167 RIX1: rRNA processing/ribosome biogenesis Back     alignment and domain information
>PF12765 Cohesin_HEAT: HEAT repeat associated with sister chromatid cohesion Back     alignment and domain information
>cd03568 VHS_STAM VHS domain family, STAM subfamily; members include STAM (Signal Transducing Adaptor Molecule), EAST (EGFR-associated protein with SH3 and TAM domains) and Hbp (Hrs-binding protein) Back     alignment and domain information
>PF12074 DUF3554: Domain of unknown function (DUF3554); InterPro: IPR022716 This presumed domain is functionally uncharacterised Back     alignment and domain information
>PF00790 VHS: VHS domain; InterPro: IPR002014 The VHS domain is a ~140 residues long domain, whose name is derived from its occurrence in VPS-27, Hrs and STAM Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PF12054 DUF3535: Domain of unknown function (DUF3535); InterPro: IPR022707 This presumed domain is functionally uncharacterised Back     alignment and domain information
>KOG2549|consensus Back     alignment and domain information
>cd06561 AlkD_like A new structural DNA glycosylase Back     alignment and domain information
>PF08167 RIX1: rRNA processing/ribosome biogenesis Back     alignment and domain information
>PF13251 DUF4042: Domain of unknown function (DUF4042) Back     alignment and domain information
>KOG1848|consensus Back     alignment and domain information
>KOG2149|consensus Back     alignment and domain information
>KOG2213|consensus Back     alignment and domain information
>KOG2005|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query318
2iae_A 589 Crystal Structure Of A Protein Phosphatase 2a (Pp2a 1e-116
2ie3_A 589 Structure Of The Protein Phosphatase 2a Core Enzyme 1e-116
1b3u_A 588 Crystal Structure Of Constant Regulatory Domain Of 1e-115
3fga_A 588 Structural Basis Of Pp2a And Sgo Interaction Length 1e-115
3dw8_A 582 Structure Of A Protein Phosphatase 2a Holoenzyme Wi 1e-114
2pkg_A 580 Structure Of A Complex Between The A Subunit Of Pro 1e-113
2nyl_A 582 Crystal Structure Of Protein Phosphatase 2a (Pp2a) 1e-112
3c5w_A232 Complex Between Pp2a-Specific Methylesterase Pme-1 2e-16
>pdb|2IAE|A Chain A, Crystal Structure Of A Protein Phosphatase 2a (Pp2a) Holoenzyme. Length = 589 Back     alignment and structure

Iteration: 1

Score = 413 bits (1061), Expect = e-116, Method: Compositional matrix adjust. Identities = 212/284 (74%), Positives = 230/284 (80%), Gaps = 32/284 (11%) Query: 1 MASSDSAPDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGQERTRGELIPFLTET 60 MA++D DDSLYPIAVLIDEL+NEDVQLRLNSIKKLSTIALALG ERTR EL+PFLT+T Sbjct: 1 MAAADG--DDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDT 58 Query: 61 IYDEDEVLLALAEQLGTFTPNVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRLISAQ 120 IYDEDEVLLALAEQLGTFT VGGPEYVHCLLPPLESLATVEETVVRDKAVESLR IS + Sbjct: 59 IYDEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHE 118 Query: 121 HSPHDLEAHFVPLVQRLASGDWFTSRTSACGLFSVCYPRVTAGVKAELRSHFRNLCQDDT 180 HSP DLEAHFVPLV+RLA GDWFTSRTSACGLFSVCYPRV++ VKAELR +FRNLC DDT Sbjct: 119 HSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDT 178 Query: 181 PMQQGHVWECGSGVKAELRSHFRNLCQDDTPMVRRAAAGKLGELAKVVEVDYLKTDIIPM 240 PMVRRAAA KLGE AKV+E+D +K++IIPM Sbjct: 179 ------------------------------PMVRRAAASKLGEFAKVLELDNVKSEIIPM 208 Query: 241 FVNLAQDEQDSVRLLAVEACVSIASLLSQSDVEQLVMPTLRQCS 284 F NLA DEQDSVRLLAVEACV+IA LL Q D+E LVMPTLRQ + Sbjct: 209 FSNLASDEQDSVRLLAVEACVNIAQLLPQEDLEALVMPTLRQAA 252
>pdb|2IE3|A Chain A, Structure Of The Protein Phosphatase 2a Core Enzyme Bound To Tumor- Inducing Toxins Length = 589 Back     alignment and structure
>pdb|1B3U|A Chain A, Crystal Structure Of Constant Regulatory Domain Of Human Pp2a, Pr65alpha Length = 588 Back     alignment and structure
>pdb|3FGA|A Chain A, Structural Basis Of Pp2a And Sgo Interaction Length = 588 Back     alignment and structure
>pdb|3DW8|A Chain A, Structure Of A Protein Phosphatase 2a Holoenzyme With B55 Subunit Length = 582 Back     alignment and structure
>pdb|2PKG|A Chain A, Structure Of A Complex Between The A Subunit Of Protein Phosphatase 2a And The Small T Antigen Of Sv40 Length = 580 Back     alignment and structure
>pdb|2NYL|A Chain A, Crystal Structure Of Protein Phosphatase 2a (Pp2a) Holoenzyme With The Catalytic Subunit Carboxyl Terminus Truncated Length = 582 Back     alignment and structure
>pdb|3C5W|A Chain A, Complex Between Pp2a-Specific Methylesterase Pme-1 And Pp2a Core Enzyme Length = 232 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query318
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 4e-78
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 1e-26
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 3e-22
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 7e-19
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 2e-15
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 3e-08
2db0_A253 253AA long hypothetical protein; heat repeats, hel 1e-07
2db0_A253 253AA long hypothetical protein; heat repeats, hel 2e-04
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 1e-07
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 5e-05
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 2e-07
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 7e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-07
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 4e-05
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 5e-05
3oqs_A 510 Importin subunit alpha-2; importin alpha, karyophe 6e-04
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
 Score =  248 bits (634), Expect = 4e-78
 Identities = 173/288 (60%), Positives = 205/288 (71%), Gaps = 9/288 (3%)

Query: 4   SDSAPDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGQERTRGELIPFLTETIYD 63
           + +  DDSLYPIAVLIDEL+NEDVQLRLNSIKKLSTIALALG ERTR EL+PFLT+TIYD
Sbjct: 1   AAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYD 60

Query: 64  EDEVLLALAEQLGTFTPNVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRLISAQHSP 123
           EDEVLLALAEQLGTFT  VGGPEYVHCLLPPLESLATVEETVVRDKAVESLR IS +HSP
Sbjct: 61  EDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSP 120

Query: 124 HDLEAHFVPLVQRLASGDWFTSRTSACGLFSVCYPRVTAGVKAELRSHFRNLCQDDTPMQ 183
            DLEAHFVPLV+RLA GDWFTSRTSACGLFSVCYPRV++ VKAELR +FRNLC DDTPM 
Sbjct: 121 SDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPMV 180

Query: 184 QGHVWECGSG---------VKAELRSHFRNLCQDDTPMVRRAAAGKLGELAKVVEVDYLK 234
           +                  VK+E+   F NL  D+   VR  A      +A+++  + L+
Sbjct: 181 RRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDLE 240

Query: 235 TDIIPMFVNLAQDEQDSVRLLAVEACVSIASLLSQSDVEQLVMPTLRQ 282
             ++P     A+D+   VR +  +    +   +     +  ++P  + 
Sbjct: 241 ALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQN 288


>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Length = 253 Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Length = 253 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Length = 1230 Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Length = 242 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query318
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 99.97
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 99.95
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 99.78
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 99.76
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 99.75
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 99.75
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 99.74
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 99.72
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 99.72
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 99.69
1qgr_A 876 Protein (importin beta subunit); transport recepto 99.68
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 99.68
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 99.67
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 99.67
1qgr_A 876 Protein (importin beta subunit); transport recepto 99.66
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 99.66
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 99.66
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 99.66
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 99.65
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 99.65
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 99.64
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 99.62
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 99.62
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 99.62
4b8j_A 528 Importin subunit alpha-1A; transport protein, nucl 99.55
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 99.53
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.53
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 99.51
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.5
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 99.49
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 99.48
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.42
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 99.41
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 99.41
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 99.41
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 99.38
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 99.36
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.34
3ul1_B 510 Importin subunit alpha-2; arm repeat, armadillo re 99.3
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.3
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 99.29
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 99.29
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 99.29
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 99.27
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.26
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.24
3tpo_A 529 Importin subunit alpha-2; nuclear import, protein 99.23
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.21
3l9t_A240 Putative uncharacterized protein SMU.31; hypotheti 99.16
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.16
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 99.14
3now_A 810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 99.13
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 99.13
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 99.12
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.12
1w63_A618 Adapter-related protein complex 1 gamma 1 subunit; 99.1
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 99.09
3l9t_A240 Putative uncharacterized protein SMU.31; hypotheti 99.03
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 98.98
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 98.97
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 98.95
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 98.92
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 98.91
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 98.89
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 98.83
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 98.82
3nmz_A458 APC variant protein; protein-protein complex, arma 98.78
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 98.78
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 98.75
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 98.75
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 98.69
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 98.69
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 98.62
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 98.57
3nmz_A458 APC variant protein; protein-protein complex, arma 98.54
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 98.52
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 98.52
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 98.5
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 98.42
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 98.4
2db0_A253 253AA long hypothetical protein; heat repeats, hel 98.4
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 98.39
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 98.34
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 98.31
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 98.25
2x1g_F 971 Cadmus; transport protein, developmental protein, 98.25
2x1g_F 971 Cadmus; transport protein, developmental protein, 98.24
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 98.19
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 98.18
2x19_B 963 Importin-13; nuclear transport, protein transport; 98.12
2db0_A253 253AA long hypothetical protein; heat repeats, hel 98.09
2x19_B 963 Importin-13; nuclear transport, protein transport; 98.09
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 98.03
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 98.01
3u0r_A 507 Apoptosis inhibitor 5; heat repeat, armadillo repe 97.9
4hat_C 1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 97.79
4hat_C 1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 97.77
3ibv_A 980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 97.65
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 97.39
3ibv_A 980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 97.25
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 97.14
3grl_A 651 General vesicular transport factor P115; vesicle t 96.64
3o2t_A386 Symplekin; heat repeat, scaffold, protein binding; 96.63
1vsy_5997 Proteasome activator BLM10; 20S proteasome BLM10, 96.63
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 96.56
3u0r_A 507 Apoptosis inhibitor 5; heat repeat, armadillo repe 96.4
3gjx_A 1073 Exportin-1; transport, cytoplasm, nucleus, RNA-bin 96.38
3a6p_A 1204 Exportin-5; exportin-5, RANGTP, nuclearexport, imp 96.29
3gjx_A 1073 Exportin-1; transport, cytoplasm, nucleus, RNA-bin 96.28
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 96.08
3grl_A 651 General vesicular transport factor P115; vesicle t 95.86
3a6p_A 1204 Exportin-5; exportin-5, RANGTP, nuclearexport, imp 95.73
3gs3_A257 Symplekin, LD45768P; helix-turn-helix heat repeat 95.61
3gs3_A257 Symplekin, LD45768P; helix-turn-helix heat repeat 95.57
1vsy_5997 Proteasome activator BLM10; 20S proteasome BLM10, 94.35
2b6c_A220 Hypothetical protein EF3068; structural genomis, D 94.19
2b6c_A220 Hypothetical protein EF3068; structural genomis, D 93.98
3o2t_A 386 Symplekin; heat repeat, scaffold, protein binding; 93.88
1lsh_A 1056 Lipovitellin (LV-1N, LV-1C); vitellogenin, lipopro 93.57
3jxy_A232 Alkylpurine DNA glycosylase ALKD; heat repeat, DNA 93.03
3jxy_A232 Alkylpurine DNA glycosylase ALKD; heat repeat, DNA 92.26
4atg_A196 TAF6; transcription, TFIID; HET: NHE; 1.89A {Anton 91.79
1lsh_A 1056 Lipovitellin (LV-1N, LV-1C); vitellogenin, lipopro 91.07
1x5b_A163 Signal transducing adaptor molecule 2; VHS domain, 90.13
3ldz_A140 STAM-1, signal transducing adapter molecule 1; ubi 89.29
3ut4_A134 CTHE_2751, putative uncharacterized protein; non P 88.69
3zyq_A226 Hepatocyte growth factor-regulated tyrosine kinas 85.42
2fv2_A268 RCD1 required for cell differentiation1 homolog; a 83.11
3ut4_A134 CTHE_2751, putative uncharacterized protein; non P 83.02
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
Probab=99.97  E-value=1.8e-30  Score=252.86  Aligned_cols=292  Identities=60%  Similarity=0.869  Sum_probs=262.3

Q ss_pred             CCCCCCchHHHHHHHhcCccHHHHHHHHHhHHHHHHhhChHhHhhchhhhhhhhcCChHHHHHHHHHHHcccccCcCccc
Q psy14015          7 APDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGQERTRGELIPFLTETIYDEDEVLLALAEQLGTFTPNVGGPE   86 (318)
Q Consensus         7 ~~~~~l~~i~~l~~~l~~~~~~~R~~~~~~L~~ia~~lg~~~~~~~llp~l~~l~~D~~~VR~~aa~~L~~l~~~~~~~~   86 (318)
                      ++|+++.||..+++.++++++.+|..+++.|..++..+|++..+++++|++....+++.+||..+++.|+.+.+.+|++.
T Consensus         4 ~~~~~~~~i~~l~~~l~s~~~~~R~~A~~~l~~i~~~~~~~~~~~~l~~~L~~~~d~~~~vr~~~~~~L~~~~~~~~~~~   83 (588)
T 1b3u_A            4 DGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGTFTTLVGGPE   83 (588)
T ss_dssp             CTTTSSHHHHHHHHHTTCSCHHHHHHHHHTHHHHHHHSCHHHHHHTHHHHHHHTCCCCHHHHHHHHHHHTTCSGGGTSGG
T ss_pred             ccCCCcCcHHHHHHHhhcccHHHHHHHHHhHHHHHHHhCHHHHHHHHHHHHHHhcCCcHHHHHHHHHHHHHHHhccCcHH
Confidence            56899999999999999999999999999999999989998888999999998885555599999999999998888877


Q ss_pred             chhccchHHhhhccCchhHHHHHHHHHHHHHHhhCChhHHhhhHHHHHHHhhcCCCchhhhhhhhhhhhhccccCcchHH
Q psy14015         87 YVHCLLPPLESLATVEETVVRDKAVESLRLISAQHSPHDLEAHFVPLVQRLASGDWFTSRTSACGLFSVCYPRVTAGVKA  166 (318)
Q Consensus        87 ~~~~llp~l~~l~~d~~~~VR~~a~~~l~~l~~~~~~~~~~~~ilp~~~~l~~d~~~~vR~~a~~~l~~~~~~~~~~~~~  166 (318)
                      ....++|.+..+..|++..||..|.+++..++..++++.....++|.+.++.+++++.+|..++.+++.++...+...+.
T Consensus        84 ~~~~ll~~L~~l~~~~~~~vR~~a~~~L~~l~~~~~~~~~~~~l~~~l~~l~~~~~~~~R~~a~~~l~~~~~~~~~~~~~  163 (588)
T 1b3u_A           84 YVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKA  163 (588)
T ss_dssp             GGGGGHHHHHHHTTSSCHHHHHHHHHHHHHHHTTSCHHHHHHTHHHHHHHHHTCSSHHHHHHHGGGHHHHTTTSCHHHHH
T ss_pred             HHHHHHHHHHHHHhCchHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHhcCCCcHHHHHHHHHHHHHHHhcCHHHHH
Confidence            78889999999999999999999999999999999988888889999999999999999999999999999888877778


Q ss_pred             HHHHHHHhhccCCCcccccchh----hc----Cc-cchHHHHHHHHHhhcCCCHHHHHHHHHhhHHHHHHhchhhhHhhH
Q psy14015        167 ELRSHFRNLCQDDTPMQQGHVW----EC----GS-GVKAELRSHFRNLCQDDTPMVRRAAAGKLGELAKVVEVDYLKTDI  237 (318)
Q Consensus       167 ~l~~~~~~l~~~~~~~vR~~v~----~~----~~-~~~~~ll~~l~~l~~D~~~~VR~~aa~~L~~l~~~~~~~~~~~~l  237 (318)
                      .+...+..++.|..+.||....    .+    ++ .....++|.+..+++|+++.||..++.+|+.++..++.+...+.+
T Consensus       164 ~l~~~l~~l~~d~~~~VR~~a~~~l~~l~~~~~~~~~~~~l~~~l~~~~~d~~~~vr~~a~~~l~~l~~~~~~~~~~~~~  243 (588)
T 1b3u_A          164 ELRQYFRNLCSDDTPMVRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDLEALV  243 (588)
T ss_dssp             HHHHHHHHHHTCSCHHHHHHHHHHHHHHHHTSCHHHHHHTHHHHHHHHHTCSCHHHHTTHHHHHHHHHHHSCHHHHHHHT
T ss_pred             HHHHHHHHHhCCCCHHHHHHHHHHHHHHHHHhcHHhHHHHHHHHHHHHhcCCcHHHHHHHHHHHHHHHHhCCHHHHHHHH
Confidence            8888888999999999997422    11    11 234678999999999999999999999999999999887777889


Q ss_pred             HHHHHHhhcCCcHHHHHHHHHHHHHHHhhCChhhhhHhhHHHHHHhccccccccccCCCCCCchhhHHhhh
Q psy14015        238 IPMFVNLAQDEQDSVRLLAVEACVSIASLLSQSDVEQLVMPTLRQCSVQIVDHKFCPNNEFHPLELHVISA  308 (318)
Q Consensus       238 lp~l~~ll~D~~~~VR~aa~~~l~~l~~~l~~~~~~~~l~p~l~~ll~D~~~~~~~~~~~~~~Vr~~~i~~  308 (318)
                      +|.+..+++|++|.||.+++.+++.++..+|++.....++|.+..+++|          ++++||..++++
T Consensus       244 ~~~l~~~~~d~~~~vR~~a~~~l~~l~~~~~~~~~~~~l~~~l~~~l~d----------~~~~vr~~a~~~  304 (588)
T 1b3u_A          244 MPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKD----------CEAEVRAAASHK  304 (588)
T ss_dssp             HHHHHHHHTCSSHHHHHHHHHTHHHHHHHHCHHHHHHTHHHHHHHHHTC----------SSHHHHHHHHHH
T ss_pred             HHHHHHHccCCCHHHHHHHHHHHHHHHHHhCcccchhHHHHHHHHHhCC----------CcHHHHHHHHHH
Confidence            9999999999999999999999999999999887778899999999999          888888876653



>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>3o2t_A Symplekin; heat repeat, scaffold, protein binding; 1.40A {Homo sapiens} PDB: 3odr_A 3ods_A 4h3k_A* 3o2s_A 3o2q_A* 4h3h_A* Back     alignment and structure
>1vsy_5 Proteasome activator BLM10; 20S proteasome BLM10, hydrolase, nucleus, phosphoprotein, PR proteasome, threonine protease; 3.00A {Saccharomyces cerevisiae} PDB: 3l5q_6 Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>3gjx_A Exportin-1; transport, cytoplasm, nucleus, RNA-binding, acetylation, GTP-binding, HOST-virus interaction, nucleotide-binding, phosphoprotein; HET: GTP; 2.50A {Mus musculus} PDB: 3nby_A* 3nbz_A* 3nc0_A* 3nc1_A* 3gb8_A Back     alignment and structure
>3a6p_A Exportin-5; exportin-5, RANGTP, nuclearexport, importin-BE family, nucleus, phosphoprotein, protein transport; HET: GTP; 2.92A {Homo sapiens} Back     alignment and structure
>3gjx_A Exportin-1; transport, cytoplasm, nucleus, RNA-binding, acetylation, GTP-binding, HOST-virus interaction, nucleotide-binding, phosphoprotein; HET: GTP; 2.50A {Mus musculus} PDB: 3nby_A* 3nbz_A* 3nc0_A* 3nc1_A* 3gb8_A Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>3a6p_A Exportin-5; exportin-5, RANGTP, nuclearexport, importin-BE family, nucleus, phosphoprotein, protein transport; HET: GTP; 2.92A {Homo sapiens} Back     alignment and structure
>3gs3_A Symplekin, LD45768P; helix-turn-helix heat repeat extended loop, transcription, protein binding; 2.40A {Drosophila melanogaster} Back     alignment and structure
>3gs3_A Symplekin, LD45768P; helix-turn-helix heat repeat extended loop, transcription, protein binding; 2.40A {Drosophila melanogaster} Back     alignment and structure
>1vsy_5 Proteasome activator BLM10; 20S proteasome BLM10, hydrolase, nucleus, phosphoprotein, PR proteasome, threonine protease; 3.00A {Saccharomyces cerevisiae} PDB: 3l5q_6 Back     alignment and structure
>2b6c_A Hypothetical protein EF3068; structural genomis, DNA repair enzyme, structural genomics, protein structure initiative; HET: SO4; 2.10A {Enterococcus faecalis} SCOP: a.118.1.17 Back     alignment and structure
>2b6c_A Hypothetical protein EF3068; structural genomis, DNA repair enzyme, structural genomics, protein structure initiative; HET: SO4; 2.10A {Enterococcus faecalis} SCOP: a.118.1.17 Back     alignment and structure
>3o2t_A Symplekin; heat repeat, scaffold, protein binding; 1.40A {Homo sapiens} PDB: 3odr_A 3ods_A 4h3k_A* 3o2s_A 3o2q_A* 4h3h_A* Back     alignment and structure
>1lsh_A Lipovitellin (LV-1N, LV-1C); vitellogenin, lipoprotein, plasma apolipoprote apolipoprotein B, APOB; HET: PLD UPL; 1.90A {Ichthyomyzon unicuspis} SCOP: a.118.4.1 f.7.1.1 f.7.1.1 Back     alignment and structure
>3jxy_A Alkylpurine DNA glycosylase ALKD; heat repeat, DNA binding, DNA glycosylase, DNA alkylation, L complex, hydrolase-DNA complex; HET: DNA; 1.50A {Bacillus cereus} SCOP: a.118.1.0 PDB: 3jx7_A* 3bvs_A 3jy1_A* 3jxz_A* Back     alignment and structure
>3jxy_A Alkylpurine DNA glycosylase ALKD; heat repeat, DNA binding, DNA glycosylase, DNA alkylation, L complex, hydrolase-DNA complex; HET: DNA; 1.50A {Bacillus cereus} SCOP: a.118.1.0 PDB: 3jx7_A* 3bvs_A 3jy1_A* 3jxz_A* Back     alignment and structure
>4atg_A TAF6; transcription, TFIID; HET: NHE; 1.89A {Antonospora locustae} Back     alignment and structure
>1lsh_A Lipovitellin (LV-1N, LV-1C); vitellogenin, lipoprotein, plasma apolipoprote apolipoprotein B, APOB; HET: PLD UPL; 1.90A {Ichthyomyzon unicuspis} SCOP: a.118.4.1 f.7.1.1 f.7.1.1 Back     alignment and structure
>1x5b_A Signal transducing adaptor molecule 2; VHS domain, ubiquitin binding, STAM2, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2l0t_B Back     alignment and structure
>3ldz_A STAM-1, signal transducing adapter molecule 1; ubiquitin-binding, cytoplasm, UBL conjugation, endosome, membrane, protein transport, SH3 domain; 2.60A {Homo sapiens} SCOP: a.118.9.0 Back     alignment and structure
>3ut4_A CTHE_2751, putative uncharacterized protein; non PFAM singleton, helical fold, unknown function; 2.03A {Clostridium thermocellum} PDB: 3ut8_A 3ut7_A Back     alignment and structure
>3zyq_A Hepatocyte growth factor-regulated tyrosine kinas substrate; signaling; 1.48A {Homo sapiens} PDB: 4avx_A* Back     alignment and structure
>2fv2_A RCD1 required for cell differentiation1 homolog; armadillo-repeat, transcription; 2.20A {Homo sapiens} Back     alignment and structure
>3ut4_A CTHE_2751, putative uncharacterized protein; non PFAM singleton, helical fold, unknown function; 2.03A {Clostridium thermocellum} PDB: 3ut8_A 3ut7_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 318
d1b3ua_ 588 a.118.1.2 (A:) Constant regulatory domain of prote 3e-70
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 4e-11
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 6e-09
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 2e-08
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 2e-06
d1u6gc_ 1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 3e-05
d2vglb_ 579 a.118.1.10 (B:) Adaptin beta subunit N-terminal fr 4e-04
d1ibrb_458 a.118.1.1 (B:) Importin beta {Human (Homo sapiens) 4e-04
d1qbkb_888 a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapi 0.003
d1oyza_ 276 a.118.1.16 (A:) Hypothetical protein YibA {Escheri 0.004
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: HEAT repeat
domain: Constant regulatory domain of protein phosphatase 2a, pr65alpha
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  226 bits (576), Expect = 3e-70
 Identities = 211/282 (74%), Positives = 226/282 (80%), Gaps = 32/282 (11%)

Query: 2   ASSDSAPDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGQERTRGELIPFLTETI 61
           A++D   DDSLYPIAVLIDEL+NEDVQLRLNSIKKLSTIALALG ERTR EL+PFLT+TI
Sbjct: 1   AAADG--DDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTI 58

Query: 62  YDEDEVLLALAEQLGTFTPNVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRLISAQH 121
           YDEDEVLLALAEQLGTFT  VGGPEYVHCLLPPLESLATVEETVVRDKAVESLR IS +H
Sbjct: 59  YDEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEH 118

Query: 122 SPHDLEAHFVPLVQRLASGDWFTSRTSACGLFSVCYPRVTAGVKAELRSHFRNLCQDDTP 181
           SP DLEAHFVPLV+RLA GDWFTSRTSACGLFSVCYPR                      
Sbjct: 119 SPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPR---------------------- 156

Query: 182 MQQGHVWECGSGVKAELRSHFRNLCQDDTPMVRRAAAGKLGELAKVVEVDYLKTDIIPMF 241
                     S VKAELR +FRNLC DDTPMVRRAAA KLGE AKV+E+D +K++IIPMF
Sbjct: 157 --------VSSAVKAELRQYFRNLCSDDTPMVRRAAASKLGEFAKVLELDNVKSEIIPMF 208

Query: 242 VNLAQDEQDSVRLLAVEACVSIASLLSQSDVEQLVMPTLRQC 283
            NLA DEQDSVRLLAVEACV+IA LL Q D+E LVMPTLRQ 
Sbjct: 209 SNLASDEQDSVRLLAVEACVNIAQLLPQEDLEALVMPTLRQA 250


>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Length = 458 Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Length = 888 Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Length = 276 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query318
d1b3ua_ 588 Constant regulatory domain of protein phosphatase 100.0
d1b3ua_588 Constant regulatory domain of protein phosphatase 99.93
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 99.63
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 99.49
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 99.49
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 99.45
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 99.44
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 99.43
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 99.38
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 99.37
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 99.37
d1qbkb_ 888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 99.36
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 99.36
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 99.35
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 99.33
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.32
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 99.28
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 99.25
d2vgla_ 584 Adaptin alpha C subunit N-terminal fragment {Mouse 99.24
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 99.15
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.13
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 99.12
d1wa5b_ 503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.11
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.11
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.09
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 99.06
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 98.73
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 98.71
d2vgla_ 584 Adaptin alpha C subunit N-terminal fragment {Mouse 98.63
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 98.58
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 98.39
d1xm9a1 457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 97.65
d1wa5c_ 959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 97.43
d1lsha1336 Lipovitellin-phosvitin complex, superhelical domai 96.57
d1lsha1336 Lipovitellin-phosvitin complex, superhelical domai 96.56
d1wa5c_ 959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 96.37
d1dvpa1145 Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7 93.65
d2b6ca1213 Hypothetical protein EF3068 {Enterococcus faecalis 93.14
d2b6ca1213 Hypothetical protein EF3068 {Enterococcus faecalis 92.3
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: HEAT repeat
domain: Constant regulatory domain of protein phosphatase 2a, pr65alpha
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=9e-35  Score=281.41  Aligned_cols=293  Identities=59%  Similarity=0.869  Sum_probs=270.5

Q ss_pred             CCCCCCchHHHHHHHhcCccHHHHHHHHHhHHHHHHhhChHhHhhchhhhhhhhcCChHHHHHHHHHHHcccccCcCccc
Q psy14015          7 APDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGQERTRGELIPFLTETIYDEDEVLLALAEQLGTFTPNVGGPE   86 (318)
Q Consensus         7 ~~~~~l~~i~~l~~~l~~~~~~~R~~~~~~L~~ia~~lg~~~~~~~llp~l~~l~~D~~~VR~~aa~~L~~l~~~~~~~~   86 (318)
                      .+|++|.||+.+++.|+++++.+|..+++.|+.++..+|++.++++++|++.++++|+++|+.+++++|+.++..+|+++
T Consensus         4 ~~~~~~~~i~~l~~~l~~~~~~~R~~a~~~l~~ia~~lg~~~~~~~lip~l~~~~~~~~ev~~~~~~~l~~~~~~~~~~~   83 (588)
T d1b3ua_           4 DGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGTFTTLVGGPE   83 (588)
T ss_dssp             CTTTSSHHHHHHHHHTTCSCHHHHHHHHHTHHHHHHHSCHHHHHHTHHHHHHHTCCCCHHHHHHHHHHHTTCSGGGTSGG
T ss_pred             CcCcchhHHHHHHHHhcCCCHHHHHHHHHHHHHHHHHhCcHhhHHHHHHHHHHHhcCcHHHHHHHHHHHHHHHHHcCChh
Confidence            57899999999999999999999999999999999999999999999999999999988899999999999999999999


Q ss_pred             chhccchHHhhhccCchhHHHHHHHHHHHHHHhhCChhHHhhhHHHHHHHhhcCCCchhhhhhhhhhhhhccccCcchHH
Q psy14015         87 YVHCLLPPLESLATVEETVVRDKAVESLRLISAQHSPHDLEAHFVPLVQRLASGDWFTSRTSACGLFSVCYPRVTAGVKA  166 (318)
Q Consensus        87 ~~~~llp~l~~l~~d~~~~VR~~a~~~l~~l~~~~~~~~~~~~ilp~~~~l~~d~~~~vR~~a~~~l~~~~~~~~~~~~~  166 (318)
                      ..+.++|.+..++.+++..||.+|++++..++...+++.+...+.|++.++.+++++..|.+|+.+++.++.+.+...+.
T Consensus        84 ~~~~ll~~l~~l~~~~~~~Vr~~a~~~l~~i~~~~~~~~~~~~l~p~i~~L~~~~~~~~r~~a~~ll~~~~~~~~~~~~~  163 (588)
T d1b3ua_          84 YVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKA  163 (588)
T ss_dssp             GGGGGHHHHHHHTTSSCHHHHHHHHHHHHHHHTTSCHHHHHHTHHHHHHHHHTCSSHHHHHHHGGGHHHHTTTSCHHHHH
T ss_pred             HHHHHHHHHHHHccCCCHHHHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHhcccchHHHHHHHHHHHHHHHHhhHHHHH
Confidence            99999999999999999999999999999999999999999999999999999988899999999999999988888888


Q ss_pred             HHHHHHHhhccCCCcccccchh----hc----C-ccchHHHHHHHHHhhcCCCHHHHHHHHHhhHHHHHHhchhhhHhhH
Q psy14015        167 ELRSHFRNLCQDDTPMQQGHVW----EC----G-SGVKAELRSHFRNLCQDDTPMVRRAAAGKLGELAKVVEVDYLKTDI  237 (318)
Q Consensus       167 ~l~~~~~~l~~~~~~~vR~~v~----~~----~-~~~~~~ll~~l~~l~~D~~~~VR~~aa~~L~~l~~~~~~~~~~~~l  237 (318)
                      ++...+..+++|..|.||+...    .+    + +.....++|.+..+++|+++.||..++.+++.++..++.+.....+
T Consensus       164 ~l~~~~~~l~~D~~~~VR~~a~~~l~~~~~~~~~~~~~~~l~~~l~~l~~d~~~~vr~~a~~~l~~i~~~~~~~~~~~~i  243 (588)
T d1b3ua_         164 ELRQYFRNLCSDDTPMVRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDLEALV  243 (588)
T ss_dssp             HHHHHHHHHHTCSCHHHHHHHHHHHHHHHHTSCHHHHHHTHHHHHHHHHTCSCHHHHTTHHHHHHHHHHHSCHHHHHHHT
T ss_pred             HHHHHHHHHhccCCHHHHHHHHHHHHHHHHHhcHHHHHHHHHHHHHHHhcCCchhhHHHHHHHHHHhhccCCHHHHHHHH
Confidence            8888999999999999998421    11    1 1345678999999999999999999999999999999988777889


Q ss_pred             HHHHHHhhcCCcHHHHHHHHHHHHHHHhhCChhhhhHhhHHHHHHhccccccccccCCCCCCchhhHHhhhh
Q psy14015        238 IPMFVNLAQDEQDSVRLLAVEACVSIASLLSQSDVEQLVMPTLRQCSVQIVDHKFCPNNEFHPLELHVISAT  309 (318)
Q Consensus       238 lp~l~~ll~D~~~~VR~aa~~~l~~l~~~l~~~~~~~~l~p~l~~ll~D~~~~~~~~~~~~~~Vr~~~i~~~  309 (318)
                      +|.+..+++|++|.||.+++.+++.++..++++...+.++|.+..+++|          ++++||..+++..
T Consensus       244 ~~~l~~~~~D~~~~Vr~~~~~~l~~l~~~~~~~~~~~~l~~~l~~ll~d----------~~~~vr~~a~~~l  305 (588)
T d1b3ua_         244 MPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKD----------CEAEVRAAASHKV  305 (588)
T ss_dssp             HHHHHHHHTCSSHHHHHHHHHTHHHHHHHHCHHHHHHTHHHHHHHHHTC----------SSHHHHHHHHHHH
T ss_pred             HHHHHHhcccccHHHHHHHHHhHHHHHHHhhhhhhhhhhhHHHHHHHhc----------cchHHHHHHHHHH
Confidence            9999999999999999999999999999999988778899999999999          8999998887654



>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} Back     information, alignment and structure
>d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dvpa1 a.118.9.2 (A:1-145) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2b6ca1 a.118.1.17 (A:3-215) Hypothetical protein EF3068 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2b6ca1 a.118.1.17 (A:3-215) Hypothetical protein EF3068 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure