Psyllid ID: psy14017
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 115 | ||||||
| 383860430 | 602 | PREDICTED: serine/threonine-protein phos | 0.530 | 0.101 | 0.721 | 2e-18 | |
| 332020375 | 603 | Serine/threonine-protein phosphatase 2A | 0.530 | 0.101 | 0.704 | 3e-18 | |
| 322787434 | 589 | hypothetical protein SINV_04974 [Solenop | 0.530 | 0.103 | 0.704 | 3e-18 | |
| 328782568 | 590 | PREDICTED: serine/threonine-protein phos | 0.530 | 0.103 | 0.721 | 4e-18 | |
| 156547500 | 590 | PREDICTED: serine/threonine-protein phos | 0.530 | 0.103 | 0.704 | 6e-18 | |
| 307189141 | 601 | Serine/threonine-protein phosphatase 2A | 0.530 | 0.101 | 0.688 | 6e-18 | |
| 307201783 | 590 | Serine/threonine-protein phosphatase 2A | 0.530 | 0.103 | 0.704 | 7e-18 | |
| 156362396 | 586 | predicted protein [Nematostella vectensi | 0.556 | 0.109 | 0.640 | 3e-17 | |
| 350402824 | 590 | PREDICTED: serine/threonine-protein phos | 0.530 | 0.103 | 0.704 | 4e-17 | |
| 340728831 | 590 | PREDICTED: serine/threonine-protein phos | 0.530 | 0.103 | 0.704 | 4e-17 |
| >gi|383860430|ref|XP_003705692.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
Score = 96.3 bits (238), Expect = 2e-18, Method: Compositional matrix adjust.
Identities = 44/61 (72%), Positives = 50/61 (81%)
Query: 54 IAEACGPTVTANFLLPTVLNMAGDNVANVRFNVAKTLQKIGPILETNVIQSQVKPALDKL 113
+AE CGP +T +LPTVL MA DNVANVRFNVAKTLQKIGP LE + +Q+QVKP LDKL
Sbjct: 510 LAEVCGPEITTKVMLPTVLGMATDNVANVRFNVAKTLQKIGPYLEPSAVQTQVKPVLDKL 569
Query: 114 N 114
N
Sbjct: 570 N 570
|
Source: Megachile rotundata Species: Megachile rotundata Genus: Megachile Family: Megachilidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|332020375|gb|EGI60796.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|322787434|gb|EFZ13522.1| hypothetical protein SINV_04974 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|328782568|ref|XP_001120202.2| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform-like [Apis mellifera] gi|380013196|ref|XP_003690652.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|156547500|ref|XP_001600229.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|307189141|gb|EFN73589.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|307201783|gb|EFN81456.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|156362396|ref|XP_001625764.1| predicted protein [Nematostella vectensis] gi|156212612|gb|EDO33664.1| predicted protein [Nematostella vectensis] | Back alignment and taxonomy information |
|---|
| >gi|350402824|ref|XP_003486616.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340728831|ref|XP_003402717.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 115 | ||||||
| UNIPROTKB|B3KQV6 | 410 | PPP2R1A "Serine/threonine-prot | 0.521 | 0.146 | 0.65 | 3.3e-16 | |
| FB|FBgn0260439 | 591 | Pp2A-29B "Protein phosphatase | 0.530 | 0.103 | 0.688 | 3.8e-16 | |
| UNIPROTKB|P30154 | 601 | PPP2R1B "Serine/threonine-prot | 0.521 | 0.099 | 0.666 | 3.9e-16 | |
| MGI|MGI:1920949 | 601 | Ppp2r1b "protein phosphatase 2 | 0.521 | 0.099 | 0.666 | 3.9e-16 | |
| RGD|1304764 | 601 | Ppp2r1b "protein phosphatase 2 | 0.521 | 0.099 | 0.666 | 3.9e-16 | |
| UNIPROTKB|A5D973 | 589 | PPP2R1A "Alpha isoform of regu | 0.521 | 0.101 | 0.65 | 6.2e-16 | |
| UNIPROTKB|Q32PI5 | 589 | PPP2R1A "Serine/threonine-prot | 0.521 | 0.101 | 0.65 | 6.2e-16 | |
| UNIPROTKB|F1PX75 | 589 | PPP2R1A "Uncharacterized prote | 0.521 | 0.101 | 0.65 | 7.9e-16 | |
| UNIPROTKB|P30153 | 589 | PPP2R1A "Serine/threonine-prot | 0.521 | 0.101 | 0.65 | 7.9e-16 | |
| UNIPROTKB|P54612 | 589 | PPP2R1A "Serine/threonine-prot | 0.521 | 0.101 | 0.65 | 7.9e-16 |
| UNIPROTKB|B3KQV6 PPP2R1A "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Score = 207 (77.9 bits), Expect = 3.3e-16, P = 3.3e-16
Identities = 39/60 (65%), Positives = 49/60 (81%)
Query: 54 IAEACGPTVTANFLLPTVLNMAGDNVANVRFNVAKTLQKIGPILETNVIQSQVKPALDKL 113
++E CG +T +LPTVL MAGD VANVRFNVAK+LQKIGPIL+ + +QS+VKP L+KL
Sbjct: 329 LSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKL 388
|
|
| FB|FBgn0260439 Pp2A-29B "Protein phosphatase 2A at 29B" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P30154 PPP2R1B "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1920949 Ppp2r1b "protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 65), beta isoform" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1304764 Ppp2r1b "protein phosphatase 2, regulatory subunit A, beta" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A5D973 PPP2R1A "Alpha isoform of regulatory subunit A, protein phosphatase 2" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q32PI5 PPP2R1A "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PX75 PPP2R1A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P30153 PPP2R1A "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P54612 PPP2R1A "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 115 | |||
| pfam02985 | 31 | pfam02985, HEAT, HEAT repeat | 0.002 |
| >gnl|CDD|202500 pfam02985, HEAT, HEAT repeat | Back alignment and domain information |
|---|
Score = 33.3 bits (77), Expect = 0.002
Identities = 10/31 (32%), Positives = 15/31 (48%)
Query: 67 LLPTVLNMAGDNVANVRFNVAKTLQKIGPIL 97
LLP +L + D VR A+ L + +L
Sbjct: 1 LLPLLLELLNDPDPEVREAAAEALGALAEVL 31
|
The HEAT repeat family is related to armadillo/beta-catenin-like repeats (see pfam00514). Length = 31 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 115 | |||
| KOG0211|consensus | 759 | 99.37 | ||
| PF02985 | 31 | HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re | 98.09 | |
| PF13513 | 55 | HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O | 97.71 | |
| KOG0211|consensus | 759 | 97.37 | ||
| PF12755 | 97 | Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region | 97.35 | |
| PF13646 | 88 | HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I | 97.23 | |
| cd00020 | 120 | ARM Armadillo/beta-catenin-like repeats. An approx | 96.91 | |
| KOG1243|consensus | 690 | 96.34 | ||
| PF12717 | 178 | Cnd1: non-SMC mitotic condensation complex subunit | 96.16 | |
| KOG2171|consensus | 1075 | 95.85 | ||
| PF12348 | 228 | CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi | 95.67 | |
| PF01602 | 526 | Adaptin_N: Adaptin N terminal region; InterPro: IP | 95.23 | |
| KOG1240|consensus | 1431 | 95.07 | ||
| KOG1240|consensus | 1431 | 94.95 | ||
| PF10363 | 92 | DUF2435: Protein of unknown function (DUF2435) | 94.55 | |
| PF12717 | 178 | Cnd1: non-SMC mitotic condensation complex subunit | 94.29 | |
| PF12755 | 97 | Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region | 94.07 | |
| PF01602 | 526 | Adaptin_N: Adaptin N terminal region; InterPro: IP | 92.95 | |
| PRK09687 | 280 | putative lyase; Provisional | 92.68 | |
| KOG2137|consensus | 700 | 92.23 | ||
| PTZ00429 | 746 | beta-adaptin; Provisional | 91.99 | |
| PF00514 | 41 | Arm: Armadillo/beta-catenin-like repeat; InterPro: | 91.86 | |
| cd00020 | 120 | ARM Armadillo/beta-catenin-like repeats. An approx | 91.33 | |
| PRK09687 | 280 | putative lyase; Provisional | 91.15 | |
| PF12348 | 228 | CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi | 91.05 | |
| PF12460 | 415 | MMS19_C: RNAPII transcription regulator C-terminal | 90.99 | |
| PF13646 | 88 | HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I | 90.51 | |
| PRK13800 | 897 | putative oxidoreductase/HEAT repeat-containing pro | 88.4 | |
| PF02985 | 31 | HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re | 87.88 | |
| KOG2023|consensus | 885 | 87.81 | ||
| PTZ00429 | 746 | beta-adaptin; Provisional | 87.79 | |
| KOG2137|consensus | 700 | 86.77 | ||
| KOG1242|consensus | 569 | 86.06 | ||
| PRK13800 | 897 | putative oxidoreductase/HEAT repeat-containing pro | 83.95 | |
| PF04826 | 254 | Arm_2: Armadillo-like; InterPro: IPR006911 This en | 83.65 | |
| PF10508 | 503 | Proteasom_PSMB: Proteasome non-ATPase 26S subunit; | 82.47 | |
| KOG1243|consensus | 690 | 82.24 | ||
| KOG1820|consensus | 815 | 81.99 | ||
| KOG2259|consensus | 823 | 81.97 | ||
| PF13251 | 182 | DUF4042: Domain of unknown function (DUF4042) | 81.59 | |
| PF11698 | 119 | V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 | 80.05 |
| >KOG0211|consensus | Back alignment and domain information |
|---|
Probab=99.37 E-value=9.6e-13 Score=117.75 Aligned_cols=75 Identities=37% Similarity=0.484 Sum_probs=72.8
Q ss_pred hHHHHHHHHHHHHHHHhhhChhHHhHhHHHHHhhhcCCCCcchhHHHHHHHHHhcccccchhhhhcHHHHHHhhh
Q psy14017 40 SAEIRRIPQKYSSQIAEACGPTVTANFLLPTVLNMAGDNVANVRFNVAKTLQKIGPILETNVIQSQVKPALDKLN 114 (115)
Q Consensus 40 s~~VR~t~l~aI~~La~~l~~eii~~~ILPivl~L~kD~VPNVRfNVAK~L~~Ia~~l~~~~v~s~IkP~L~kL~ 114 (115)
+-.+|+|++++|..+++++|++++.++++|++..+.+|++||||||+||.|..+.+.+.....++.|+|+++.|.
T Consensus 570 ~y~~R~t~l~si~~la~v~g~ei~~~~Llp~~~~l~~D~vanVR~nvak~L~~i~~~L~~~~~~~~v~pll~~L~ 644 (759)
T KOG0211|consen 570 NYLVRMTTLFSIHELAEVLGQEITCEDLLPVFLDLVKDPVANVRINVAKHLPKILKLLDESVRDEEVLPLLETLS 644 (759)
T ss_pred ccchhhHHHHHHHHHHHHhccHHHHHHHhHHHHHhccCCchhhhhhHHHHHHHHHhhcchHHHHHHHHHHHHHhc
Confidence 568999999999999999999999999999999999999999999999999999999999999999999999875
|
|
| >PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] | Back alignment and domain information |
|---|
| >PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B | Back alignment and domain information |
|---|
| >KOG0211|consensus | Back alignment and domain information |
|---|
| >PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region | Back alignment and domain information |
|---|
| >PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A | Back alignment and domain information |
|---|
| >cd00020 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >KOG1243|consensus | Back alignment and domain information |
|---|
| >PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 | Back alignment and domain information |
|---|
| >KOG2171|consensus | Back alignment and domain information |
|---|
| >PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] | Back alignment and domain information |
|---|
| >PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >KOG1240|consensus | Back alignment and domain information |
|---|
| >KOG1240|consensus | Back alignment and domain information |
|---|
| >PF10363 DUF2435: Protein of unknown function (DUF2435) | Back alignment and domain information |
|---|
| >PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 | Back alignment and domain information |
|---|
| >PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region | Back alignment and domain information |
|---|
| >PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PRK09687 putative lyase; Provisional | Back alignment and domain information |
|---|
| >KOG2137|consensus | Back alignment and domain information |
|---|
| >PTZ00429 beta-adaptin; Provisional | Back alignment and domain information |
|---|
| >PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless | Back alignment and domain information |
|---|
| >cd00020 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >PRK09687 putative lyase; Provisional | Back alignment and domain information |
|---|
| >PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] | Back alignment and domain information |
|---|
| >PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins | Back alignment and domain information |
|---|
| >PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A | Back alignment and domain information |
|---|
| >PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] | Back alignment and domain information |
|---|
| >KOG2023|consensus | Back alignment and domain information |
|---|
| >PTZ00429 beta-adaptin; Provisional | Back alignment and domain information |
|---|
| >KOG2137|consensus | Back alignment and domain information |
|---|
| >KOG1242|consensus | Back alignment and domain information |
|---|
| >PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function | Back alignment and domain information |
|---|
| >PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG1243|consensus | Back alignment and domain information |
|---|
| >KOG1820|consensus | Back alignment and domain information |
|---|
| >KOG2259|consensus | Back alignment and domain information |
|---|
| >PF13251 DUF4042: Domain of unknown function (DUF4042) | Back alignment and domain information |
|---|
| >PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 115 | ||||
| 3c5w_A | 232 | Complex Between Pp2a-Specific Methylesterase Pme-1 | 4e-18 | ||
| 3dw8_A | 582 | Structure Of A Protein Phosphatase 2a Holoenzyme Wi | 4e-18 | ||
| 2pkg_A | 580 | Structure Of A Complex Between The A Subunit Of Pro | 4e-18 | ||
| 2ie3_A | 589 | Structure Of The Protein Phosphatase 2a Core Enzyme | 4e-18 | ||
| 1b3u_A | 588 | Crystal Structure Of Constant Regulatory Domain Of | 4e-18 | ||
| 2iae_A | 589 | Crystal Structure Of A Protein Phosphatase 2a (Pp2a | 5e-18 | ||
| 3fga_A | 588 | Structural Basis Of Pp2a And Sgo Interaction Length | 5e-18 | ||
| 2nyl_A | 582 | Crystal Structure Of Protein Phosphatase 2a (Pp2a) | 2e-16 |
| >pdb|3C5W|A Chain A, Complex Between Pp2a-Specific Methylesterase Pme-1 And Pp2a Core Enzyme Length = 232 | Back alignment and structure |
|
| >pdb|3DW8|A Chain A, Structure Of A Protein Phosphatase 2a Holoenzyme With B55 Subunit Length = 582 | Back alignment and structure |
| >pdb|2PKG|A Chain A, Structure Of A Complex Between The A Subunit Of Protein Phosphatase 2a And The Small T Antigen Of Sv40 Length = 580 | Back alignment and structure |
| >pdb|2IE3|A Chain A, Structure Of The Protein Phosphatase 2a Core Enzyme Bound To Tumor- Inducing Toxins Length = 589 | Back alignment and structure |
| >pdb|1B3U|A Chain A, Crystal Structure Of Constant Regulatory Domain Of Human Pp2a, Pr65alpha Length = 588 | Back alignment and structure |
| >pdb|2IAE|A Chain A, Crystal Structure Of A Protein Phosphatase 2a (Pp2a) Holoenzyme. Length = 589 | Back alignment and structure |
| >pdb|3FGA|A Chain A, Structural Basis Of Pp2a And Sgo Interaction Length = 588 | Back alignment and structure |
| >pdb|2NYL|A Chain A, Crystal Structure Of Protein Phosphatase 2a (Pp2a) Holoenzyme With The Catalytic Subunit Carboxyl Terminus Truncated Length = 582 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 115 | |||
| 1b3u_A | 588 | Protein (protein phosphatase PP2A); scaffold prote | 2e-15 | |
| 1b3u_A | 588 | Protein (protein phosphatase PP2A); scaffold prote | 3e-05 | |
| 1b3u_A | 588 | Protein (protein phosphatase PP2A); scaffold prote | 5e-05 | |
| 1b3u_A | 588 | Protein (protein phosphatase PP2A); scaffold prote | 2e-04 | |
| 1b3u_A | 588 | Protein (protein phosphatase PP2A); scaffold prote | 2e-04 |
| >1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 | Back alignment and structure |
|---|
Score = 69.7 bits (170), Expect = 2e-15
Identities = 39/62 (62%), Positives = 50/62 (80%)
Query: 52 SQIAEACGPTVTANFLLPTVLNMAGDNVANVRFNVAKTLQKIGPILETNVIQSQVKPALD 111
+ ++E CG +T +LPTVL MAGD VANVRFNVAK+LQKIGPIL+ + +QS+VKP L+
Sbjct: 505 NVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILE 564
Query: 112 KL 113
KL
Sbjct: 565 KL 566
|
| >1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 | Back alignment and structure |
|---|
| >1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 | Back alignment and structure |
|---|
| >1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 | Back alignment and structure |
|---|
| >1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 115 | |||
| 1b3u_A | 588 | Protein (protein phosphatase PP2A); scaffold prote | 98.75 | |
| 1b3u_A | 588 | Protein (protein phosphatase PP2A); scaffold prote | 98.04 | |
| 1ibr_B | 462 | P95, importin beta-1 subunit, nuclear factor; smal | 97.72 | |
| 2qk2_A | 242 | LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 | 97.12 | |
| 2qk2_A | 242 | LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 | 97.01 | |
| 2bpt_A | 861 | Importin beta-1 subunit; nuclear transport, nucleo | 96.82 | |
| 1ibr_B | 462 | P95, importin beta-1 subunit, nuclear factor; smal | 96.82 | |
| 2qk1_A | 249 | Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h | 96.77 | |
| 4fdd_A | 852 | Transportin-1; heat repeats, karyopherin, nuclear | 96.74 | |
| 4fdd_A | 852 | Transportin-1; heat repeats, karyopherin, nuclear | 96.6 | |
| 1te4_A | 131 | Conserved protein MTH187; methanobacterium thermoa | 96.48 | |
| 1qgr_A | 876 | Protein (importin beta subunit); transport recepto | 96.48 | |
| 3ltm_A | 211 | Alpha-REP4; protein engineering, heat-like repeat, | 96.43 | |
| 1qgr_A | 876 | Protein (importin beta subunit); transport recepto | 96.37 | |
| 2vgl_B | 591 | AP-2 complex subunit beta-1; cytoplasmic vesicle, | 96.15 | |
| 3ltj_A | 201 | Alpharep-4; protein engineering, heat-like repeat, | 96.11 | |
| 3ltm_A | 211 | Alpha-REP4; protein engineering, heat-like repeat, | 96.04 | |
| 1u6g_C | 1230 | TIP120 protein, CAND1; cullin repeat, heat repeat, | 96.01 | |
| 4db6_A | 210 | Armadillo repeat protein; solenoid repeat, armadil | 95.96 | |
| 3ltj_A | 201 | Alpharep-4; protein engineering, heat-like repeat, | 95.96 | |
| 4db6_A | 210 | Armadillo repeat protein; solenoid repeat, armadil | 95.86 | |
| 1u6g_C | 1230 | TIP120 protein, CAND1; cullin repeat, heat repeat, | 95.84 | |
| 1oyz_A | 280 | Hypothetical protein YIBA; structural genomics, PS | 95.84 | |
| 4hxt_A | 252 | De novo protein OR329; structural genomics, PSI-bi | 95.8 | |
| 4ffb_C | 278 | Protein STU2; tubulin fold, heat repeats, cytoskel | 95.75 | |
| 1te4_A | 131 | Conserved protein MTH187; methanobacterium thermoa | 95.73 | |
| 4hxt_A | 252 | De novo protein OR329; structural genomics, PSI-bi | 95.7 | |
| 2bpt_A | 861 | Importin beta-1 subunit; nuclear transport, nucleo | 95.67 | |
| 2qk1_A | 249 | Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h | 95.63 | |
| 1wa5_C | 960 | Importin alpha RE-exporter; nuclear transport/comp | 95.55 | |
| 1oyz_A | 280 | Hypothetical protein YIBA; structural genomics, PS | 95.52 | |
| 2jdq_A | 450 | Importin alpha-1 subunit; transport, PB2 subunit, | 95.5 | |
| 2vgl_B | 591 | AP-2 complex subunit beta-1; cytoplasmic vesicle, | 95.44 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 95.32 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 95.06 | |
| 2jdq_A | 450 | Importin alpha-1 subunit; transport, PB2 subunit, | 94.96 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 94.81 | |
| 1w63_A | 618 | Adapter-related protein complex 1 gamma 1 subunit; | 93.99 | |
| 1wa5_B | 530 | Importin alpha subunit; nuclear transport/complex, | 93.92 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 93.38 | |
| 4b8j_A | 528 | Importin subunit alpha-1A; transport protein, nucl | 93.34 | |
| 1wa5_B | 530 | Importin alpha subunit; nuclear transport/complex, | 92.8 | |
| 4b8j_A | 528 | Importin subunit alpha-1A; transport protein, nucl | 92.55 | |
| 1w63_A | 618 | Adapter-related protein complex 1 gamma 1 subunit; | 92.35 | |
| 4ady_A | 963 | RPN2, 26S proteasome regulatory subunit RPN2; prot | 91.93 | |
| 1xqr_A | 296 | HSPBP1 protein; armadillo repeat, superhelical twi | 91.59 | |
| 2vgl_A | 621 | Adaptor protein complex AP-2, alpha 2 subunit; cyt | 91.41 | |
| 3ul1_B | 510 | Importin subunit alpha-2; arm repeat, armadillo re | 90.93 | |
| 2x19_B | 963 | Importin-13; nuclear transport, protein transport; | 90.78 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 90.67 | |
| 1xqr_A | 296 | HSPBP1 protein; armadillo repeat, superhelical twi | 90.38 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 90.09 | |
| 2vgl_A | 621 | Adaptor protein complex AP-2, alpha 2 subunit; cyt | 89.61 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 89.42 | |
| 3tpo_A | 529 | Importin subunit alpha-2; nuclear import, protein | 89.34 | |
| 2of3_A | 266 | ZYG-9; multifunctional macromolecule, kinetochore, | 88.84 | |
| 3ul1_B | 510 | Importin subunit alpha-2; arm repeat, armadillo re | 88.76 | |
| 3l9t_A | 240 | Putative uncharacterized protein SMU.31; hypotheti | 88.13 | |
| 3m1i_C | 1049 | Exportin-1; heat repeat, GTP-binding, nucleotide-b | 87.61 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 87.5 | |
| 1xm9_A | 457 | Plakophilin 1; armadillo repeat, cell adhesion; 2. | 86.53 | |
| 4gmo_A | 684 | Putative uncharacterized protein; ARM, heat, solen | 86.43 | |
| 3tpo_A | 529 | Importin subunit alpha-2; nuclear import, protein | 85.93 | |
| 3nmw_A | 354 | APC variant protein; ARMADIILO repeats domain, cel | 85.84 | |
| 2x1g_F | 971 | Cadmus; transport protein, developmental protein, | 85.28 | |
| 1xm9_A | 457 | Plakophilin 1; armadillo repeat, cell adhesion; 2. | 84.33 | |
| 3tt9_A | 233 | Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | 83.16 | |
| 2x1g_F | 971 | Cadmus; transport protein, developmental protein, | 81.29 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 80.77 | |
| 3nmw_A | 354 | APC variant protein; ARMADIILO repeats domain, cel | 80.09 |
| >1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A | Back alignment and structure |
|---|
Probab=98.75 E-value=2e-08 Score=80.19 Aligned_cols=76 Identities=53% Similarity=0.782 Sum_probs=70.6
Q ss_pred hhHHHHHHHHHHHHHHHhhhChhHHhHhHHHHHhhhcCCCCcchhHHHHHHHHHhcccccchhhhhcHHHHHHhhh
Q psy14017 39 ESAEIRRIPQKYSSQIAEACGPTVTANFLLPTVLNMAGDNVANVRFNVAKTLQKIGPILETNVIQSQVKPALDKLN 114 (115)
Q Consensus 39 ~s~~VR~t~l~aI~~La~~l~~eii~~~ILPivl~L~kD~VPNVRfNVAK~L~~Ia~~l~~~~v~s~IkP~L~kL~ 114 (115)
.+..+|.+.+.++..++..++.+...+.++|.++++++|+.||||.+++++|..+...++.+...+.+.|.|.+|.
T Consensus 492 ~~~~~R~~a~~~l~~l~~~~~~~~~~~~~~~~l~~~l~d~~~~Vr~~a~~~l~~l~~~~~~~~~~~~~~p~l~~l~ 567 (588)
T 1b3u_A 492 PNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLT 567 (588)
T ss_dssp SCHHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHGGGCSCHHHHHHHHHHHHHHGGGSCHHHHHHHHHHHHHHHT
T ss_pred CCHHHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhhCCCCCchHHHHHHHHHHHHHHHhchhhhHHHHHHHHHHHc
Confidence 4578999999999999999999999999999999999999999999999999999999988877788999998864
|
| >1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A | Back alignment and structure |
|---|
| >1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A | Back alignment and structure |
|---|
| >2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A | Back alignment and structure |
|---|
| >1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A | Back alignment and structure |
|---|
| >2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* | Back alignment and structure |
|---|
| >4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* | Back alignment and structure |
|---|
| >1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A | Back alignment and structure |
|---|
| >3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} | Back alignment and structure |
|---|
| >1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A | Back alignment and structure |
|---|
| >2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B | Back alignment and structure |
|---|
| >3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} | Back alignment and structure |
|---|
| >3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} | Back alignment and structure |
|---|
| >1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A | Back alignment and structure |
|---|
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A | Back alignment and structure |
|---|
| >3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} | Back alignment and structure |
|---|
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A | Back alignment and structure |
|---|
| >1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A | Back alignment and structure |
|---|
| >1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} | Back alignment and structure |
|---|
| >4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} | Back alignment and structure |
|---|
| >2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A | Back alignment and structure |
|---|
| >2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A | Back alignment and structure |
|---|
| >1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A | Back alignment and structure |
|---|
| >2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A | Back alignment and structure |
|---|
| >1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 | Back alignment and structure |
|---|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A | Back alignment and structure |
|---|
| >4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A | Back alignment and structure |
|---|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A | Back alignment and structure |
|---|
| >4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A | Back alignment and structure |
|---|
| >1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 | Back alignment and structure |
|---|
| >4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N | Back alignment and structure |
|---|
| >1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* | Back alignment and structure |
|---|
| >2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A | Back alignment and structure |
|---|
| >3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... | Back alignment and structure |
|---|
| >2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} | Back alignment and structure |
|---|
| >2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B | Back alignment and structure |
|---|
| >2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... | Back alignment and structure |
|---|
| >3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} | Back alignment and structure |
|---|
| >1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 | Back alignment and structure |
|---|
| >4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A | Back alignment and structure |
|---|
| >3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B | Back alignment and structure |
|---|
| >3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A | Back alignment and structure |
|---|
| >2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 | Back alignment and structure |
|---|
| >3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 115 | ||||
| d1b3ua_ | 588 | a.118.1.2 (A:) Constant regulatory domain of prote | 3e-17 | |
| d1b3ua_ | 588 | a.118.1.2 (A:) Constant regulatory domain of prote | 9e-06 | |
| d1b3ua_ | 588 | a.118.1.2 (A:) Constant regulatory domain of prote | 4e-04 | |
| d1ibrb_ | 458 | a.118.1.1 (B:) Importin beta {Human (Homo sapiens) | 4e-05 |
| >d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: ARM repeat family: HEAT repeat domain: Constant regulatory domain of protein phosphatase 2a, pr65alpha species: Human (Homo sapiens) [TaxId: 9606]
Score = 73.7 bits (179), Expect = 3e-17
Identities = 39/62 (62%), Positives = 50/62 (80%)
Query: 52 SQIAEACGPTVTANFLLPTVLNMAGDNVANVRFNVAKTLQKIGPILETNVIQSQVKPALD 111
+ ++E CG +T +LPTVL MAGD VANVRFNVAK+LQKIGPIL+ + +QS+VKP L+
Sbjct: 505 NVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILE 564
Query: 112 KL 113
KL
Sbjct: 565 KL 566
|
| >d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 | Back information, alignment and structure |
|---|
| >d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 | Back information, alignment and structure |
|---|
| >d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Length = 458 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 115 | |||
| d1b3ua_ | 588 | Constant regulatory domain of protein phosphatase | 99.26 | |
| d1b3ua_ | 588 | Constant regulatory domain of protein phosphatase | 97.97 | |
| d1ibrb_ | 458 | Importin beta {Human (Homo sapiens) [TaxId: 9606]} | 97.97 | |
| d1te4a_ | 111 | MTH187 {Archaeon Methanobacterium thermoautotrophi | 97.13 | |
| d2vglb_ | 579 | Adaptin beta subunit N-terminal fragment {Human (H | 96.85 | |
| d2vglb_ | 579 | Adaptin beta subunit N-terminal fragment {Human (H | 96.32 | |
| d1ibrb_ | 458 | Importin beta {Human (Homo sapiens) [TaxId: 9606]} | 96.3 | |
| d1qbkb_ | 888 | Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 | 96.27 | |
| d1te4a_ | 111 | MTH187 {Archaeon Methanobacterium thermoautotrophi | 96.1 | |
| d1oyza_ | 276 | Hypothetical protein YibA {Escherichia coli [TaxId | 95.94 | |
| d1xm9a1 | 457 | Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | 95.48 | |
| d2vgla_ | 584 | Adaptin alpha C subunit N-terminal fragment {Mouse | 95.11 | |
| d1qbkb_ | 888 | Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 | 95.01 | |
| d2bpta1 | 861 | Importin beta {Baker's yeast (Saccharomyces cerevi | 94.82 | |
| d2bpta1 | 861 | Importin beta {Baker's yeast (Saccharomyces cerevi | 93.7 | |
| d1xqra1 | 264 | Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi | 93.18 | |
| d1u6gc_ | 1207 | Cullin-associated NEDD8-dissociated protein 1 (Tip | 92.92 | |
| d1qgra_ | 876 | Importin beta {Human (Homo sapiens) [TaxId: 9606]} | 92.22 | |
| d1wa5c_ | 959 | Exportin Cse1p {Baker's yeast (Saccharomyces cerev | 92.2 | |
| d1q1sc_ | 434 | Importin alpha {Mouse (Mus musculus) [TaxId: 10090 | 92.08 | |
| d2vgla_ | 584 | Adaptin alpha C subunit N-terminal fragment {Mouse | 91.76 | |
| d1oyza_ | 276 | Hypothetical protein YibA {Escherichia coli [TaxId | 91.67 | |
| d1xqra1 | 264 | Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi | 91.08 | |
| d1u6gc_ | 1207 | Cullin-associated NEDD8-dissociated protein 1 (Tip | 90.65 | |
| d1xm9a1 | 457 | Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | 90.35 | |
| d1qgra_ | 876 | Importin beta {Human (Homo sapiens) [TaxId: 9606]} | 89.98 | |
| d1q1sc_ | 434 | Importin alpha {Mouse (Mus musculus) [TaxId: 10090 | 89.81 | |
| d1jdha_ | 529 | beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | 88.47 | |
| d1jdha_ | 529 | beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | 83.83 | |
| d1wa5b_ | 503 | Karyopherin alpha {Baker's yeast (Saccharomyces ce | 83.59 |
| >d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: ARM repeat family: HEAT repeat domain: Constant regulatory domain of protein phosphatase 2a, pr65alpha species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.26 E-value=5e-12 Score=99.68 Aligned_cols=76 Identities=53% Similarity=0.782 Sum_probs=72.1
Q ss_pred hhHHHHHHHHHHHHHHHhhhChhHHhHhHHHHHhhhcCCCCcchhHHHHHHHHHhcccccchhhhhcHHHHHHhhh
Q psy14017 39 ESAEIRRIPQKYSSQIAEACGPTVTANFLLPTVLNMAGDNVANVRFNVAKTLQKIGPILETNVIQSQVKPALDKLN 114 (115)
Q Consensus 39 ~s~~VR~t~l~aI~~La~~l~~eii~~~ILPivl~L~kD~VPNVRfNVAK~L~~Ia~~l~~~~v~s~IkP~L~kL~ 114 (115)
.+..+|+++++|+..+++.++.+.+.++++|.++++++|++||||++++|+|..+.+.++.+.+++.++|+|++|.
T Consensus 492 ~~~~~R~~~~~~l~~l~~~~~~~~~~~~ilp~ll~~~~D~v~nVR~~a~~~l~~i~~~~~~~~~~~~i~~~l~~L~ 567 (588)
T d1b3ua_ 492 PNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLT 567 (588)
T ss_dssp SCHHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHGGGCSCHHHHHHHHHHHHHHGGGSCHHHHHHHHHHHHHHHT
T ss_pred CCHHHHHHHHHHHHHHHHHcChHHHHHHHHHHHHHHcCCCCHHHHHHHHHHHHHHHHHcCcHhHHHHHHHHHHHHc
Confidence 3568999999999999999999999999999999999999999999999999999999999999999999999885
|
| >d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|