Psyllid ID: psy14212


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-
MEELFLHHPHNHLLHQRYADILYTQGGLENIELAISHYLMAINLNEKNIRALYGLALSCHQVLTSAKCSAAKKKEISKQMMWVSKHLARQYEEQQGNTETLTELMSALQVS
cccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccc
ccEEEEcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccc
meelflhhphnhllHQRYADILYTQGGLENIELAISHYLMAINLNEKNIRALYGLALSCHQVLTSAKCSAAKKKEISKQMMWVSKHLARQYEEQQGNTETLTELMSALQVS
MEELFLHHPHNHLLHQRYADILYTQGGLENIELAISHYLMAINLNEKNIRALYGLALSCHQVLTSAKCSAAKKKEISKQMMWVSKHLARQYeeqqgnteTLTELMSALQVS
MEElflhhphnhllhQRYADILYTQGGLENIELAISHYLMAINLNEKNIRALYGLALSCHQVLTSAKCSAAKKKEISKQMMWVSKHLARQYEEQQGNTETLTELMSALQVS
****FLHHPHNHLLHQRYADILYTQGGLENIELAISHYLMAINLNEKNIRALYGLALSCHQVLTSAKCSAA*******QMMWVS***************************
MEELFLHHPHNHLLHQRYADILYTQGGLENIELAISHYLMAINLNEKNIRALYGLALSC********************MMWVSKHL*****************MSALQV*
MEELFLHHPHNHLLHQRYADILYTQGGLENIELAISHYLMAINLNEKNIRALYGLALSCHQVLTSAKCSAAKKKEISKQMMWVSKHLARQYEEQQGNTETLTELMSALQVS
MEELFLHHPHNHLLHQRYADILYTQGGLENIELAISHYLMAINLNEKNIRALYGLALSCHQVLTSAKCS*AKKKEISKQMMWVSKHLARQYEEQQGNTETLTELMSALQVS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEELFLHHPHNHLLHQRYADILYTQGGLENIELAISHYLMAINLNEKNIRALYGLALSCHQVLTSAKCSAAKKKEISKQMMWVSKHLARQYEEQQGNTETLTELMSALQVS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query111 2.2.26 [Sep-21-2011]
Q6TGY8297 ER membrane protein compl yes N/A 1.0 0.373 0.381 4e-19
Q5R882297 ER membrane protein compl yes N/A 1.0 0.373 0.364 4e-18
Q15006297 ER membrane protein compl yes N/A 1.0 0.373 0.364 4e-18
B0BNG0297 ER membrane protein compl yes N/A 1.0 0.373 0.355 7e-18
Q9CRD2297 ER membrane protein compl yes N/A 1.0 0.373 0.364 8e-18
Q5M7J9297 ER membrane protein compl yes N/A 1.0 0.373 0.347 3e-17
Q6INS3297 ER membrane protein compl N/A N/A 1.0 0.373 0.347 3e-17
Q5E993297 ER membrane protein compl yes N/A 1.0 0.373 0.347 5e-17
Q8AVU9297 ER membrane protein compl N/A N/A 1.0 0.373 0.338 1e-16
>sp|Q6TGY8|EMC2_DANRE ER membrane protein complex subunit 2 OS=Danio rerio GN=emc2 PE=2 SV=1 Back     alignment and function desciption
 Score = 93.2 bits (230), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 75/118 (63%), Gaps = 7/118 (5%)

Query: 1   MEELFLHHPHNHLLHQRYADILYTQGGLENIELAISHYLMAINLNEKNIRALYGLALSCH 60
           +EEL + +PHNHL  ++YA++ YTQGGLEN+ELA  ++  A+ LN +N+RAL+GL +S  
Sbjct: 178 LEELMMTNPHNHLYCEQYAEVKYTQGGLENLELARKYFAQALKLNNRNMRALFGLYMSAS 237

Query: 61  QVLTSAKCSAAKKKEISKQMMWVSKHLARQYE-------EQQGNTETLTELMSALQVS 111
            +  S K SA  KK+  K   W +  ++R Y+       E + + + + E++ +LQ++
Sbjct: 238 HIAASPKVSAKVKKDNVKYAAWAAAQISRAYQMAGRGKKENKCSVKAVEEMLESLQIT 295





Danio rerio (taxid: 7955)
>sp|Q5R882|EMC2_PONAB ER membrane protein complex subunit 2 OS=Pongo abelii GN=EMC2 PE=2 SV=1 Back     alignment and function description
>sp|Q15006|EMC2_HUMAN ER membrane protein complex subunit 2 OS=Homo sapiens GN=EMC2 PE=1 SV=1 Back     alignment and function description
>sp|B0BNG0|EMC2_RAT ER membrane protein complex subunit 2 OS=Rattus norvegicus GN=Emc2 PE=2 SV=1 Back     alignment and function description
>sp|Q9CRD2|EMC2_MOUSE ER membrane protein complex subunit 2 OS=Mus musculus GN=Emc2 PE=2 SV=1 Back     alignment and function description
>sp|Q5M7J9|EMC2_XENTR ER membrane protein complex subunit 2 OS=Xenopus tropicalis GN=emc2 PE=2 SV=1 Back     alignment and function description
>sp|Q6INS3|EMC2A_XENLA ER membrane protein complex subunit 2-A OS=Xenopus laevis GN=emc2-a PE=2 SV=1 Back     alignment and function description
>sp|Q5E993|EMC2_BOVIN ER membrane protein complex subunit 2 OS=Bos taurus GN=EMC2 PE=2 SV=1 Back     alignment and function description
>sp|Q8AVU9|EMC2B_XENLA ER membrane protein complex subunit 2-B OS=Xenopus laevis GN=emc2-b PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query111
91077750 278 PREDICTED: similar to CG17556 CG17556-PA 0.981 0.392 0.558 2e-27
307199386 1367 Tetratricopeptide repeat protein 35-B [H 0.990 0.080 0.508 9e-26
225718804 289 Tetratricopeptide repeat protein 35 [Cal 0.837 0.321 0.559 2e-24
307177773 289 Tetratricopeptide repeat protein 35-B [C 0.990 0.380 0.491 5e-24
290462971 290 Tetratricopeptide repeat protein 35 [Lep 0.837 0.320 0.548 2e-23
332019332 289 Tetratricopeptide repeat protein 35-B [A 0.990 0.380 0.473 4e-23
156550299 291 PREDICTED: tetratricopeptide repeat prot 0.990 0.378 0.482 8e-23
332375893 275 unknown [Dendroctonus ponderosae] 0.837 0.338 0.569 4e-22
350412349 289 PREDICTED: tetratricopeptide repeat prot 0.918 0.352 0.480 8e-22
48102403 289 PREDICTED: tetratricopeptide repeat prot 0.846 0.325 0.5 3e-21
>gi|91077750|ref|XP_966972.1| PREDICTED: similar to CG17556 CG17556-PA [Tribolium castaneum] gi|270002222|gb|EEZ98669.1| hypothetical protein TcasGA2_TC001201 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 62/111 (55%), Positives = 78/111 (70%), Gaps = 2/111 (1%)

Query: 1   MEELFLHHPHNHLLHQRYADILYTQGGLENIELAISHYLMAINLNEKNIRALYGLALSCH 60
           +EEL LH+PHNHLLHQRYADI YTQGGLENIELA S+Y  AI LN KN+RALYGL ++  
Sbjct: 170 VEELILHNPHNHLLHQRYADIKYTQGGLENIELARSYYCQAIKLNPKNVRALYGLYIATT 229

Query: 61  QVLTSAKCSAAKKKEISKQMMWVSKHLARQYEEQQGNTETLTELMSALQVS 111
            + TSAKCS+ KKKE  K   W    +  QY  +  N + + + + ALQ++
Sbjct: 230 AIATSAKCSSQKKKEAQKLSEWALNEIQNQY--KHSNIDDIEDRLGALQIN 278




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|307199386|gb|EFN80011.1| Tetratricopeptide repeat protein 35-B [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|225718804|gb|ACO15248.1| Tetratricopeptide repeat protein 35 [Caligus clemensi] Back     alignment and taxonomy information
>gi|307177773|gb|EFN66770.1| Tetratricopeptide repeat protein 35-B [Camponotus floridanus] Back     alignment and taxonomy information
>gi|290462971|gb|ADD24533.1| Tetratricopeptide repeat protein 35 [Lepeophtheirus salmonis] gi|290561284|gb|ADD38044.1| Tetratricopeptide repeat protein 35 [Lepeophtheirus salmonis] Back     alignment and taxonomy information
>gi|332019332|gb|EGI59838.1| Tetratricopeptide repeat protein 35-B [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|156550299|ref|XP_001603293.1| PREDICTED: tetratricopeptide repeat protein 35-A-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|332375893|gb|AEE63087.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|350412349|ref|XP_003489615.1| PREDICTED: tetratricopeptide repeat protein 35-B-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|48102403|ref|XP_395349.1| PREDICTED: tetratricopeptide repeat protein 35-B-like [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query111
ZFIN|ZDB-GENE-040625-82297 emc2 "ER membrane protein comp 0.864 0.323 0.359 1.1e-14
UNIPROTKB|E1BRW7297 TTC35 "Uncharacterized protein 0.864 0.323 0.339 7.5e-14
UNIPROTKB|Q15006297 EMC2 "ER membrane protein comp 0.864 0.323 0.339 7.5e-14
UNIPROTKB|F1S1G1297 EMC2 "Uncharacterized protein" 0.864 0.323 0.339 7.5e-14
UNIPROTKB|Q5R882297 EMC2 "ER membrane protein comp 0.864 0.323 0.339 7.5e-14
MGI|MGI:1913986297 Emc2 "ER membrane protein comp 0.864 0.323 0.339 9.9e-14
UNIPROTKB|Q5E993297 EMC2 "ER membrane protein comp 0.864 0.323 0.330 1.7e-13
RGD|1310430297 Emc2 "ER membrane protein comp 0.864 0.323 0.330 1.7e-13
UNIPROTKB|Q5M7J9297 emc2 "ER membrane protein comp 0.783 0.292 0.386 1.1e-12
UNIPROTKB|Q6INS3297 emc2-a "ER membrane protein co 0.783 0.292 0.386 1.1e-12
ZFIN|ZDB-GENE-040625-82 emc2 "ER membrane protein complex subunit 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 188 (71.2 bits), Expect = 1.1e-14, P = 1.1e-14
 Identities = 37/103 (35%), Positives = 64/103 (62%)

Query:    16 QRYADILYTQGGLENIELAISHYLMAINLNEKNIRALYGLALSCHQVLTSAKCSAAKKKE 75
             ++YA++ YTQGGLEN+ELA  ++  A+ LN +N+RAL+GL +S   +  S K SA  KK+
Sbjct:   193 EQYAEVKYTQGGLENLELARKYFAQALKLNNRNMRALFGLYMSASHIAASPKVSAKVKKD 252

Query:    76 ISKQMMWVSKHLARQYE-------EQQGNTETLTELMSALQVS 111
               K   W +  ++R Y+       E + + + + E++ +LQ++
Sbjct:   253 NVKYAAWAAAQISRAYQMAGRGKKENKCSVKAVEEMLESLQIT 295




GO:0008150 "biological_process" evidence=ND
GO:0005737 "cytoplasm" evidence=IEA;ISS
GO:0005783 "endoplasmic reticulum" evidence=ISS
GO:0072546 "ER membrane protein complex" evidence=ISS
GO:0005634 "nucleus" evidence=IEA
UNIPROTKB|E1BRW7 TTC35 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q15006 EMC2 "ER membrane protein complex subunit 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S1G1 EMC2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R882 EMC2 "ER membrane protein complex subunit 2" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
MGI|MGI:1913986 Emc2 "ER membrane protein complex subunit 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q5E993 EMC2 "ER membrane protein complex subunit 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1310430 Emc2 "ER membrane protein complex subunit 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5M7J9 emc2 "ER membrane protein complex subunit 2" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|Q6INS3 emc2-a "ER membrane protein complex subunit 2-A" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 111
KOG3060|consensus289 99.97
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.88
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.85
PRK15359144 type III secretion system chaperone protein SscB; 97.71
PF1337173 TPR_9: Tetratricopeptide repeat 97.59
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.57
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.47
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.38
PF1342844 TPR_14: Tetratricopeptide repeat 97.35
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.34
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 97.33
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.31
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.14
PRK15359144 type III secretion system chaperone protein SscB; 97.12
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.1
PRK10370198 formate-dependent nitrite reductase complex subuni 97.05
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.05
PRK10370198 formate-dependent nitrite reductase complex subuni 96.95
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.94
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.9
PRK12370 553 invasion protein regulator; Provisional 96.87
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 96.76
PRK11189 296 lipoprotein NlpI; Provisional 96.72
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 96.69
PRK02603172 photosystem I assembly protein Ycf3; Provisional 96.63
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 96.62
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 96.6
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.51
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 96.33
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 96.29
PF1343134 TPR_17: Tetratricopeptide repeat 96.27
cd00189100 TPR Tetratricopeptide repeat domain; typically con 96.18
PRK12370553 invasion protein regulator; Provisional 96.17
PRK11189296 lipoprotein NlpI; Provisional 96.09
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 95.93
KOG1155|consensus559 95.88
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 95.84
KOG1125|consensus579 95.77
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 95.72
PF06552186 TOM20_plant: Plant specific mitochondrial import r 95.62
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 95.6
CHL00033168 ycf3 photosystem I assembly protein Ycf3 95.53
KOG1126|consensus638 95.49
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 95.27
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 95.09
KOG0553|consensus304 95.03
PF06552186 TOM20_plant: Plant specific mitochondrial import r 94.7
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 94.7
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 94.62
KOG1127|consensus 1238 94.53
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 94.4
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 94.4
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 94.19
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 94.04
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 93.94
KOG1173|consensus611 93.9
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 93.86
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 93.84
PRK10747398 putative protoheme IX biogenesis protein; Provisio 93.84
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 93.81
KOG0553|consensus304 93.77
PF1337173 TPR_9: Tetratricopeptide repeat 93.62
KOG2076|consensus 895 93.59
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 93.53
KOG4626|consensus 966 93.43
PRK10803263 tol-pal system protein YbgF; Provisional 93.31
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 93.26
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 92.95
PF1343134 TPR_17: Tetratricopeptide repeat 92.93
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 92.77
KOG1173|consensus 611 92.76
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 92.55
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 91.79
KOG1174|consensus564 91.71
PLN02789320 farnesyltranstransferase 91.35
PRK11788 389 tetratricopeptide repeat protein; Provisional 91.16
KOG1155|consensus559 90.76
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 90.54
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 90.41
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 90.39
PRK02603172 photosystem I assembly protein Ycf3; Provisional 90.39
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 90.35
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 90.23
PLN02789 320 farnesyltranstransferase 89.82
PRK15331165 chaperone protein SicA; Provisional 89.55
PRK10153517 DNA-binding transcriptional activator CadC; Provis 89.35
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 89.02
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 88.78
PRK11788389 tetratricopeptide repeat protein; Provisional 88.13
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 87.94
KOG4626|consensus 966 87.86
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 87.33
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 86.41
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 86.13
PRK10153517 DNA-binding transcriptional activator CadC; Provis 86.03
PF02064121 MAS20: MAS20 protein import receptor; InterPro: IP 86.0
KOG1126|consensus638 85.78
PRK10747 398 putative protoheme IX biogenesis protein; Provisio 85.46
PRK14574 822 hmsH outer membrane protein; Provisional 85.41
KOG0624|consensus504 84.92
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 84.13
PRK15331165 chaperone protein SicA; Provisional 84.09
PF13512142 TPR_18: Tetratricopeptide repeat 83.58
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 83.08
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 82.88
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 82.05
PRK11906458 transcriptional regulator; Provisional 81.85
COG4235287 Cytochrome c biogenesis factor [Posttranslational 81.83
PRK14574 822 hmsH outer membrane protein; Provisional 81.77
CHL00033168 ycf3 photosystem I assembly protein Ycf3 81.32
PRK11906458 transcriptional regulator; Provisional 80.84
KOG0543|consensus397 80.77
smart0067136 SEL1 Sel1-like repeats. These represent a subfamil 80.17
>KOG3060|consensus Back     alignment and domain information
Probab=99.97  E-value=3.7e-31  Score=209.27  Aligned_cols=111  Identities=35%  Similarity=0.565  Sum_probs=101.3

Q ss_pred             CccchhcCCCCHHHHHHHHHHHHhcCCcccHHHHHHHHHHHhccCCCchHHHHhHHHHHHHHHhhhhhhhhhHHh--HHH
Q psy14212          1 MEELFLHHPHNHLLHQRYADILYTQGGLENIELAISHYLMAINLNEKNIRALYGLALSCHQVLTSAKCSAAKKKE--ISK   78 (111)
Q Consensus         1 ~EEvlL~~P~n~~~h~rlAEi~Yt~Gg~enl~~A~kyf~~aleL~~~~lRalyGL~l~~~~l~~~~k~~~~~~~e--~~k   78 (111)
                      ||||+|++|+||.||+||||++||+||.||++.||||||+||++||.|+|||||+++|+++|.+.+|...+++++  ..+
T Consensus       177 lEE~ll~~P~n~l~f~rlae~~Yt~gg~eN~~~arkyy~~alkl~~~~~ral~GI~lc~~~la~~sk~~~k~~K~~a~~~  256 (289)
T KOG3060|consen  177 LEELLLIQPFNPLYFQRLAEVLYTQGGAENLELARKYYERALKLNPKNLRALFGIYLCGSALAQISKAELKRKKDVAAPD  256 (289)
T ss_pred             HHHHHHcCCCcHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHhChHhHHHHHHHHHHHHHHHHHhHHHHhhhhhhhhhh
Confidence            699999999999999999999999999999999999999999999999999999999999999999888877777  569


Q ss_pred             HHHHHHHHHHHHHHhhcCChhHHHHHHhhccCC
Q psy14212         79 QMMWVSKHLARQYEEQQGNTETLTELMSALQVS  111 (111)
Q Consensus        79 L~~~A~~~L~~~Y~~~~~~~~~~~~~l~~~~~~  111 (111)
                      +..||..++.++|+...+++..++++|..++|+
T Consensus       257 l~~~aas~l~r~~q~s~~~~d~i~~~l~~lKi~  289 (289)
T KOG3060|consen  257 LISLAASQLERISQKSKNKLDLITAALENLKIT  289 (289)
T ss_pred             HHHhHHHHHHHHHHhccchhhHHHHHHHHhccC
Confidence            999999999999944333344899999999885



>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1155|consensus Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG1125|consensus Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG1126|consensus Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG0553|consensus Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG1127|consensus Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG1173|consensus Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG0553|consensus Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG2076|consensus Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG4626|consensus Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG1173|consensus Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1174|consensus Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG1155|consensus Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG4626|consensus Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF02064 MAS20: MAS20 protein import receptor; InterPro: IPR002056 Virtually all mitochondrial precursors are imported via the same mechanism []: precursors first bind to receptors on the mitochondrial surface, then insert into the translocation channel in the outer membrane Back     alignment and domain information
>KOG1126|consensus Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG0543|consensus Back     alignment and domain information
>smart00671 SEL1 Sel1-like repeats Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query111
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.19
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.18
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.18
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.18
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.13
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.11
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.11
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.1
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.05
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.03
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.98
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.98
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 97.96
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 97.95
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.95
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.93
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 97.91
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.84
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 97.84
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 97.8
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 97.8
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.79
3k9i_A117 BH0479 protein; putative protein binding protein, 97.79
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 97.79
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 97.72
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.71
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.71
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.7
4i17_A228 Hypothetical protein; TPR repeats protein, structu 97.7
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.68
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.68
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 97.66
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.66
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 97.65
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 97.62
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 97.62
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 97.61
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.6
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 97.6
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.58
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.57
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 97.54
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 97.54
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 97.52
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.51
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 97.5
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.49
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.48
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.47
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 97.45
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 97.45
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 97.43
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 97.41
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.4
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 97.39
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.38
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 97.38
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.37
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.35
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 97.32
4i17_A228 Hypothetical protein; TPR repeats protein, structu 97.31
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.3
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 97.29
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 97.27
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 97.26
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.25
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 97.25
4eqf_A365 PEX5-related protein; accessory protein, tetratric 97.24
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 97.23
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 97.22
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 97.22
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 97.21
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 97.19
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 97.16
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.16
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 97.15
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 97.14
3u4t_A272 TPR repeat-containing protein; structural genomics 97.11
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 97.09
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 97.07
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 97.06
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 97.05
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 97.05
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 97.04
3u4t_A272 TPR repeat-containing protein; structural genomics 97.03
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.02
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.0
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.99
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 96.99
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 96.96
2l6j_A111 TPR repeat-containing protein associated with HSP; 96.93
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 96.92
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 96.91
3k9i_A117 BH0479 protein; putative protein binding protein, 96.91
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 96.9
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 96.89
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 96.88
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 96.87
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 96.87
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 96.86
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 96.85
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 96.85
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 96.84
2gw1_A 514 Mitochondrial precursor proteins import receptor; 96.84
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 96.84
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 96.83
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 96.82
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 96.82
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 96.8
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 96.78
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 96.77
3qky_A 261 Outer membrane assembly lipoprotein YFIO; membrane 96.76
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 96.74
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 96.72
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 96.72
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 96.72
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 96.71
4g1t_A 472 Interferon-induced protein with tetratricopeptide 96.65
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.64
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 96.63
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 96.63
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 96.59
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 96.56
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 96.54
2ond_A 308 Cleavage stimulation factor 77 kDa subunit; HAT do 96.51
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 96.46
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 96.45
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 96.44
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 96.41
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.35
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 96.35
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 96.35
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 96.32
4g1t_A 472 Interferon-induced protein with tetratricopeptide 96.06
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 95.95
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 95.88
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 95.86
2gw1_A514 Mitochondrial precursor proteins import receptor; 95.86
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 95.84
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 95.83
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 95.81
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 95.55
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.53
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 95.24
2ooe_A 530 Cleavage stimulation factor 77 kDa subunit; HAT do 95.06
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 95.02
2ooe_A 530 Cleavage stimulation factor 77 kDa subunit; HAT do 95.02
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 94.57
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 94.5
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 93.98
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 93.94
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 93.9
1ouv_A 273 Conserved hypothetical secreted protein; TPR repea 93.84
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 93.19
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 93.01
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 92.93
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 92.91
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 92.72
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 92.43
3nf1_A 311 KLC 1, kinesin light chain 1; TPR, structural geno 91.82
3dra_A 306 Protein farnesyltransferase/geranylgeranyltransfer 90.94
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 90.84
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 90.75
1ouv_A 273 Conserved hypothetical secreted protein; TPR repea 90.62
3ax2_A73 Mitochondrial import receptor subunit TOM20 homol; 90.53
1om2_A95 Protein (mitochondrial import receptor subunit TOM 90.45
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 90.34
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 90.24
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 90.05
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 89.61
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 88.58
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 88.42
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 87.91
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 87.74
3ulq_A 383 Response regulator aspartate phosphatase F; tetrat 87.43
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 86.82
3u3w_A293 Transcriptional activator PLCR protein; ternary co 86.6
3q15_A378 PSP28, response regulator aspartate phosphatase H; 86.37
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 85.62
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 85.48
3u3w_A293 Transcriptional activator PLCR protein; ternary co 85.43
3q7a_A 349 Farnesyltransferase alpha subunit; protein prenylt 85.11
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 84.3
3q15_A378 PSP28, response regulator aspartate phosphatase H; 83.38
1klx_A138 Cysteine rich protein B; structural genomics, heli 82.97
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 82.54
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 82.52
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 82.48
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 82.32
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 81.67
3dss_A 331 Geranylgeranyl transferase type-2 subunit alpha; p 81.63
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 81.02
2uy1_A 493 Cleavage stimulation factor 77; RNA-binding protei 80.83
3mv2_B 310 Coatomer subunit epsilon; vesicular membrane coat 80.76
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
Probab=98.19  E-value=2.3e-06  Score=56.95  Aligned_cols=62  Identities=19%  Similarity=0.137  Sum_probs=56.4

Q ss_pred             CccchhcCCCCHHHHHHHHHHHHhcCCcccHHHHHHHHHHHhccCCCchHHHHhHHHHHHHHHhh
Q psy14212          1 MEELFLHHPHNHLLHQRYADILYTQGGLENIELAISHYLMAINLNEKNIRALYGLALSCHQVLTS   65 (111)
Q Consensus         1 ~EEvlL~~P~n~~~h~rlAEi~Yt~Gg~enl~~A~kyf~~aleL~~~~lRalyGL~l~~~~l~~~   65 (111)
                      |+++|-++|.++..|..+|.+++-+|   +++.|+.+|.++|+++|++..+++.+-.|-..+.+.
T Consensus        36 ~~~al~~~p~~~~~~~~~~~~~~~~~---~~~~A~~~~~~al~~~p~~~~a~~~lg~~~~~~~~~   97 (126)
T 4gco_A           36 YNEAVKRDPENAILYSNRAACLTKLM---EFQRALDDCDTCIRLDSKFIKGYIRKAACLVAMREW   97 (126)
T ss_dssp             HHHHHHHCTTCHHHHHHHHHHHHHTT---CHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCH
T ss_pred             HHHHHHhCCCCHHHHHHHhhHHHhhc---cHHHHHHHHHHHHHhhhhhhHHHHHHHHHHHHCCCH
Confidence            35788899999999999999999999   999999999999999999999999998888776543



>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ax2_A Mitochondrial import receptor subunit TOM20 homol; protein-protein complex, membrane protein-transport protein; 1.90A {Rattus norvegicus} PDB: 2v1s_A 3awr_A 2v1t_A 3ax5_A 3ax3_A Back     alignment and structure
>1om2_A Protein (mitochondrial import receptor subunit TOM20); mitochondrial protein import across outer membrane, receptor for presequences; NMR {Rattus norvegicus} SCOP: a.23.4.1 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query111
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.4
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.3
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.25
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.22
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.12
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.08
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 97.99
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.93
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 97.87
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.86
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.8
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.78
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.78
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.78
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.75
d1w3ba_ 388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 97.74
d1fcha_ 323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.7
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.69
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 97.65
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.53
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.45
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 97.37
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 97.36
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.35
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.3
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.3
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 97.15
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 96.82
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.78
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 96.77
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 96.74
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 96.72
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 96.69
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 96.55
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 96.25
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 95.69
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 95.46
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 94.38
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 94.28
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 93.68
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 93.66
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 92.81
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 92.25
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 91.23
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 91.23
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 91.16
d1ouva_ 265 Cysteine rich protein C (HcpC) {Helicobacter pylor 90.41
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 89.41
d2onda1 308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 88.81
d1om2a_95 Mitochondrial import receptor subunit Tom20 {Rat ( 85.36
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 82.02
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 80.47
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: STIP1 homology and U box-containing protein 1, STUB1
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=98.40  E-value=2.2e-07  Score=62.48  Aligned_cols=61  Identities=13%  Similarity=0.107  Sum_probs=55.5

Q ss_pred             CccchhcCCCCHHHHHHHHHHHHhcCCcccHHHHHHHHHHHhccCCCchHHHHhHHHHHHHHHh
Q psy14212          1 MEELFLHHPHNHLLHQRYADILYTQGGLENIELAISHYLMAINLNEKNIRALYGLALSCHQVLT   64 (111)
Q Consensus         1 ~EEvlL~~P~n~~~h~rlAEi~Yt~Gg~enl~~A~kyf~~aleL~~~~lRalyGL~l~~~~l~~   64 (111)
                      |+++|-++|.++.+|..+|.++.-.|   +++.|+++|.+||+++|++..||+.+-.+-.++..
T Consensus        27 ~~kal~~~p~~~~~~~~lg~~y~~~~---~~~~Ai~~~~~al~l~p~~~~a~~~lg~~~~~l~~   87 (201)
T d2c2la1          27 YGRAITRNPLVAVYYTNRALCYLKMQ---QPEQALADCRRALELDGQSVKAHFFLGQCQLEMES   87 (201)
T ss_dssp             HHHHHHHCSCCHHHHHHHHHHHHHTT---CHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHHTTC
T ss_pred             HHHHHHhCCCCHHHHHhHHHHHhhhh---hhhhhhHHHHHHHHhCCCcHHHHHHHHHHHHHCCC
Confidence            35788899999999999999999999   99999999999999999999999998888776543



>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1om2a_ a.23.4.1 (A:) Mitochondrial import receptor subunit Tom20 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure