Psyllid ID: psy14271

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60-----
MSYKKNPKLLDQLQYCEDNQIHWCIVIGQSELASNSVKLRNVLTREEETISRDKLLDTLQEKLKE
ccccccccHHHHHHHHHHccccEEEEEcHHHHHccEEEEEEcccccEEEEcHHHHHHHHHHHHHc
ccccccHHHHHHHHHHHHccccEEEEEcHHHHHcccEEEEEEcccccEEccHHHHHHHHHHHHcc
msykknpklldqLQYCEDNQIHWCIVIGQSELASNSVKLRNVLTREEETISRDKLLDTLQEKLKE
msykknpkLLDQLQYCEDNQIHWCIVIGqselasnsVKLRNvltreeetisrdklldtlqeklke
MSYKKNPKLLDQLQYCEDNQIHWCIVIGQSELASNSVKLRNVLTREEETISRDKLLDTLQEKLKE
********LLDQLQYCEDNQIHWCIVIGQSELASNSVKLRNV***********************
******PKLLDQLQYCEDNQIHWCIVIGQSELASNSVKLRNVLTREEETISRDKLLDTLQEKLK*
MSYKKNPKLLDQLQYCEDNQIHWCIVIGQSELASNSVKLRNVLTREEETISRDKLLDTLQEKLKE
*SYKKNPKLLDQLQYCEDNQIHWCIVIGQSELASNSVKLRNVLTREEETISRDKLLDTLQEKLK*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooo
oooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSYKKNPKLLDQLQYCEDNQIHWCIVIGQSELASNSVKLRNVLTREEETISRDKLLDTLQEKLKE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query65 2.2.26 [Sep-21-2011]
Q5R5E5506 Probable histidine--tRNA yes N/A 1.0 0.128 0.461 1e-10
P34183521 Histidine--tRNA ligase OS yes N/A 0.969 0.120 0.507 2e-10
A5D7V9506 Probable histidine--tRNA yes N/A 1.0 0.128 0.461 2e-10
Q99KK9505 Probable histidine--tRNA yes N/A 1.0 0.128 0.476 2e-10
P49590506 Probable histidine--tRNA yes N/A 1.0 0.128 0.446 5e-10
Q2KI84509 Histidine--tRNA ligase, c no N/A 0.923 0.117 0.466 5e-10
Q61035509 Histidine--tRNA ligase, c no N/A 0.923 0.117 0.466 7e-10
P12081509 Histidine--tRNA ligase, c no N/A 0.923 0.117 0.466 8e-10
Q5R4R2509 Histidine--tRNA ligase, c no N/A 0.923 0.117 0.466 8e-10
P07178508 Histidine--tRNA ligase, c N/A N/A 0.923 0.118 0.466 1e-09
>sp|Q5R5E5|SYHM_PONAB Probable histidine--tRNA ligase, mitochondrial OS=Pongo abelii GN=HARS2 PE=2 SV=1 Back     alignment and function desciption
 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 42/65 (64%)

Query: 1   MSYKKNPKLLDQLQYCEDNQIHWCIVIGQSELASNSVKLRNVLTREEETISRDKLLDTLQ 60
           M YK NPKLL QL YCE   I   ++IG+ EL    +K+R+V +REE  I R+ L+  +Q
Sbjct: 441 MLYKNNPKLLTQLHYCESTGIPLVVIIGEQELKEGVIKIRSVASREEVAIKRENLVAEIQ 500

Query: 61  EKLKE 65
           ++L E
Sbjct: 501 KRLSE 505

Pongo abelii (taxid: 9601)
EC: 6EC: .EC: 1EC: .EC: 1EC: .EC: 2EC: 1
>sp|P34183|SYH_CAEEL Histidine--tRNA ligase OS=Caenorhabditis elegans GN=hrs-1 PE=2 SV=3 Back     alignment and function description
>sp|A5D7V9|SYHM_BOVIN Probable histidine--tRNA ligase, mitochondrial OS=Bos taurus GN=HARS2 PE=2 SV=1 Back     alignment and function description
>sp|Q99KK9|SYHM_MOUSE Probable histidine--tRNA ligase, mitochondrial OS=Mus musculus GN=Hars2 PE=2 SV=1 Back     alignment and function description
>sp|P49590|SYHM_HUMAN Probable histidine--tRNA ligase, mitochondrial OS=Homo sapiens GN=HARS2 PE=1 SV=1 Back     alignment and function description
>sp|Q2KI84|SYHC_BOVIN Histidine--tRNA ligase, cytoplasmic OS=Bos taurus GN=HARS PE=2 SV=1 Back     alignment and function description
>sp|Q61035|SYHC_MOUSE Histidine--tRNA ligase, cytoplasmic OS=Mus musculus GN=Hars PE=2 SV=2 Back     alignment and function description
>sp|P12081|SYHC_HUMAN Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens GN=HARS PE=1 SV=2 Back     alignment and function description
>sp|Q5R4R2|SYHC_PONAB Histidine--tRNA ligase, cytoplasmic OS=Pongo abelii GN=HARS PE=2 SV=1 Back     alignment and function description
>sp|P07178|SYHC_MESAU Histidine--tRNA ligase, cytoplasmic OS=Mesocricetus auratus GN=HARS PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query65
321455063 525 hypothetical protein DAPPUDRAFT_219129 [ 0.969 0.12 0.619 1e-13
332375783 518 unknown [Dendroctonus ponderosae] 0.984 0.123 0.578 1e-13
225714138 518 Histidyl-tRNA synthetase, cytoplasmic [L 0.984 0.123 0.515 3e-12
260786598 472 hypothetical protein BRAFLDRAFT_114648 [ 0.969 0.133 0.523 2e-11
260780861 515 hypothetical protein BRAFLDRAFT_274629 [ 0.969 0.122 0.523 2e-11
170062845 521 histidyl-tRNA synthetase [Culex quinquef 0.953 0.119 0.564 2e-11
391334792 511 PREDICTED: histidine--tRNA ligase, cytop 0.953 0.121 0.532 3e-11
346468155 507 hypothetical protein [Amblyomma maculatu 0.969 0.124 0.571 3e-11
198434351 506 PREDICTED: similar to LOC445827 protein 0.984 0.126 0.453 4e-11
224068279 441 PREDICTED: histidine--tRNA ligase, cytop 0.984 0.145 0.531 6e-11
>gi|321455063|gb|EFX66208.1| hypothetical protein DAPPUDRAFT_219129 [Daphnia pulex] Back     alignment and taxonomy information
 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 39/63 (61%), Positives = 45/63 (71%)

Query: 1   MSYKKNPKLLDQLQYCEDNQIHWCIVIGQSELASNSVKLRNVLTREEETISRDKLLDTLQ 60
           MSYK NPKLL QLQ CE+  I W I+IGQSEL    VKLR+V +R+EE I R KL D L+
Sbjct: 458 MSYKANPKLLGQLQTCEEQGIPWAIIIGQSELEKGVVKLRHVPSRQEEEIERSKLTDVLK 517

Query: 61  EKL 63
            KL
Sbjct: 518 HKL 520

Source: Daphnia pulex

Species: Daphnia pulex

Genus: Daphnia

Family: Daphniidae

Order: Diplostraca

Class: Branchiopoda

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|332375783|gb|AEE63032.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|225714138|gb|ACO12915.1| Histidyl-tRNA synthetase, cytoplasmic [Lepeophtheirus salmonis] Back     alignment and taxonomy information
>gi|260786598|ref|XP_002588344.1| hypothetical protein BRAFLDRAFT_114648 [Branchiostoma floridae] gi|229273505|gb|EEN44355.1| hypothetical protein BRAFLDRAFT_114648 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|260780861|ref|XP_002585554.1| hypothetical protein BRAFLDRAFT_274629 [Branchiostoma floridae] gi|229270558|gb|EEN41565.1| hypothetical protein BRAFLDRAFT_274629 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|170062845|ref|XP_001866846.1| histidyl-tRNA synthetase [Culex quinquefasciatus] gi|167880611|gb|EDS43994.1| histidyl-tRNA synthetase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|391334792|ref|XP_003741784.1| PREDICTED: histidine--tRNA ligase, cytoplasmic-like [Metaseiulus occidentalis] Back     alignment and taxonomy information
>gi|346468155|gb|AEO33922.1| hypothetical protein [Amblyomma maculatum] Back     alignment and taxonomy information
>gi|198434351|ref|XP_002125799.1| PREDICTED: similar to LOC445827 protein [Ciona intestinalis] Back     alignment and taxonomy information
>gi|224068279|ref|XP_002191200.1| PREDICTED: histidine--tRNA ligase, cytoplasmic-like [Taeniopygia guttata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query65
RGD|1308426262 Hars2 "histidyl-tRNA synthetas 1.0 0.248 0.476 1.9e-11
UNIPROTKB|F1NEE7501 HARS "Uncharacterized protein" 0.969 0.125 0.492 8.9e-11
UNIPROTKB|F1ND13504 HARS "Uncharacterized protein" 0.969 0.125 0.492 9e-11
WB|WBGene00002001521 hars-1 [Caenorhabditis elegans 0.969 0.120 0.507 9.6e-11
UNIPROTKB|F1M9C9507 Hars2l "Protein Hars2l" [Rattu 1.0 0.128 0.476 1.2e-10
MGI|MGI:1918041505 Hars2 "histidyl-tRNA synthetas 1.0 0.128 0.476 1.9e-10
UNIPROTKB|B4DQ67334 HARS2 "Probable histidine--tRN 1.0 0.194 0.446 2.2e-10
UNIPROTKB|E2QZ43505 HARS2 "Uncharacterized protein 0.969 0.124 0.492 2.4e-10
UNIPROTKB|A5D7V9506 HARS2 "Probable histidine--tRN 1.0 0.128 0.461 2.5e-10
UNIPROTKB|F1N0T6506 HARS2 "Probable histidine--tRN 1.0 0.128 0.461 2.5e-10
RGD|1308426 Hars2 "histidyl-tRNA synthetase 2, mitochondrial" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 158 (60.7 bits), Expect = 1.9e-11, P = 1.9e-11
 Identities = 31/65 (47%), Positives = 43/65 (66%)

Query:     1 MSYKKNPKLLDQLQYCEDNQIHWCIVIGQSELASNSVKLRNVLTREEETISRDKLLDTLQ 60
             M YK NPKLL QL YCE   I   ++IG+ E     VKLR+V +REE T++R+ L+  +Q
Sbjct:   197 MLYKNNPKLLTQLHYCEKEDIPLMVIIGEQEQNEGVVKLRSVASREEVTVNRESLVAEIQ 256

Query:    61 EKLKE 65
             ++L E
Sbjct:   257 KRLSE 261
GO:0005739 "mitochondrion" evidence=ISO
UNIPROTKB|F1NEE7 HARS "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1ND13 HARS "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
WB|WBGene00002001 hars-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|F1M9C9 Hars2l "Protein Hars2l" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1918041 Hars2 "histidyl-tRNA synthetase 2, mitochondrial (putative)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|B4DQ67 HARS2 "Probable histidine--tRNA ligase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2QZ43 HARS2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|A5D7V9 HARS2 "Probable histidine--tRNA ligase, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1N0T6 HARS2 "Probable histidine--tRNA ligase, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P34183SYH_CAEEL6, ., 1, ., 1, ., 2, 10.50790.96920.1209yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query65
cd0085991 cd00859, HisRS_anticodon, HisRS Histidyl-anticodon 4e-15
COG0124429 COG0124, HisS, Histidyl-tRNA synthetase [Translati 2e-10
pfam0312993 pfam03129, HGTP_anticodon, Anticodon binding domai 4e-09
PRK00037412 PRK00037, hisS, histidyl-tRNA synthetase; Reviewed 1e-08
PLN02972763 PLN02972, PLN02972, Histidyl-tRNA synthetase 7e-08
PRK12420423 PRK12420, PRK12420, histidyl-tRNA synthetase; Prov 3e-04
TIGR00442397 TIGR00442, hisS, histidyl-tRNA synthetase 0.002
cd0086194 cd00861, ProRS_anticodon_short, ProRS Prolyl-antic 0.002
>gnl|CDD|238436 cd00859, HisRS_anticodon, HisRS Histidyl-anticodon binding domain Back     alignment and domain information 
 Score = 62.6 bits (153), Expect = 4e-15
 Identities = 16/56 (28%), Positives = 36/56 (64%)

Query: 5  KNPKLLDQLQYCEDNQIHWCIVIGQSELASNSVKLRNVLTREEETISRDKLLDTLQ 60
             KL  Q +Y + +   + +++G+ ELA+  V ++++ T E+ET++ D+L++ L+
Sbjct: 36 GGRKLKKQFKYADRSGARFAVILGEDELAAGVVTVKDLETGEQETVALDELVEELK 91

HisRS belongs to class II aminoacyl-tRNA synthetases (aaRS). This alignment contains the anticodon binding domain, which is responsible for specificity in tRNA-binding, so that the activated amino acid is transferred to a ribose 3' OH group of the appropriate tRNA only. Length = 91
>gnl|CDD|223202 COG0124, HisS, Histidyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|202547 pfam03129, HGTP_anticodon, Anticodon binding domain Back     alignment and domain information
>gnl|CDD|234586 PRK00037, hisS, histidyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|215525 PLN02972, PLN02972, Histidyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|237097 PRK12420, PRK12420, histidyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|213530 TIGR00442, hisS, histidyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|238438 cd00861, ProRS_anticodon_short, ProRS Prolyl-anticodon binding domain, short version found predominantly in bacteria Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 65
PF0312994 HGTP_anticodon: Anticodon binding domain; InterPro 99.66
cd0086194 ProRS_anticodon_short ProRS Prolyl-anticodon bindi 99.58
cd00858121 GlyRS_anticodon GlyRS Glycyl-anticodon binding dom 99.55
COG0124429 HisS Histidyl-tRNA synthetase [Translation, riboso 99.51
cd0086091 ThrRS_anticodon ThrRS Threonyl-anticodon binding d 99.49
PRK12305575 thrS threonyl-tRNA synthetase; Reviewed 99.48
cd0073894 HGTP_anticodon HGTP anticodon binding domain, as f 99.46
cd00862202 ProRS_anticodon_zinc ProRS Prolyl-anticodon bindin 99.45
PRK14799545 thrS threonyl-tRNA synthetase; Provisional 99.41
TIGR00418563 thrS threonyl-tRNA synthetase. This model represen 99.4
PRK00413638 thrS threonyl-tRNA synthetase; Reviewed 99.4
PRK12444639 threonyl-tRNA synthetase; Reviewed 99.37
KOG1936|consensus518 99.37
TIGR00408472 proS_fam_I prolyl-tRNA synthetase, family I. Proly 99.36
PRK14938387 Ser-tRNA(Thr) hydrolase; Provisional 99.34
PLN02908686 threonyl-tRNA synthetase 99.33
PRK04173456 glycyl-tRNA synthetase; Provisional 99.33
PRK08661477 prolyl-tRNA synthetase; Provisional 99.33
PRK12325439 prolyl-tRNA synthetase; Provisional 99.31
PRK14894539 glycyl-tRNA synthetase; Provisional 99.28
PLN02837614 threonine-tRNA ligase 99.28
CHL00201430 syh histidine-tRNA synthetase; Provisional 99.28
cd02426128 Pol_gamma_b_Cterm C-terminal domain of mitochondri 99.27
PRK03991613 threonyl-tRNA synthetase; Validated 99.27
PRK09194565 prolyl-tRNA synthetase; Provisional 99.25
PLN02972763 Histidyl-tRNA synthetase 99.21
TIGR00389551 glyS_dimeric glycyl-tRNA synthetase, dimeric type. 99.2
PRK00037412 hisS histidyl-tRNA synthetase; Reviewed 99.17
cd0085991 HisRS_anticodon HisRS Histidyl-anticodon binding d 99.1
PLN02530487 histidine-tRNA ligase 99.06
PLN02734684 glycyl-tRNA synthetase 98.97
PRK12420423 histidyl-tRNA synthetase; Provisional 98.94
TIGR00409568 proS_fam_II prolyl-tRNA synthetase, family II. Pro 98.84
COG0423558 GRS1 Glycyl-tRNA synthetase (class II) [Translatio 98.81
COG0441589 ThrS Threonyl-tRNA synthetase [Translation, riboso 98.81
TIGR00442397 hisS histidyl-tRNA synthetase. This model finds a 98.46
PF12745 273 HGTP_anticodon2: Anticodon binding domain of tRNAs 98.09
KOG2298|consensus599 97.74
KOG1637|consensus560 97.65
KOG2324|consensus457 97.51
KOG4163|consensus 551 97.37
COG0442500 ProS Prolyl-tRNA synthetase [Translation, ribosoma 93.9
COG0442 500 ProS Prolyl-tRNA synthetase [Translation, ribosoma 92.81
>PF03129 HGTP_anticodon: Anticodon binding domain; InterPro: IPR004154 tRNA synthetases, or tRNA ligases are involved in protein synthesis Back     alignment and domain information 
Probab=99.66  E-value=2.2e-16  Score=83.25  Aligned_cols=57  Identities=32%  Similarity=0.542  Sum_probs=54.3

Q ss_pred             CCCCHHHHHHHhhhcCCcEEEEEcccccccCeEEEEEcCCCceeeecHHHHHHHHHH
Q psy14271          5 KNPKLLDQLQYCEDNQIHWCIVIGQSELASNSVKLRNVLTREEETISRDKLLDTLQE   61 (65)
Q Consensus         5 ~~~~l~kq~k~A~~~~~~~~vivG~~E~~~~~v~vk~~~~~~~~~~~~~e~~~~i~~   61 (65)
                      .+.++++||++|++.|+||++++|++|.++|++++|++.++++..++++++.+.++.
T Consensus        37 ~~~~~~k~~~~a~~~g~p~~iiiG~~e~~~~~v~vk~~~~~~~~~v~~~el~~~l~~   93 (94)
T PF03129_consen   37 SDKSLGKQIKYADKLGIPFIIIIGEKELENGTVTVKDRDTGEQETVSLEELIEYLKE   93 (94)
T ss_dssp             SSSTHHHHHHHHHHTTESEEEEEEHHHHHTTEEEEEETTTTEEEEEECCHHHHHHHH
T ss_pred             CCCchhHHHHHHhhcCCeEEEEECchhHhCCEEEEEECCCCcEEEEEHHHHHHHHhh
Confidence            478999999999999999999999999999999999999999999999999998864

This domain is found in histidyl, glycyl, threonyl and prolyl tRNA synthetases [] it is probably the anticodon binding domain [].; GO: 0004812 aminoacyl-tRNA ligase activity, 0005524 ATP binding; PDB: 1KOG_B 1EVL_D 1EVK_B 1QF6_A 1FYF_B 2I4O_A 2I4M_A 2I4N_A 2I4L_A 1HC7_D ....
>cd00861 ProRS_anticodon_short ProRS Prolyl-anticodon binding domain, short version found predominantly in bacteria Back     alignment and domain information
>cd00858 GlyRS_anticodon GlyRS Glycyl-anticodon binding domain Back     alignment and domain information
>COG0124 HisS Histidyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00860 ThrRS_anticodon ThrRS Threonyl-anticodon binding domain Back     alignment and domain information
>PRK12305 thrS threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>cd00738 HGTP_anticodon HGTP anticodon binding domain, as found at the C-terminus of histidyl, glycyl, threonyl and prolyl tRNA synthetases, which are classified as a group of class II aminoacyl-tRNA synthetases (aaRS) Back     alignment and domain information
>cd00862 ProRS_anticodon_zinc ProRS Prolyl-anticodon binding domain, long version found predominantly in eukaryotes and archaea Back     alignment and domain information
>PRK14799 thrS threonyl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR00418 thrS threonyl-tRNA synthetase Back     alignment and domain information
>PRK00413 thrS threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12444 threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>KOG1936|consensus Back     alignment and domain information
>TIGR00408 proS_fam_I prolyl-tRNA synthetase, family I Back     alignment and domain information
>PRK14938 Ser-tRNA(Thr) hydrolase; Provisional Back     alignment and domain information
>PLN02908 threonyl-tRNA synthetase Back     alignment and domain information
>PRK04173 glycyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK08661 prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK12325 prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK14894 glycyl-tRNA synthetase; Provisional Back     alignment and domain information
>PLN02837 threonine-tRNA ligase Back     alignment and domain information
>CHL00201 syh histidine-tRNA synthetase; Provisional Back     alignment and domain information
>cd02426 Pol_gamma_b_Cterm C-terminal domain of mitochondrial DNA polymerase gamma B subunit, which is required for processivity Back     alignment and domain information
>PRK03991 threonyl-tRNA synthetase; Validated Back     alignment and domain information
>PRK09194 prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>PLN02972 Histidyl-tRNA synthetase Back     alignment and domain information
>TIGR00389 glyS_dimeric glycyl-tRNA synthetase, dimeric type Back     alignment and domain information
>PRK00037 hisS histidyl-tRNA synthetase; Reviewed Back     alignment and domain information
>cd00859 HisRS_anticodon HisRS Histidyl-anticodon binding domain Back     alignment and domain information
>PLN02530 histidine-tRNA ligase Back     alignment and domain information
>PLN02734 glycyl-tRNA synthetase Back     alignment and domain information
>PRK12420 histidyl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR00409 proS_fam_II prolyl-tRNA synthetase, family II Back     alignment and domain information
>COG0423 GRS1 Glycyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0441 ThrS Threonyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00442 hisS histidyl-tRNA synthetase Back     alignment and domain information
>PF12745 HGTP_anticodon2: Anticodon binding domain of tRNAs; InterPro: IPR024435 This is an anticodon binding domain, found largely on Gcn2 proteins which bind tRNA to down regulate translation in certain stress situations [] Back     alignment and domain information
>KOG2298|consensus Back     alignment and domain information
>KOG1637|consensus Back     alignment and domain information
>KOG2324|consensus Back     alignment and domain information
>KOG4163|consensus Back     alignment and domain information
>COG0442 ProS Prolyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0442 ProS Prolyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query65
4g85_A517 Crystal Structure Of Human Hisrs Length = 517 5e-11
4g84_A464 Crystal Structure Of Human Hisrs Length = 464 6e-11
>pdb|4G85|A Chain A, Crystal Structure Of Human Hisrs Length = 517 Back     alignment and structure 
Iteration: 1

 Score = 62.8 bits (151), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 28/60 (46%), Positives = 42/60 (70%)
Query: 3   YKKNPKLLDQLQYCEDNQIHWCIVIGQSELASNSVKLRNVLTREEETISRDKLLDTLQEK 62
           YKKNPKLL+QLQYCE+  I    +IG+ EL    +KLR+V +REE  + R+ L++ ++ +
Sbjct: 453 YKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRR 512
>pdb|4G84|A Chain A, Crystal Structure Of Human Hisrs Length = 464 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query65
3net_A465 Histidyl-tRNA synthetase; aminoacyl-tRNA synthetas 3e-15
3lc0_A456 Histidyl-tRNA synthetase; tRNA-ligase, aminoacyl-t 2e-11
1wu7_A434 Histidyl-tRNA synthetase; ligase, structural genom 1e-10
1h4v_B421 Histidyl-tRNA synthetase; class IIA aminoacyl-tRNA 5e-09
1htt_A423 Histidyl-tRNA synthetase; complex (tRNA synthetase 1e-08
1qe0_A420 Histidyl-tRNA synthetase; class II tRNA synthetase 3e-08
4e51_A467 Histidine--tRNA ligase; seattle structural genomic 3e-06
>3net_A Histidyl-tRNA synthetase; aminoacyl-tRNA synthetase, ligase, structural genomics, PSI- nostoc, protein structure initiative; 2.70A {Nostoc SP} Length = 465 Back     alignment and structure
 Score = 66.6 bits (163), Expect = 3e-15
 Identities = 13/61 (21%), Positives = 31/61 (50%)

Query: 3   YKKNPKLLDQLQYCEDNQIHWCIVIGQSELASNSVKLRNVLTREEETISRDKLLDTLQEK 62
             +  +L  Q Q  +   I +C++IG  E A+    L+++ + E+  ++   L + ++ +
Sbjct: 404 NFEKRQLGKQFQAADKQGIRFCVIIGADEAAAQKSSLKDLQSGEQVEVALADLAEEIKRR 463

Query: 63  L 63
           L
Sbjct: 464 L 464
>3lc0_A Histidyl-tRNA synthetase; tRNA-ligase, aminoacyl-tRNA synthetase, ligase, structural G medical structural genomics of pathogenic protozoa; HET: HIS; 1.80A {Trypanosoma cruzi} PDB: 3hrk_A* 3hri_A Length = 456 Back     alignment and structure
>1wu7_A Histidyl-tRNA synthetase; ligase, structural genomics, dimer; 2.40A {Thermoplasma acidophilum} SCOP: c.51.1.1 d.104.1.1 Length = 434 Back     alignment and structure
>1h4v_B Histidyl-tRNA synthetase; class IIA aminoacyl-tRNA synthetase, ATP + L-histidine tRNA(His)-> AMP + PPI + L-histidyl-tRNA(His); 2.4A {Thermus thermophilus} SCOP: c.51.1.1 d.104.1.1 PDB: 1ady_A* 1adj_A Length = 421 Back     alignment and structure
>1htt_A Histidyl-tRNA synthetase; complex (tRNA synthetase/His-adenylate), aminoacyl-tRNA synthase, ligase; HET: HIS AMP; 2.60A {Escherichia coli} SCOP: c.51.1.1 d.104.1.1 PDB: 1kmm_A* 1kmn_A* 2el9_A* Length = 423 Back     alignment and structure
>1qe0_A Histidyl-tRNA synthetase; class II tRNA synthetase, beta sheet, ligase; 2.70A {Staphylococcus aureus} SCOP: c.51.1.1 d.104.1.1 Length = 420 Back     alignment and structure
>4e51_A Histidine--tRNA ligase; seattle structural genomics center for infectious disease, S aminoacylation, tRNA activation, charged tRNA; HET: HIS; 2.65A {Burkholderia thailandensis} Length = 467 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query65
4g84_A464 Histidine--tRNA ligase, cytoplasmic; synthetase; 2 99.66
4g85_A517 Histidine-tRNA ligase, cytoplasmic; synthetase; 3. 99.65
1evl_A401 Threonyl-tRNA synthetase; amino acid recognition, 99.5
3ikl_A459 DNA polymerase subunit gamma-2, mitochondrial; tra 99.48
3uh0_A460 Threonyl-tRNA synthetase, mitochondrial; threonine 99.48
1v95_A130 Nuclear receptor coactivator 5; coactivator indepe 99.43
4e51_A467 Histidine--tRNA ligase; seattle structural genomic 99.43
1g5h_A454 Mitochondrial DNA polymerase accessory subunit; in 99.42
1qf6_A642 THRRS, threonyl-tRNA synthetase; tRNA(Thr), AMP, m 99.41
1nj8_A459 Proline-tRNA synthetase, proline--tRNA ligase; cla 99.41
2j3l_A572 Prolyl-tRNA synthetase; class II aminoacyl- T synt 99.4
1h4v_B421 Histidyl-tRNA synthetase; class IIA aminoacyl-tRNA 99.39
1nj1_A501 PROR, proline-tRNA synthetase, proline--tRNA ligas 99.39
1htt_A423 Histidyl-tRNA synthetase; complex (tRNA synthetase 99.38
1nyr_A645 Threonyl-tRNA synthetase 1; ATP, threonine, ligase 99.38
1ati_A505 Glycyl-tRNA synthetase; protein biosynthesis, liga 99.38
1hc7_A477 Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, 99.35
2zt5_A693 Glycyl-tRNA synthetase; ligase, AP4A, glycine, ATP 99.35
4hvc_A 519 Bifunctional glutamate/proline--tRNA ligase; ligas 99.35
1wu7_A434 Histidyl-tRNA synthetase; ligase, structural genom 99.31
3lc0_A456 Histidyl-tRNA synthetase; tRNA-ligase, aminoacyl-t 99.29
3net_A465 Histidyl-tRNA synthetase; aminoacyl-tRNA synthetas 99.27
1qe0_A420 Histidyl-tRNA synthetase; class II tRNA synthetase 99.27
2i4l_A458 Proline-tRNA ligase; alpha beta; 2.00A {Rhodopseud 99.24
3a32_A471 Probable threonyl-tRNA synthetase 1; aeropyrum per 99.19
3ial_A 518 Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, 99.1
>4g84_A Histidine--tRNA ligase, cytoplasmic; synthetase; 2.40A {Homo sapiens} Back     alignment and structure
Probab=99.66  E-value=1.6e-16  Score=101.27  Aligned_cols=64  Identities=44%  Similarity=0.782  Sum_probs=59.7

Q ss_pred             CCCCCCCHHHHHHHhhhcCCcEEEEEcccccccCeEEEEEcCCCceeeecHHHHHHHHHHHhhC
Q psy14271          2 SYKKNPKLLDQLQYCEDNQIHWCIVIGQSELASNSVKLRNVLTREEETISRDKLLDTLQEKLKE   65 (65)
Q Consensus         2 ~~~~~~~l~kq~k~A~~~~~~~~vivG~~E~~~~~v~vk~~~~~~~~~~~~~e~~~~i~~~~~~   65 (65)
                      +|..+.++++||++|++.|+||+||||++|.++|+|+||||.+++|..++++++++.|+..++|
T Consensus       399 ~~~~~~~l~~q~k~A~~~g~~~~viiG~~E~~~g~v~vK~l~tgeq~~v~~~elv~~lk~~l~~  462 (464)
T 4g84_A          399 LYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQ  462 (464)
T ss_dssp             CSCSSCCHHHHHHHHHHHTCCEEEECCHHHHHHTEEEEEETTTCCEEEEEGGGHHHHHHHHHTC
T ss_pred             EeCCCCCHHHHHHHHHHCCCCEEEEECchhhhCCEEEEEECCCCCeEEeeHHHHHHHHHHHhcC
Confidence            4554568999999999999999999999999999999999999999999999999999998875
>4g85_A Histidine-tRNA ligase, cytoplasmic; synthetase; 3.11A {Homo sapiens} Back     alignment and structure
>1evl_A Threonyl-tRNA synthetase; amino acid recognition, zinc ION, adenylate analog, deletion mutant, ligase; HET: TSB; 1.55A {Escherichia coli} SCOP: c.51.1.1 d.104.1.1 PDB: 1evk_A* 1fyf_A* 1kog_A* Back     alignment and structure
>3ikl_A DNA polymerase subunit gamma-2, mitochondrial; transferase; HET: DNA; 3.10A {Homo sapiens} Back     alignment and structure
>3uh0_A Threonyl-tRNA synthetase, mitochondrial; threonine tRNA, threonyl ADE threonyl sulfamoyl adenylate; HET: TSB; 2.00A {Saccharomyces cerevisiae} PDB: 3ugt_A 3ugq_A* 4eo4_A* Back     alignment and structure
>1v95_A Nuclear receptor coactivator 5; coactivator independent of AF-2 function (CIA), structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: c.51.1.1 Back     alignment and structure
>4e51_A Histidine--tRNA ligase; seattle structural genomics center for infectious disease, S aminoacylation, tRNA activation, charged tRNA; HET: HIS; 2.65A {Burkholderia thailandensis} Back     alignment and structure
>1g5h_A Mitochondrial DNA polymerase accessory subunit; intermolecular four helix bundle, DNA binding protein; 1.95A {Mus musculus} SCOP: c.51.1.1 d.104.1.1 PDB: 1g5i_A 2g4c_A* 3ikm_B* Back     alignment and structure
>1qf6_A THRRS, threonyl-tRNA synthetase; tRNA(Thr), AMP, mRNA, aminoacylati translational regulation, protein/RNA, ligase-RNA complex; HET: H2U AET G7M 5MU PSU AMP; 2.90A {Escherichia coli} SCOP: c.51.1.1 d.15.10.1 d.67.1.1 d.104.1.1 Back     alignment and structure
>1nj8_A Proline-tRNA synthetase, proline--tRNA ligase; class-II tRNA synthetase; 3.20A {Methanocaldococcus jannaschii} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 Back     alignment and structure
>2j3l_A Prolyl-tRNA synthetase; class II aminoacyl- T synthetase, editing, translation; HET: P5A; 2.3A {Enterococcus faecalis} PDB: 2j3m_A* Back     alignment and structure
>1h4v_B Histidyl-tRNA synthetase; class IIA aminoacyl-tRNA synthetase, ATP + L-histidine tRNA(His)-> AMP + PPI + L-histidyl-tRNA(His); 2.4A {Thermus thermophilus} SCOP: c.51.1.1 d.104.1.1 PDB: 1ady_A* 1adj_A Back     alignment and structure
>1nj1_A PROR, proline-tRNA synthetase, proline--tRNA ligase; protein-aminoacyladenylate complex class-II tRNA synthetase,; HET: 5CA; 2.55A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 PDB: 1nj2_A 1nj5_A* 1nj6_A* Back     alignment and structure
>1htt_A Histidyl-tRNA synthetase; complex (tRNA synthetase/His-adenylate), aminoacyl-tRNA synthase, ligase; HET: HIS AMP; 2.60A {Escherichia coli} SCOP: c.51.1.1 d.104.1.1 PDB: 1kmm_A* 1kmn_A* 2el9_A* Back     alignment and structure
>1nyr_A Threonyl-tRNA synthetase 1; ATP, threonine, ligase; HET: ATP; 2.80A {Staphylococcus aureus} SCOP: c.51.1.1 d.15.10.1 d.67.1.1 d.104.1.1 PDB: 1nyq_A* Back     alignment and structure
>1ati_A Glycyl-tRNA synthetase; protein biosynthesis, ligase, aminoacyl-tRNA SYN; 2.75A {Thermus thermophilus} SCOP: c.51.1.1 d.104.1.1 PDB: 1b76_A* 1ggm_A* Back     alignment and structure
>1hc7_A Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP + L-proline + tRNA(Pro) AMP + PPI + L-prolyl-tRNA(Pro); 2.43A {Thermus thermophilus} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 PDB: 1h4q_A* 1h4t_A 1h4s_A Back     alignment and structure
>2zt5_A Glycyl-tRNA synthetase; ligase, AP4A, glycine, ATP, Gly-AMP, aminoacyl-tRNA synthetase, ATP-binding, charcot-marie-tooth disease, disease mutation; HET: B4P; 2.50A {Homo sapiens} PDB: 2pme_A* 2zt6_A* 2zt7_A* 2zt8_A* 2zxf_A* 2pmf_A 2q5h_A 2q5i_A Back     alignment and structure
>4hvc_A Bifunctional glutamate/proline--tRNA ligase; ligase-ligase inhibitor complex; HET: ANP HFG; 2.00A {Homo sapiens} Back     alignment and structure
>1wu7_A Histidyl-tRNA synthetase; ligase, structural genomics, dimer; 2.40A {Thermoplasma acidophilum} SCOP: c.51.1.1 d.104.1.1 Back     alignment and structure
>3lc0_A Histidyl-tRNA synthetase; tRNA-ligase, aminoacyl-tRNA synthetase, ligase, structural G medical structural genomics of pathogenic protozoa; HET: HIS; 1.80A {Trypanosoma cruzi} PDB: 3hrk_A* 3hri_A Back     alignment and structure
>3net_A Histidyl-tRNA synthetase; aminoacyl-tRNA synthetase, ligase, structural genomics, PSI- nostoc, protein structure initiative; 2.70A {Nostoc SP} Back     alignment and structure
>1qe0_A Histidyl-tRNA synthetase; class II tRNA synthetase, beta sheet, ligase; 2.70A {Staphylococcus aureus} SCOP: c.51.1.1 d.104.1.1 Back     alignment and structure
>2i4l_A Proline-tRNA ligase; alpha beta; 2.00A {Rhodopseudomonas palustris} PDB: 2i4m_A* 2i4n_A* 2i4o_A* Back     alignment and structure
>3a32_A Probable threonyl-tRNA synthetase 1; aeropyrum pernix K1, protein biosynthesis, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase; 2.30A {Aeropyrum pernix} PDB: 3a31_A Back     alignment and structure
>3ial_A Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, prors, cysrs, RS, translation, ATP-binding, nucleotide-binding; HET: PR8; 2.20A {Giardia lamblia atcc 50803} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 65
d1nyra1113 c.51.1.1 (A:533-645) Threonyl-tRNA synthetase (Thr 8e-08
d1qe0a195 c.51.1.1 (A:326-420) Histidyl-tRNA synthetase (His 3e-07
d1g5ha1127 c.51.1.1 (A:343-469) The aaRS-like accessory subun 2e-06
d1qf6a1110 c.51.1.1 (A:533-642) Threonyl-tRNA synthetase (Thr 1e-05
>d1nyra1 c.51.1.1 (A:533-645) Threonyl-tRNA synthetase (ThrRS), C-terminal domain {Staphylococcus aureus [TaxId: 1280]} Length = 113 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Anticodon-binding domain-like
superfamily: Class II aaRS ABD-related
family: Anticodon-binding domain of Class II aaRS
domain: Threonyl-tRNA synthetase (ThrRS), C-terminal domain
species: Staphylococcus aureus [TaxId: 1280]

 Score = 43.2 bits (101), Expect = 8e-08
 Identities = 12/51 (23%), Positives = 31/51 (60%)

Query: 15  YCEDNQIHWCIVIGQSELASNSVKLRNVLTREEETISRDKLLDTLQEKLKE 65
             +  +I + IV+G  E+ +N V +R   ++++ET+ +D+ +  L ++++ 
Sbjct: 59  EAQMQKIPYQIVVGDKEVENNQVNVRQYGSQDQETVEKDEFIWNLVDEIRL 109
>d1qe0a1 c.51.1.1 (A:326-420) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Staphylococcus aureus [TaxId: 1280]} Length = 95 Back     information, alignment and structure
>d1g5ha1 c.51.1.1 (A:343-469) The aaRS-like accessory subunit of mitochondrial polymerase gamma, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1qf6a1 c.51.1.1 (A:533-642) Threonyl-tRNA synthetase (ThrRS), C-terminal domain {Escherichia coli [TaxId: 562]} Length = 110 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query65
d1kmma199 Histidyl-tRNA synthetase (HisRS), C-terminal domai 99.79
d1h4vb196 Histidyl-tRNA synthetase (HisRS), C-terminal domai 99.78
d1wu7a197 Histidyl-tRNA synthetase (HisRS), C-terminal domai 99.75
d1qf6a1110 Threonyl-tRNA synthetase (ThrRS), C-terminal domai 99.73
d1qe0a195 Histidyl-tRNA synthetase (HisRS), C-terminal domai 99.7
d1nyra1113 Threonyl-tRNA synthetase (ThrRS), C-terminal domai 99.69
d1g5ha1127 The aaRS-like accessory subunit of mitochondrial p 99.68
d1nj1a1127 Prolyl-tRNA synthetase (ProRS) domain {Arhaeon (Me 99.59
d1nj8a1126 Prolyl-tRNA synthetase (ProRS) domain {Archaeon (M 99.59
d1atia1111 Glycyl-tRNA synthetase (GlyRS), C-terminal domain 99.53
d1hc7a1127 Prolyl-tRNA synthetase (ProRS) domain {Thermus the 99.38
d1v95a_130 Nuclear receptor coactivator 5 (KIAA1637) {Human ( 95.5
>d1kmma1 c.51.1.1 (A:326-424) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Anticodon-binding domain-like
superfamily: Class II aaRS ABD-related
family: Anticodon-binding domain of Class II aaRS
domain: Histidyl-tRNA synthetase (HisRS), C-terminal domain
species: Escherichia coli [TaxId: 562]

Probab=99.79  E-value=1.7e-19  Score=94.52  Aligned_cols=60  Identities=17%  Similarity=0.315  Sum_probs=57.1

Q ss_pred             CCCCHHHHHHHhhhcCCcEEEEEcccccccCeEEEEEcCCCceeeecHHHHHHHHHHHhh
Q psy14271          5 KNPKLLDQLQYCEDNQIHWCIVIGQSELASNSVKLRNVLTREEETISRDKLLDTLQEKLK   64 (65)
Q Consensus         5 ~~~~l~kq~k~A~~~~~~~~vivG~~E~~~~~v~vk~~~~~~~~~~~~~e~~~~i~~~~~   64 (65)
                      .+.++++||++|++.|+||++|+|++|.++|+|++|+|.+++|..+++++++..++..|+
T Consensus        40 ~~~~l~kq~k~A~~~~~~~~iiiG~~E~~~~~v~vk~l~~~~q~~v~~~el~~~l~~~Lg   99 (99)
T d1kmma1          40 GGGNFKKQFARADKWGARVAVVLGESEVANGTAVVKDLRSGEQTAVAQDSVAAHLRTLLG   99 (99)
T ss_dssp             SCCCHHHHHHHHHHHTCSEEEECCHHHHHTTEEEEEETTTCCEEEEEHHHHHHHHHHHHC
T ss_pred             CCCCHHHHHHHHHHhCCChhhhcCchhhhccEEEEEECCCCCEEEEeHHHHHHHHHHHhC
Confidence            368999999999999999999999999999999999999999999999999999988774
>d1h4vb1 c.51.1.1 (B:326-421) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wu7a1 c.51.1.1 (A:330-426) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1qf6a1 c.51.1.1 (A:533-642) Threonyl-tRNA synthetase (ThrRS), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qe0a1 c.51.1.1 (A:326-420) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1nyra1 c.51.1.1 (A:533-645) Threonyl-tRNA synthetase (ThrRS), C-terminal domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1g5ha1 c.51.1.1 (A:343-469) The aaRS-like accessory subunit of mitochondrial polymerase gamma, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nj1a1 c.51.1.1 (A:284-410) Prolyl-tRNA synthetase (ProRS) domain {Arhaeon (Methanothermobacter thermautotrophicus) [TaxId: 145262]} Back     information, alignment and structure
>d1nj8a1 c.51.1.1 (A:268-393) Prolyl-tRNA synthetase (ProRS) domain {Archaeon (Methanocaldococcus jannaschii) [TaxId: 2190]} Back     information, alignment and structure
>d1atia1 c.51.1.1 (A:395-505) Glycyl-tRNA synthetase (GlyRS), C-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hc7a1 c.51.1.1 (A:277-403) Prolyl-tRNA synthetase (ProRS) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v95a_ c.51.1.1 (A:) Nuclear receptor coactivator 5 (KIAA1637) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure