Psyllid ID: psy14279
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 73 | ||||||
| 242010402 | 127 | abrupt protein, putative [Pediculus huma | 0.753 | 0.433 | 0.785 | 4e-17 | |
| 156550568 | 127 | PREDICTED: longitudinals lacking protein | 0.753 | 0.433 | 0.732 | 7e-16 | |
| 110756044 | 127 | PREDICTED: longitudinals lacking protein | 0.753 | 0.433 | 0.732 | 7e-16 | |
| 322802841 | 109 | hypothetical protein SINV_10955 [Solenop | 0.753 | 0.504 | 0.732 | 7e-16 | |
| 17865642 | 127 | lola like, isoform A [Drosophila melanog | 0.753 | 0.433 | 0.732 | 2e-15 | |
| 195150907 | 126 | GL10513 [Drosophila persimilis] gi|19533 | 0.753 | 0.436 | 0.732 | 2e-15 | |
| 31200901 | 126 | AGAP011247-PA [Anopheles gambiae str. PE | 0.753 | 0.436 | 0.696 | 2e-15 | |
| 225717820 | 128 | Longitudinals lacking protein-like [Cali | 0.739 | 0.421 | 0.727 | 2e-15 | |
| 225719214 | 128 | Longitudinals lacking protein-like [Cali | 0.739 | 0.421 | 0.727 | 3e-15 | |
| 157125571 | 126 | abrupt protein [Aedes aegypti] gi|157125 | 0.753 | 0.436 | 0.696 | 3e-15 |
| >gi|242010402|ref|XP_002425957.1| abrupt protein, putative [Pediculus humanus corporis] gi|212509940|gb|EEB13219.1| abrupt protein, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 92.0 bits (227), Expect = 4e-17, Method: Compositional matrix adjust.
Identities = 44/56 (78%), Positives = 49/56 (87%), Gaps = 1/56 (1%)
Query: 18 VIMDKTFKHLTDILEFMYAGEVNVSQDQLPSFLKTADRLKIKGLAEAPQSSVKREG 73
++ D F HL ILEFMYAGEVNVSQDQLP+FLKTADRLK+KGLAEAPQ S+KREG
Sbjct: 73 ILKDVPFSHLQAILEFMYAGEVNVSQDQLPAFLKTADRLKVKGLAEAPQ-SIKREG 127
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|156550568|ref|XP_001603477.1| PREDICTED: longitudinals lacking protein-like isoform 1 [Nasonia vitripennis] gi|345488630|ref|XP_003425953.1| PREDICTED: longitudinals lacking protein-like isoform 2 [Nasonia vitripennis] gi|307166782|gb|EFN60744.1| Longitudinals lacking protein-like [Camponotus floridanus] gi|307207491|gb|EFN85202.1| Longitudinals lacking protein-like [Harpegnathos saltator] gi|332021216|gb|EGI61601.1| Longitudinals lacking protein-like protein [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|110756044|ref|XP_001120198.1| PREDICTED: longitudinals lacking protein-like [Apis mellifera] gi|340712770|ref|XP_003394928.1| PREDICTED: longitudinals lacking protein-like [Bombus terrestris] gi|350409197|ref|XP_003488648.1| PREDICTED: longitudinals lacking protein-like [Bombus impatiens] gi|380021548|ref|XP_003694625.1| PREDICTED: longitudinals lacking protein-like [Apis florea] gi|383847541|ref|XP_003699411.1| PREDICTED: longitudinals lacking protein-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|322802841|gb|EFZ23037.1| hypothetical protein SINV_10955 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|17865642|ref|NP_524778.1| lola like, isoform A [Drosophila melanogaster] gi|24654826|ref|NP_725756.1| lola like, isoform B [Drosophila melanogaster] gi|24654830|ref|NP_725757.1| lola like, isoform C [Drosophila melanogaster] gi|24654834|ref|NP_725758.1| lola like, isoform D [Drosophila melanogaster] gi|281363640|ref|NP_001163186.1| lola like, isoform E [Drosophila melanogaster] gi|386768235|ref|NP_001246402.1| lola like, isoform F [Drosophila melanogaster] gi|386768237|ref|NP_001246403.1| lola like, isoform G [Drosophila melanogaster] gi|194753378|ref|XP_001958989.1| GF12279 [Drosophila ananassae] gi|194880979|ref|XP_001974626.1| GG20988 [Drosophila erecta] gi|195123556|ref|XP_002006271.1| GI20951 [Drosophila mojavensis] gi|195381699|ref|XP_002049583.1| GJ20673 [Drosophila virilis] gi|195429549|ref|XP_002062820.1| GK19492 [Drosophila willistoni] gi|195487586|ref|XP_002091971.1| GE13931 [Drosophila yakuba] gi|195584489|ref|XP_002082037.1| GD25412 [Drosophila simulans] gi|73621174|sp|Q7KRI2.1|LOLAL_DROME RecName: Full=Longitudinals lacking protein-like; Short=Lola-like protein; AltName: Full=Protein Batman gi|12007119|gb|AAG45054.1|AF308476_1 batman protein [Drosophila melanogaster] gi|7302659|gb|AAF57739.1| lola like, isoform A [Drosophila melanogaster] gi|16648276|gb|AAL25403.1| LD14505p [Drosophila melanogaster] gi|21626476|gb|AAM68179.1| lola like, isoform B [Drosophila melanogaster] gi|21626477|gb|AAM68180.1| lola like, isoform C [Drosophila melanogaster] gi|21626478|gb|AAM68181.1| lola like, isoform D [Drosophila melanogaster] gi|190620287|gb|EDV35811.1| GF12279 [Drosophila ananassae] gi|190657813|gb|EDV55026.1| GG20988 [Drosophila erecta] gi|193911339|gb|EDW10206.1| GI20951 [Drosophila mojavensis] gi|194144380|gb|EDW60776.1| GJ20673 [Drosophila virilis] gi|194158905|gb|EDW73806.1| GK19492 [Drosophila willistoni] gi|194178072|gb|EDW91683.1| GE13931 [Drosophila yakuba] gi|194194046|gb|EDX07622.1| GD25412 [Drosophila simulans] gi|220942400|gb|ACL83743.1| lolal-PA [synthetic construct] gi|220952644|gb|ACL88865.1| lolal-PA [synthetic construct] gi|257286279|gb|ACV53086.1| MIP07390p [Drosophila melanogaster] gi|272432537|gb|ACZ94458.1| lola like, isoform E [Drosophila melanogaster] gi|289741675|gb|ADD19585.1| hypothetical conserved protein [Glossina morsitans morsitans] gi|383302569|gb|AFH08155.1| lola like, isoform F [Drosophila melanogaster] gi|383302570|gb|AFH08156.1| lola like, isoform G [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|195150907|ref|XP_002016391.1| GL10513 [Drosophila persimilis] gi|195335493|ref|XP_002034398.1| GM19923 [Drosophila sechellia] gi|198457686|ref|XP_001360761.2| GA19096 [Drosophila pseudoobscura pseudoobscura] gi|194110238|gb|EDW32281.1| GL10513 [Drosophila persimilis] gi|194126368|gb|EDW48411.1| GM19923 [Drosophila sechellia] gi|198136068|gb|EAL25336.2| GA19096 [Drosophila pseudoobscura pseudoobscura] | Back alignment and taxonomy information |
|---|
| >gi|31200901|ref|XP_309398.1| AGAP011247-PA [Anopheles gambiae str. PEST] gi|30178468|gb|EAA05153.2| AGAP011247-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|225717820|gb|ACO14756.1| Longitudinals lacking protein-like [Caligus clemensi] | Back alignment and taxonomy information |
|---|
| >gi|225719214|gb|ACO15453.1| Longitudinals lacking protein-like [Caligus clemensi] | Back alignment and taxonomy information |
|---|
| >gi|157125571|ref|XP_001654392.1| abrupt protein [Aedes aegypti] gi|157125573|ref|XP_001654393.1| abrupt protein [Aedes aegypti] gi|170037621|ref|XP_001846655.1| BTB/POZ and Kelch domain-containing protein [Culex quinquefasciatus] gi|94468928|gb|ABF18313.1| BTB/POZ and Kelch domain-containing protein [Aedes aegypti] gi|108873571|gb|EAT37796.1| AAEL010244-PA [Aedes aegypti] gi|108873572|gb|EAT37797.1| AAEL010244-PB [Aedes aegypti] gi|167880866|gb|EDS44249.1| BTB/POZ and Kelch domain-containing protein [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 73 | ||||||
| FB|FBgn0022238 | 127 | lolal "lola like" [Drosophila | 0.753 | 0.433 | 0.732 | 8.6e-17 | |
| FB|FBgn0263108 | 798 | BtbVII "BTB-protein-VII" [Dros | 0.794 | 0.072 | 0.477 | 7.3e-09 | |
| FB|FBgn0029824 | 676 | CG3726 [Drosophila melanogaste | 0.630 | 0.068 | 0.586 | 2.6e-08 | |
| FB|FBgn0025525 | 1067 | bab2 "bric a brac 2" [Drosophi | 0.876 | 0.059 | 0.44 | 2e-07 | |
| FB|FBgn0264981 | 1089 | mamo "maternal gene required f | 0.945 | 0.063 | 0.459 | 2.1e-07 | |
| FB|FBgn0002781 | 610 | mod(mdg4) "modifier of mdg4" [ | 0.547 | 0.065 | 0.581 | 3.4e-07 | |
| FB|FBgn0004870 | 977 | bab1 "bric a brac 1" [Drosophi | 0.630 | 0.047 | 0.531 | 1.1e-06 | |
| FB|FBgn0005630 | 970 | lola "longitudinals lacking" [ | 0.643 | 0.048 | 0.446 | 1.6e-06 | |
| FB|FBgn0264442 | 904 | ab "abrupt" [Drosophila melano | 0.630 | 0.050 | 0.521 | 2.5e-06 | |
| FB|FBgn0004652 | 955 | fru "fruitless" [Drosophila me | 0.739 | 0.056 | 0.418 | 2.6e-06 |
| FB|FBgn0022238 lolal "lola like" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 207 (77.9 bits), Expect = 8.6e-17, P = 8.6e-17
Identities = 41/56 (73%), Positives = 49/56 (87%)
Query: 18 VIMDKTFKHLTDILEFMYAGEVNVSQDQLPSFLKTADRLKIKGLAEAPQSSVKREG 73
++ D ++ HL ILEFMYAGEVNVSQ+QLP+FLKTADRLK+KGLAE P SS+KREG
Sbjct: 73 ILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLAETP-SSIKREG 127
|
|
| FB|FBgn0263108 BtbVII "BTB-protein-VII" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0029824 CG3726 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0025525 bab2 "bric a brac 2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0264981 mamo "maternal gene required for meiosis" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0002781 mod(mdg4) "modifier of mdg4" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0004870 bab1 "bric a brac 1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0005630 lola "longitudinals lacking" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0264442 ab "abrupt" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0004652 fru "fruitless" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 73 | |||
| smart00225 | 97 | smart00225, BTB, Broad-Complex, Tramtrack and Bric | 3e-07 | |
| pfam00651 | 101 | pfam00651, BTB, BTB/POZ domain | 1e-05 |
| >gnl|CDD|197585 smart00225, BTB, Broad-Complex, Tramtrack and Bric a brac | Back alignment and domain information |
|---|
Score = 43.1 bits (102), Expect = 3e-07
Identities = 13/48 (27%), Positives = 27/48 (56%)
Query: 17 YVIMDKTFKHLTDILEFMYAGEVNVSQDQLPSFLKTADRLKIKGLAEA 64
+ D + + +L F+Y G++++ ++ + L+ AD L+I GL E
Sbjct: 41 IYLDDVSPEDFRALLNFLYTGKLDLPEENVEELLELADYLQIPGLVEL 88
|
Domain in Broad-Complex, Tramtrack and Bric a brac. Also known as POZ (poxvirus and zinc finger) domain. Known to be a protein-protein interaction motif found at the N-termini of several C2H2-type transcription factors as well as Shaw-type potassium channels. Known structure reveals a tightly intertwined dimer formed via interactions between N-terminal strand and helix structures. However in a subset of BTB/POZ domains, these two secondary structures appear to be missing. Be aware SMART predicts BTB/POZ domains without the beta1- and alpha1-secondary structures. Length = 97 |
| >gnl|CDD|216043 pfam00651, BTB, BTB/POZ domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 73 | |||
| PHA02790 | 480 | Kelch-like protein; Provisional | 99.83 | |
| KOG4441|consensus | 571 | 99.76 | ||
| PHA02713 | 557 | hypothetical protein; Provisional | 99.72 | |
| PHA03098 | 534 | kelch-like protein; Provisional | 99.63 | |
| PF00651 | 111 | BTB: BTB/POZ domain; InterPro: IPR013069 The BTB ( | 99.53 | |
| smart00225 | 90 | BTB Broad-Complex, Tramtrack and Bric a brac. Doma | 99.49 | |
| KOG4350|consensus | 620 | 98.62 | ||
| KOG2075|consensus | 521 | 98.12 | ||
| KOG4682|consensus | 488 | 98.0 | ||
| KOG4591|consensus | 280 | 97.44 | ||
| KOG0783|consensus | 1267 | 97.32 | ||
| KOG2716|consensus | 230 | 96.83 | ||
| KOG0783|consensus | 1267 | 96.76 | ||
| smart00512 | 104 | Skp1 Found in Skp1 protein family. Family of Skp1 | 96.51 | |
| PF02214 | 94 | BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassi | 96.21 | |
| KOG1665|consensus | 302 | 95.77 | ||
| KOG1724|consensus | 162 | 95.51 | ||
| KOG3473|consensus | 112 | 93.5 | ||
| PF11822 | 317 | DUF3342: Domain of unknown function (DUF3342); Int | 92.52 | |
| PF03931 | 62 | Skp1_POZ: Skp1 family, tetramerisation domain; Int | 91.58 | |
| KOG2838|consensus | 401 | 91.12 | ||
| KOG0511|consensus | 516 | 90.11 | ||
| PF01466 | 78 | Skp1: Skp1 family, dimerisation domain; InterPro: | 85.35 | |
| KOG2714|consensus | 465 | 84.37 | ||
| KOG3840|consensus | 438 | 82.96 |
| >PHA02790 Kelch-like protein; Provisional | Back alignment and domain information |
|---|
Probab=99.83 E-value=1.6e-21 Score=142.66 Aligned_cols=67 Identities=12% Similarity=0.202 Sum_probs=62.5
Q ss_pred EEEeeCCHHHHHhhh----------hc--CCCCHHHHHHHhHhhhcceEeecCCcHHHHHHHHhhcCcccccccccccc
Q psy14279 3 SSEQFCHQFLEALFY----------VI--MDKTFKHLTDILEFMYAGEVNVSQDQLPSFLKTADRLKIKGLAEAPQSSV 69 (73)
Q Consensus 3 ~VLAa~S~YFr~lf~----------~l--~~v~~~~l~~ll~f~YtG~i~i~~~~v~~ll~aA~~Lqi~~l~~~~~~~~ 69 (73)
+||||||||||+||+ .+ .|+++++|+.||+|+|||++.|+.+|++++++||++||++.+.+.|++..
T Consensus 38 ~VLAa~S~YFraMF~~~~~Es~~~v~~~~~~v~~~~l~~lldy~YTg~l~it~~nV~~ll~aA~~Lqi~~v~~~C~~fL 116 (480)
T PHA02790 38 TILKKLSPYFRTHLRQKYTKNKDPVTRVCLDLDIHSLTSIVIYSYTGKVYIDSHNVVNLLRASILTSVEFIIYTCINFI 116 (480)
T ss_pred hhhhhcCHHHHHHhcCCccccccceEEEecCcCHHHHHHHHHhheeeeEEEecccHHHHHHHHHHhChHHHHHHHHHHH
Confidence 589999999999998 23 38999999999999999999999999999999999999999999998863
|
|
| >KOG4441|consensus | Back alignment and domain information |
|---|
| >PHA02713 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA03098 kelch-like protein; Provisional | Back alignment and domain information |
|---|
| >PF00651 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB (for BR-C, ttk and bab) [] or POZ (for Pox virus and Zinc finger) [] domain is present near the N terminus of a fraction of zinc finger (IPR007087 from INTERPRO) proteins and in proteins that contain the IPR006652 from INTERPRO motif such as Kelch and a family of pox virus proteins | Back alignment and domain information |
|---|
| >smart00225 BTB Broad-Complex, Tramtrack and Bric a brac | Back alignment and domain information |
|---|
| >KOG4350|consensus | Back alignment and domain information |
|---|
| >KOG2075|consensus | Back alignment and domain information |
|---|
| >KOG4682|consensus | Back alignment and domain information |
|---|
| >KOG4591|consensus | Back alignment and domain information |
|---|
| >KOG0783|consensus | Back alignment and domain information |
|---|
| >KOG2716|consensus | Back alignment and domain information |
|---|
| >KOG0783|consensus | Back alignment and domain information |
|---|
| >smart00512 Skp1 Found in Skp1 protein family | Back alignment and domain information |
|---|
| >PF02214 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassium channels are the most diverse group of the ion channel family [, ] | Back alignment and domain information |
|---|
| >KOG1665|consensus | Back alignment and domain information |
|---|
| >KOG1724|consensus | Back alignment and domain information |
|---|
| >KOG3473|consensus | Back alignment and domain information |
|---|
| >PF11822 DUF3342: Domain of unknown function (DUF3342); InterPro: IPR021777 This family of proteins are functionally uncharacterised | Back alignment and domain information |
|---|
| >PF03931 Skp1_POZ: Skp1 family, tetramerisation domain; InterPro: IPR016073 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] | Back alignment and domain information |
|---|
| >KOG2838|consensus | Back alignment and domain information |
|---|
| >KOG0511|consensus | Back alignment and domain information |
|---|
| >PF01466 Skp1: Skp1 family, dimerisation domain; InterPro: IPR016072 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] | Back alignment and domain information |
|---|
| >KOG2714|consensus | Back alignment and domain information |
|---|
| >KOG3840|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 73 | |||
| 3m5b_A | 119 | Zinc finger and BTB domain-containing protein 32; | 5e-05 | |
| 3ohu_A | 125 | Transcription regulator protein BACH2; BTB/POZ dom | 5e-04 | |
| 1r29_A | 127 | B-cell lymphoma 6 protein; BTB domain, transcripti | 5e-04 |
| >3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
Score = 37.2 bits (87), Expect = 5e-05
Identities = 18/62 (29%), Positives = 26/62 (41%), Gaps = 3/62 (4%)
Query: 3 SSEQFCHQFLEALFYVIMDKTFKHLTDILEFMYAGEVNVSQDQLPSFLKTADRLKIKGLA 62
S+Q + AL I TF L L F+Y V + +L + A L ++ L
Sbjct: 52 VSQQLGRRGQWALGEGISPSTFAQL---LNFVYGESVELQPGELRPLQEAARALGVQSLE 108
Query: 63 EA 64
EA
Sbjct: 109 EA 110
|
| >3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} PDB: 3ohv_A Length = 125 | Back alignment and structure |
|---|
| >1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Length = 127 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 73 | |||
| 2ihc_A | 124 | Transcription regulator protein BACH1; BRIC-A-BRAC | 99.78 | |
| 3ohu_A | 125 | Transcription regulator protein BACH2; BTB/POZ dom | 99.78 | |
| 3b84_A | 119 | Zinc finger and BTB domain-containing protein 48; | 99.77 | |
| 3ga1_A | 129 | Nucleus accumbens-associated protein 1; BTB/POZ do | 99.77 | |
| 2q81_A | 119 | MIZ-1 protein; BTB/POZ domain, transcription; HET: | 99.77 | |
| 2yy9_A | 135 | Zinc finger and BTB domain-containing protein 48; | 99.75 | |
| 1r29_A | 127 | B-cell lymphoma 6 protein; BTB domain, transcripti | 99.75 | |
| 2vpk_A | 116 | Myoneurin; transcription regulation, transcription | 99.75 | |
| 1buo_A | 121 | POZ domain, protein (promyelocytic leukemia zinc f | 99.75 | |
| 2ppi_A | 144 | Gigaxonin; BTB domain, protein degradation, struct | 99.75 | |
| 2z8h_A | 138 | Transcription regulator protein BACH1; BTB, POZ, d | 99.75 | |
| 3m5b_A | 119 | Zinc finger and BTB domain-containing protein 32; | 99.74 | |
| 2if5_A | 120 | Zinc finger and BTB domain-containing protein 7A; | 99.74 | |
| 2vkp_A | 109 | BTB/POZ domain-containing protein 6; protein-bindi | 99.74 | |
| 3fkc_A | 116 | Transcriptional regulator kaiso; zinc finger and B | 99.69 | |
| 4eoz_A | 145 | Speckle-type POZ protein; E3 ubiquitin ligase, nuc | 99.67 | |
| 3hve_A | 256 | Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis | 99.66 | |
| 3htm_A | 172 | Speckle-type POZ protein; BTB, SPOP, ubiquitin, li | 99.64 | |
| 3i3n_A | 279 | Kelch-like protein 11; structural genomics, BTB, K | 99.63 | |
| 3hqi_A | 312 | Speckle-type POZ protein; SPOP, ubiquitin, puckere | 99.53 | |
| 2ast_A | 159 | S-phase kinase-associated protein 1A; SCF-substrat | 99.3 | |
| 4ajy_C | 97 | Transcription elongation factor B polypeptide 1; E | 99.18 | |
| 1fs1_B | 141 | SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, le | 99.01 | |
| 2p1m_A | 160 | SKP1-like protein 1A; F-BOX, leucine rich repeat, | 98.98 | |
| 2fnj_C | 96 | Transcription elongation factor B polypeptide 1; b | 98.28 | |
| 1hv2_A | 99 | Elongin C, ELC1; protein-peptide complex, signalin | 98.08 | |
| 3v7d_A | 169 | Suppressor of kinetochore protein 1; WD 40 domain, | 97.98 | |
| 1vcb_B | 112 | Protein (elongin C); tumor suppressor, cancer, ubi | 97.61 | |
| 3drz_A | 107 | BTB/POZ domain-containing protein KCTD5; potassium | 97.23 | |
| 1s1g_A | 124 | Potassium voltage-gated channel subfamily D membe; | 95.72 | |
| 2nz0_B | 140 | Potassium voltage-gated channel subfamily D membe; | 95.65 | |
| 1nn7_A | 105 | Potassium channel KV4.2; teteramerization domain, | 94.69 | |
| 3drx_A | 202 | BTB/POZ domain-containing protein KCTD5; golgi, gr | 94.63 | |
| 3kvt_A | 115 | Potassium channel protein SHAW; tetramerization do | 94.42 | |
| 1t1d_A | 100 | Protein (potassium channel KV1.1); potassium chann | 92.85 | |
| 2rbg_A | 126 | Putative uncharacterized protein ST0493; hypotheti | 83.14 |
| >2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.78 E-value=9.6e-20 Score=111.22 Aligned_cols=68 Identities=16% Similarity=0.331 Sum_probs=63.0
Q ss_pred EEEeeCCHHHHHhhh---------hc-CCCCHHHHHHHhHhhhcceEeecCCcHHHHHHHHhhcCccccccccccccc
Q psy14279 3 SSEQFCHQFLEALFY---------VI-MDKTFKHLTDILEFMYAGEVNVSQDQLPSFLKTADRLKIKGLAEAPQSSVK 70 (73)
Q Consensus 3 ~VLAa~S~YFr~lf~---------~l-~~v~~~~l~~ll~f~YtG~i~i~~~~v~~ll~aA~~Lqi~~l~~~~~~~~~ 70 (73)
+||||+||||++||. .+ .++++++++.+|+|+|||++.++.+++.+++.+|++|+++++.+.|++..+
T Consensus 46 ~vLaa~S~yF~~mf~~~~~e~~~i~l~~~v~~~~f~~lL~~iYtg~~~i~~~~v~~ll~~A~~~~~~~L~~~C~~~l~ 123 (124)
T 2ihc_A 46 SVLAACSSYFHSRIVGQADGELNITLPEEVTVKGFEPLIQFAYTAKLILSKENVDEVCKCVEFLSVHNIEESCFQFLK 123 (124)
T ss_dssp HHHHHHBHHHHHHHTTC---CEEEECCTTSCHHHHHHHHHHHHHSEEEEETTTHHHHHHHHHHHTBSSCCGGGGGTC-
T ss_pred HHHHHcCHHHHHHHcCCCCCCceEeecCCcCHHHHHHHHHHhcCCCcccCHHHHHHHHHHHHHHCCHHHHHHHHHHHh
Confidence 479999999999998 46 589999999999999999999999999999999999999999999998653
|
| >3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} SCOP: d.42.1.0 PDB: 3ohv_A | Back alignment and structure |
|---|
| >3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} | Back alignment and structure |
|---|
| >3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A | Back alignment and structure |
|---|
| >2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} | Back alignment and structure |
|---|
| >1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A | Back alignment and structure |
|---|
| >2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A | Back alignment and structure |
|---|
| >2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} SCOP: d.42.1.0 | Back alignment and structure |
|---|
| >2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A | Back alignment and structure |
|---|
| >2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} | Back alignment and structure |
|---|
| >3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A | Back alignment and structure |
|---|
| >4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B | Back alignment and structure |
|---|
| >3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} PDB: 4ap2_A* 4apf_A | Back alignment and structure |
|---|
| >3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A | Back alignment and structure |
|---|
| >4ajy_C Transcription elongation factor B polypeptide 1; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 2izv_C 3dcg_B 3zrc_B* 3zrf_B 3ztc_B* 3ztd_B* 3zun_B* 2c9w_C 4awj_B* 4b95_B* 4b9k_B* 2fnj_C 1lqb_B 1lm8_C 2jz3_C 2xai_B 4b9k_E* | Back alignment and structure |
|---|
| >1fs1_B SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.157.1.1 d.42.1.1 PDB: 1fs2_B 1ldk_D | Back alignment and structure |
|---|
| >2p1m_A SKP1-like protein 1A; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_A* 2p1o_A* 2p1p_A* 2p1q_A* 3c6n_A* 3c6o_A* 3c6p_A* 3ogk_A* 3ogl_A* 3ogm_A* | Back alignment and structure |
|---|
| >2fnj_C Transcription elongation factor B polypeptide 1; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.42.1.1 PDB: 1lqb_B 1lm8_C 2jz3_C 2xai_B 2c9w_C 2izv_C 3dcg_B 3zrc_B* 3zrf_B | Back alignment and structure |
|---|
| >1hv2_A Elongin C, ELC1; protein-peptide complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: d.42.1.1 | Back alignment and structure |
|---|
| >3v7d_A Suppressor of kinetochore protein 1; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_A* 3mks_A* | Back alignment and structure |
|---|
| >1vcb_B Protein (elongin C); tumor suppressor, cancer, ubiquitin, beta sandwich, transcription, transcriptional elongation; 2.70A {Homo sapiens} SCOP: d.42.1.1 | Back alignment and structure |
|---|
| >3drz_A BTB/POZ domain-containing protein KCTD5; potassium channel domain T1, pentamer, unkno function; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1s1g_A Potassium voltage-gated channel subfamily D membe; K+ channels, tetramerization domain, T1 domain, transport PR; 2.60A {Homo sapiens} SCOP: d.42.1.2 | Back alignment and structure |
|---|
| >2nz0_B Potassium voltage-gated channel subfamily D membe; KV4.3, kchip1, membrane protein; 3.20A {Homo sapiens} PDB: 2i2r_A | Back alignment and structure |
|---|
| >1nn7_A Potassium channel KV4.2; teteramerization domain, voltage gated potassium channel SHAL, membrane protein; 2.10A {Rattus norvegicus} SCOP: d.42.1.2 | Back alignment and structure |
|---|
| >3drx_A BTB/POZ domain-containing protein KCTD5; golgi, grAsp55, potassium channel domain T1, pentameric assembly, HOST-virus interaction, nucleus; 3.11A {Homo sapiens} PDB: 3dry_A | Back alignment and structure |
|---|
| >3kvt_A Potassium channel protein SHAW; tetramerization domain, molecular recogni zinc-binding; 2.00A {Aplysia californica} SCOP: d.42.1.2 | Back alignment and structure |
|---|
| >1t1d_A Protein (potassium channel KV1.1); potassium channels, tetramerization domain, aplysia KV1.1, proton transport, membrane protein; 1.51A {Aplysia californica} SCOP: d.42.1.2 PDB: 1eod_A 1eof_A 1eoe_A 1a68_A 1qdv_A 1exb_E* 1qdw_A 1dsx_A | Back alignment and structure |
|---|
| >2rbg_A Putative uncharacterized protein ST0493; hypothetical protein, structural genomics, unknown function, NPPSFA; 1.75A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 73 | ||||
| d1buoa_ | 121 | d.42.1.1 (A:) Promyelocytic leukaemia zinc finger | 5e-06 | |
| d1r29a_ | 122 | d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB | 8e-05 |
| >d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 121 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: POZ domain superfamily: POZ domain family: BTB/POZ domain domain: Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain species: Human (Homo sapiens) [TaxId: 9606]
Score = 38.9 bits (90), Expect = 5e-06
Identities = 14/64 (21%), Positives = 23/64 (35%)
Query: 1 MVSSEQFCHQFLEALFYVIMDKTFKHLTDILEFMYAGEVNVSQDQLPSFLKTADRLKIKG 60
S + Y + + K ILE+ Y + + L L A+ L+I+
Sbjct: 49 CTSKMFEILFHRNSQHYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEY 108
Query: 61 LAEA 64
L E
Sbjct: 109 LEEQ 112
|
| >d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 122 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 73 | |||
| d1buoa_ | 121 | Promyelocytic leukaemia zinc finger (PLZF) protein | 99.77 | |
| d1r29a_ | 122 | B-cell lymphoma 6 (Bcl6) protein BTB domain {Human | 99.76 | |
| d2c9wc1 | 96 | Elongin C {Human (Homo sapiens) [TaxId: 9606]} | 97.01 | |
| d1hv2a_ | 99 | Elongin C {Baker's yeast (Saccharomyces cerevisiae | 96.75 | |
| d3kvta_ | 103 | akv3.1 voltage-gated potassium channel {California | 95.12 | |
| d1nn7a_ | 105 | Potassium channel kv4.2 {Rat (Rattus norvegicus) [ | 94.21 | |
| d1fs1b2 | 61 | Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa | 91.69 | |
| d1t1da_ | 100 | Shaker potassium channel {California sea hare (Apl | 87.69 | |
| d1nexa2 | 72 | Centromere DNA-binding protein complex Cbf3 subuni | 87.48 | |
| d1fs1b1 | 55 | Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa | 84.72 | |
| d1nexa1 | 70 | Centromere DNA-binding protein complex Cbf3 subuni | 84.01 |
| >d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: POZ domain superfamily: POZ domain family: BTB/POZ domain domain: Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.77 E-value=8.1e-21 Score=115.45 Aligned_cols=67 Identities=22% Similarity=0.304 Sum_probs=63.7
Q ss_pred EEEeeCCHHHHHhhh------hcCCCCHHHHHHHhHhhhcceEeecCCcHHHHHHHHhhcCcccccccccccc
Q psy14279 3 SSEQFCHQFLEALFY------VIMDKTFKHLTDILEFMYAGEVNVSQDQLPSFLKTADRLKIKGLAEAPQSSV 69 (73)
Q Consensus 3 ~VLAa~S~YFr~lf~------~l~~v~~~~l~~ll~f~YtG~i~i~~~~v~~ll~aA~~Lqi~~l~~~~~~~~ 69 (73)
+|||++||||++||. .++++++++++.+|+|+|||++.++.+++.+++.+|++|+++++.+.|.+..
T Consensus 45 ~vLaa~S~~F~~lf~~~~~~i~~~~v~~~~f~~ll~~~Ytg~i~l~~~~v~~ll~~A~~l~~~~L~~~C~~~L 117 (121)
T d1buoa_ 45 TVLACTSKMFEILFHRNSQHYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLKML 117 (121)
T ss_dssp HHHHHHCHHHHHHTTSCCSEEEECSSCHHHHHHHHHHHHHSCCCCCGGGHHHHHHHHHHHTCHHHHHHHHHHH
T ss_pred HHhcccChhhhhhccCccceeecCCCCHHHHHHHHHheEccccCCcHHHHHHHHHHHHHhCCHHHHHHHHHHH
Confidence 479999999999999 7899999999999999999999999999999999999999999999998754
|
| >d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c9wc1 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hv2a_ d.42.1.1 (A:) Elongin C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d3kvta_ d.42.1.2 (A:) akv3.1 voltage-gated potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} | Back information, alignment and structure |
|---|
| >d1nn7a_ d.42.1.2 (A:) Potassium channel kv4.2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fs1b2 d.42.1.1 (B:2-68) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t1da_ d.42.1.2 (A:) Shaker potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} | Back information, alignment and structure |
|---|
| >d1nexa2 d.42.1.1 (A:4-103) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fs1b1 a.157.1.1 (B:86-140) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nexa1 a.157.1.1 (A:116-185) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|