Psyllid ID: psy14279


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70---
MVSSEQFCHQFLEALFYVIMDKTFKHLTDILEFMYAGEVNVSQDQLPSFLKTADRLKIKGLAEAPQSSVKREG
cccccccccHHHHHHHHHHccccHHHHHHHHccccccEEEEEcccHHHHHHHHHHcccccccccccccccccc
ccccHHcccHHHHHHHHHHHcccHHHHHHHHHHHHccccEccHHHHHHHHHHHHHHccccccccccccccccc
MVSSEQFCHQFLEALFYVIMDKTFKHLTDILEFMYagevnvsqdqlpsFLKTADRLKIKglaeapqssvkreg
MVSSEQFCHQFLEALFYVIMDKTFKHLTDILEFMYAGEVNVSQDQLPSFLKTADRLKIkglaeapqssvkreg
MVSSEQFCHQFLEALFYVIMDKTFKHLTDILEFMYAGEVNVSQDQLPSFLKTADRLKIKGLAEAPQSSVKREG
******FCHQFLEALFYVIMDKTFKHLTDILEFMYAGEVNVSQDQLPSFLKTA********************
***SEQFCHQFLEALFYVIMDKTFKHLTDILEFMYAGEVNVSQDQLPSFLKTADRLKIK**************
MVSSEQFCHQFLEALFYVIMDKTFKHLTDILEFMYAGEVNVSQDQLPSFLKTADRLKIKGLA***********
*****QFCHQFLEALFYVIMDKTFKHLTDILEFMYAGEVNVSQDQLPSFLKTADRLKIKGL************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVSSEQFCHQFLEALFYVIMDKTFKHLTDILEFMYAGEVNVSQDQLPSFLKTADRLKIKGLAEAPQSSVKREG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query73 2.2.26 [Sep-21-2011]
Q7KRI2127 Longitudinals lacking pro yes N/A 0.753 0.433 0.732 4e-17
Q9W0K4 1067 Protein bric-a-brac 2 OS= no N/A 0.876 0.059 0.413 5e-09
Q7KQZ4 787 Longitudinals lacking pro no N/A 0.739 0.068 0.407 2e-07
Q9V5M6 963 Longitudinals lacking pro no N/A 0.739 0.056 0.407 3e-07
P42283 891 Longitudinals lacking pro no N/A 0.739 0.060 0.407 3e-07
Q86B87 610 Modifier of mdg4 OS=Droso no N/A 0.506 0.060 0.594 3e-07
Q9V5M3 878 Longitudinals lacking pro no N/A 0.739 0.061 0.407 4e-07
P42284 549 Longitudinals lacking pro no N/A 0.739 0.098 0.407 4e-07
Q24174 904 Protein abrupt OS=Drosoph no N/A 0.630 0.050 0.521 5e-07
Q867Z4 970 Longitudinals lacking pro no N/A 0.739 0.055 0.407 7e-07
>sp|Q7KRI2|LOLAL_DROME Longitudinals lacking protein-like OS=Drosophila melanogaster GN=lolal PE=1 SV=1 Back     alignment and function desciption
 Score = 86.7 bits (213), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 49/56 (87%), Gaps = 1/56 (1%)

Query: 18  VIMDKTFKHLTDILEFMYAGEVNVSQDQLPSFLKTADRLKIKGLAEAPQSSVKREG 73
           ++ D ++ HL  ILEFMYAGEVNVSQ+QLP+FLKTADRLK+KGLAE P SS+KREG
Sbjct: 73  ILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLAETP-SSIKREG 127




Required, together with Trl, for maintaining the repressed state of target genes including homeotic genes Scr and Ubx. May also be involved in the activation of homeotic genes. Binds to a DNA Polycomb response element (PRE) at the bithorax complex. Also binds to polytene chromosomes at several hundred sites, many of which are shared with Trl and ph-p. Required during embryonic development.
Drosophila melanogaster (taxid: 7227)
>sp|Q9W0K4|BAB2_DROME Protein bric-a-brac 2 OS=Drosophila melanogaster GN=bab2 PE=1 SV=2 Back     alignment and function description
>sp|Q7KQZ4|LOLA3_DROME Longitudinals lacking protein, isoforms A/B/D/L OS=Drosophila melanogaster GN=lola PE=1 SV=1 Back     alignment and function description
>sp|Q9V5M6|LOLA5_DROME Longitudinals lacking protein, isoforms J/P/Q/S/Z OS=Drosophila melanogaster GN=lola PE=1 SV=4 Back     alignment and function description
>sp|P42283|LOLA1_DROME Longitudinals lacking protein, isoform G OS=Drosophila melanogaster GN=lola PE=1 SV=2 Back     alignment and function description
>sp|Q86B87|MMD4_DROME Modifier of mdg4 OS=Drosophila melanogaster GN=mod(mdg4) PE=1 SV=1 Back     alignment and function description
>sp|Q9V5M3|LOLA6_DROME Longitudinals lacking protein, isoforms N/O/W/X/Y OS=Drosophila melanogaster GN=lola PE=1 SV=3 Back     alignment and function description
>sp|P42284|LOLA2_DROME Longitudinals lacking protein, isoforms H/M/V OS=Drosophila melanogaster GN=lola PE=1 SV=2 Back     alignment and function description
>sp|Q24174|ABRU_DROME Protein abrupt OS=Drosophila melanogaster GN=ab PE=1 SV=2 Back     alignment and function description
>sp|Q867Z4|LOLA4_DROME Longitudinals lacking protein, isoforms F/I/K/T OS=Drosophila melanogaster GN=lola PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query73
242010402127 abrupt protein, putative [Pediculus huma 0.753 0.433 0.785 4e-17
156550568127 PREDICTED: longitudinals lacking protein 0.753 0.433 0.732 7e-16
110756044127 PREDICTED: longitudinals lacking protein 0.753 0.433 0.732 7e-16
322802841109 hypothetical protein SINV_10955 [Solenop 0.753 0.504 0.732 7e-16
17865642127 lola like, isoform A [Drosophila melanog 0.753 0.433 0.732 2e-15
195150907126 GL10513 [Drosophila persimilis] gi|19533 0.753 0.436 0.732 2e-15
31200901126 AGAP011247-PA [Anopheles gambiae str. PE 0.753 0.436 0.696 2e-15
225717820128 Longitudinals lacking protein-like [Cali 0.739 0.421 0.727 2e-15
225719214128 Longitudinals lacking protein-like [Cali 0.739 0.421 0.727 3e-15
157125571126 abrupt protein [Aedes aegypti] gi|157125 0.753 0.436 0.696 3e-15
>gi|242010402|ref|XP_002425957.1| abrupt protein, putative [Pediculus humanus corporis] gi|212509940|gb|EEB13219.1| abrupt protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score = 92.0 bits (227), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 44/56 (78%), Positives = 49/56 (87%), Gaps = 1/56 (1%)

Query: 18  VIMDKTFKHLTDILEFMYAGEVNVSQDQLPSFLKTADRLKIKGLAEAPQSSVKREG 73
           ++ D  F HL  ILEFMYAGEVNVSQDQLP+FLKTADRLK+KGLAEAPQ S+KREG
Sbjct: 73  ILKDVPFSHLQAILEFMYAGEVNVSQDQLPAFLKTADRLKVKGLAEAPQ-SIKREG 127




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|156550568|ref|XP_001603477.1| PREDICTED: longitudinals lacking protein-like isoform 1 [Nasonia vitripennis] gi|345488630|ref|XP_003425953.1| PREDICTED: longitudinals lacking protein-like isoform 2 [Nasonia vitripennis] gi|307166782|gb|EFN60744.1| Longitudinals lacking protein-like [Camponotus floridanus] gi|307207491|gb|EFN85202.1| Longitudinals lacking protein-like [Harpegnathos saltator] gi|332021216|gb|EGI61601.1| Longitudinals lacking protein-like protein [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|110756044|ref|XP_001120198.1| PREDICTED: longitudinals lacking protein-like [Apis mellifera] gi|340712770|ref|XP_003394928.1| PREDICTED: longitudinals lacking protein-like [Bombus terrestris] gi|350409197|ref|XP_003488648.1| PREDICTED: longitudinals lacking protein-like [Bombus impatiens] gi|380021548|ref|XP_003694625.1| PREDICTED: longitudinals lacking protein-like [Apis florea] gi|383847541|ref|XP_003699411.1| PREDICTED: longitudinals lacking protein-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|322802841|gb|EFZ23037.1| hypothetical protein SINV_10955 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|17865642|ref|NP_524778.1| lola like, isoform A [Drosophila melanogaster] gi|24654826|ref|NP_725756.1| lola like, isoform B [Drosophila melanogaster] gi|24654830|ref|NP_725757.1| lola like, isoform C [Drosophila melanogaster] gi|24654834|ref|NP_725758.1| lola like, isoform D [Drosophila melanogaster] gi|281363640|ref|NP_001163186.1| lola like, isoform E [Drosophila melanogaster] gi|386768235|ref|NP_001246402.1| lola like, isoform F [Drosophila melanogaster] gi|386768237|ref|NP_001246403.1| lola like, isoform G [Drosophila melanogaster] gi|194753378|ref|XP_001958989.1| GF12279 [Drosophila ananassae] gi|194880979|ref|XP_001974626.1| GG20988 [Drosophila erecta] gi|195123556|ref|XP_002006271.1| GI20951 [Drosophila mojavensis] gi|195381699|ref|XP_002049583.1| GJ20673 [Drosophila virilis] gi|195429549|ref|XP_002062820.1| GK19492 [Drosophila willistoni] gi|195487586|ref|XP_002091971.1| GE13931 [Drosophila yakuba] gi|195584489|ref|XP_002082037.1| GD25412 [Drosophila simulans] gi|73621174|sp|Q7KRI2.1|LOLAL_DROME RecName: Full=Longitudinals lacking protein-like; Short=Lola-like protein; AltName: Full=Protein Batman gi|12007119|gb|AAG45054.1|AF308476_1 batman protein [Drosophila melanogaster] gi|7302659|gb|AAF57739.1| lola like, isoform A [Drosophila melanogaster] gi|16648276|gb|AAL25403.1| LD14505p [Drosophila melanogaster] gi|21626476|gb|AAM68179.1| lola like, isoform B [Drosophila melanogaster] gi|21626477|gb|AAM68180.1| lola like, isoform C [Drosophila melanogaster] gi|21626478|gb|AAM68181.1| lola like, isoform D [Drosophila melanogaster] gi|190620287|gb|EDV35811.1| GF12279 [Drosophila ananassae] gi|190657813|gb|EDV55026.1| GG20988 [Drosophila erecta] gi|193911339|gb|EDW10206.1| GI20951 [Drosophila mojavensis] gi|194144380|gb|EDW60776.1| GJ20673 [Drosophila virilis] gi|194158905|gb|EDW73806.1| GK19492 [Drosophila willistoni] gi|194178072|gb|EDW91683.1| GE13931 [Drosophila yakuba] gi|194194046|gb|EDX07622.1| GD25412 [Drosophila simulans] gi|220942400|gb|ACL83743.1| lolal-PA [synthetic construct] gi|220952644|gb|ACL88865.1| lolal-PA [synthetic construct] gi|257286279|gb|ACV53086.1| MIP07390p [Drosophila melanogaster] gi|272432537|gb|ACZ94458.1| lola like, isoform E [Drosophila melanogaster] gi|289741675|gb|ADD19585.1| hypothetical conserved protein [Glossina morsitans morsitans] gi|383302569|gb|AFH08155.1| lola like, isoform F [Drosophila melanogaster] gi|383302570|gb|AFH08156.1| lola like, isoform G [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195150907|ref|XP_002016391.1| GL10513 [Drosophila persimilis] gi|195335493|ref|XP_002034398.1| GM19923 [Drosophila sechellia] gi|198457686|ref|XP_001360761.2| GA19096 [Drosophila pseudoobscura pseudoobscura] gi|194110238|gb|EDW32281.1| GL10513 [Drosophila persimilis] gi|194126368|gb|EDW48411.1| GM19923 [Drosophila sechellia] gi|198136068|gb|EAL25336.2| GA19096 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|31200901|ref|XP_309398.1| AGAP011247-PA [Anopheles gambiae str. PEST] gi|30178468|gb|EAA05153.2| AGAP011247-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|225717820|gb|ACO14756.1| Longitudinals lacking protein-like [Caligus clemensi] Back     alignment and taxonomy information
>gi|225719214|gb|ACO15453.1| Longitudinals lacking protein-like [Caligus clemensi] Back     alignment and taxonomy information
>gi|157125571|ref|XP_001654392.1| abrupt protein [Aedes aegypti] gi|157125573|ref|XP_001654393.1| abrupt protein [Aedes aegypti] gi|170037621|ref|XP_001846655.1| BTB/POZ and Kelch domain-containing protein [Culex quinquefasciatus] gi|94468928|gb|ABF18313.1| BTB/POZ and Kelch domain-containing protein [Aedes aegypti] gi|108873571|gb|EAT37796.1| AAEL010244-PA [Aedes aegypti] gi|108873572|gb|EAT37797.1| AAEL010244-PB [Aedes aegypti] gi|167880866|gb|EDS44249.1| BTB/POZ and Kelch domain-containing protein [Culex quinquefasciatus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query73
FB|FBgn0022238127 lolal "lola like" [Drosophila 0.753 0.433 0.732 8.6e-17
FB|FBgn0263108 798 BtbVII "BTB-protein-VII" [Dros 0.794 0.072 0.477 7.3e-09
FB|FBgn0029824 676 CG3726 [Drosophila melanogaste 0.630 0.068 0.586 2.6e-08
FB|FBgn0025525 1067 bab2 "bric a brac 2" [Drosophi 0.876 0.059 0.44 2e-07
FB|FBgn0264981 1089 mamo "maternal gene required f 0.945 0.063 0.459 2.1e-07
FB|FBgn0002781 610 mod(mdg4) "modifier of mdg4" [ 0.547 0.065 0.581 3.4e-07
FB|FBgn0004870 977 bab1 "bric a brac 1" [Drosophi 0.630 0.047 0.531 1.1e-06
FB|FBgn0005630 970 lola "longitudinals lacking" [ 0.643 0.048 0.446 1.6e-06
FB|FBgn0264442 904 ab "abrupt" [Drosophila melano 0.630 0.050 0.521 2.5e-06
FB|FBgn0004652 955 fru "fruitless" [Drosophila me 0.739 0.056 0.418 2.6e-06
FB|FBgn0022238 lolal "lola like" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 207 (77.9 bits), Expect = 8.6e-17, P = 8.6e-17
 Identities = 41/56 (73%), Positives = 49/56 (87%)

Query:    18 VIMDKTFKHLTDILEFMYAGEVNVSQDQLPSFLKTADRLKIKGLAEAPQSSVKREG 73
             ++ D ++ HL  ILEFMYAGEVNVSQ+QLP+FLKTADRLK+KGLAE P SS+KREG
Sbjct:    73 ILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLAETP-SSIKREG 127




GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0005634 "nucleus" evidence=ISS
GO:0006357 "regulation of transcription from RNA polymerase II promoter" evidence=ISS
GO:0006342 "chromatin silencing" evidence=IMP
GO:0016458 "gene silencing" evidence=IMP
GO:0031519 "PcG protein complex" evidence=IPI
GO:0005515 "protein binding" evidence=IPI
GO:0007426 "tracheal outgrowth, open tracheal system" evidence=IMP
GO:0007435 "salivary gland morphogenesis" evidence=IMP
FB|FBgn0263108 BtbVII "BTB-protein-VII" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0029824 CG3726 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0025525 bab2 "bric a brac 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0264981 mamo "maternal gene required for meiosis" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0002781 mod(mdg4) "modifier of mdg4" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0004870 bab1 "bric a brac 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0005630 lola "longitudinals lacking" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0264442 ab "abrupt" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0004652 fru "fruitless" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q7KRI2LOLAL_DROMENo assigned EC number0.73210.75340.4330yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query73
smart0022597 smart00225, BTB, Broad-Complex, Tramtrack and Bric 3e-07
pfam00651101 pfam00651, BTB, BTB/POZ domain 1e-05
>gnl|CDD|197585 smart00225, BTB, Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
 Score = 43.1 bits (102), Expect = 3e-07
 Identities = 13/48 (27%), Positives = 27/48 (56%)

Query: 17 YVIMDKTFKHLTDILEFMYAGEVNVSQDQLPSFLKTADRLKIKGLAEA 64
            + D + +    +L F+Y G++++ ++ +   L+ AD L+I GL E 
Sbjct: 41 IYLDDVSPEDFRALLNFLYTGKLDLPEENVEELLELADYLQIPGLVEL 88


Domain in Broad-Complex, Tramtrack and Bric a brac. Also known as POZ (poxvirus and zinc finger) domain. Known to be a protein-protein interaction motif found at the N-termini of several C2H2-type transcription factors as well as Shaw-type potassium channels. Known structure reveals a tightly intertwined dimer formed via interactions between N-terminal strand and helix structures. However in a subset of BTB/POZ domains, these two secondary structures appear to be missing. Be aware SMART predicts BTB/POZ domains without the beta1- and alpha1-secondary structures. Length = 97

>gnl|CDD|216043 pfam00651, BTB, BTB/POZ domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 73
PHA02790 480 Kelch-like protein; Provisional 99.83
KOG4441|consensus 571 99.76
PHA02713 557 hypothetical protein; Provisional 99.72
PHA03098 534 kelch-like protein; Provisional 99.63
PF00651111 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB ( 99.53
smart0022590 BTB Broad-Complex, Tramtrack and Bric a brac. Doma 99.49
KOG4350|consensus 620 98.62
KOG2075|consensus 521 98.12
KOG4682|consensus 488 98.0
KOG4591|consensus 280 97.44
KOG0783|consensus 1267 97.32
KOG2716|consensus 230 96.83
KOG0783|consensus 1267 96.76
smart00512104 Skp1 Found in Skp1 protein family. Family of Skp1 96.51
PF0221494 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassi 96.21
KOG1665|consensus 302 95.77
KOG1724|consensus162 95.51
KOG3473|consensus112 93.5
PF11822 317 DUF3342: Domain of unknown function (DUF3342); Int 92.52
PF0393162 Skp1_POZ: Skp1 family, tetramerisation domain; Int 91.58
KOG2838|consensus401 91.12
KOG0511|consensus 516 90.11
PF0146678 Skp1: Skp1 family, dimerisation domain; InterPro: 85.35
KOG2714|consensus 465 84.37
KOG3840|consensus 438 82.96
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
Probab=99.83  E-value=1.6e-21  Score=142.66  Aligned_cols=67  Identities=12%  Similarity=0.202  Sum_probs=62.5

Q ss_pred             EEEeeCCHHHHHhhh----------hc--CCCCHHHHHHHhHhhhcceEeecCCcHHHHHHHHhhcCcccccccccccc
Q psy14279          3 SSEQFCHQFLEALFY----------VI--MDKTFKHLTDILEFMYAGEVNVSQDQLPSFLKTADRLKIKGLAEAPQSSV   69 (73)
Q Consensus         3 ~VLAa~S~YFr~lf~----------~l--~~v~~~~l~~ll~f~YtG~i~i~~~~v~~ll~aA~~Lqi~~l~~~~~~~~   69 (73)
                      +||||||||||+||+          .+  .|+++++|+.||+|+|||++.|+.+|++++++||++||++.+.+.|++..
T Consensus        38 ~VLAa~S~YFraMF~~~~~Es~~~v~~~~~~v~~~~l~~lldy~YTg~l~it~~nV~~ll~aA~~Lqi~~v~~~C~~fL  116 (480)
T PHA02790         38 TILKKLSPYFRTHLRQKYTKNKDPVTRVCLDLDIHSLTSIVIYSYTGKVYIDSHNVVNLLRASILTSVEFIIYTCINFI  116 (480)
T ss_pred             hhhhhcCHHHHHHhcCCccccccceEEEecCcCHHHHHHHHHhheeeeEEEecccHHHHHHHHHHhChHHHHHHHHHHH
Confidence            589999999999998          23  38999999999999999999999999999999999999999999998863



>KOG4441|consensus Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PF00651 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB (for BR-C, ttk and bab) [] or POZ (for Pox virus and Zinc finger) [] domain is present near the N terminus of a fraction of zinc finger (IPR007087 from INTERPRO) proteins and in proteins that contain the IPR006652 from INTERPRO motif such as Kelch and a family of pox virus proteins Back     alignment and domain information
>smart00225 BTB Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
>KOG4350|consensus Back     alignment and domain information
>KOG2075|consensus Back     alignment and domain information
>KOG4682|consensus Back     alignment and domain information
>KOG4591|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG2716|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>smart00512 Skp1 Found in Skp1 protein family Back     alignment and domain information
>PF02214 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassium channels are the most diverse group of the ion channel family [, ] Back     alignment and domain information
>KOG1665|consensus Back     alignment and domain information
>KOG1724|consensus Back     alignment and domain information
>KOG3473|consensus Back     alignment and domain information
>PF11822 DUF3342: Domain of unknown function (DUF3342); InterPro: IPR021777 This family of proteins are functionally uncharacterised Back     alignment and domain information
>PF03931 Skp1_POZ: Skp1 family, tetramerisation domain; InterPro: IPR016073 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] Back     alignment and domain information
>KOG2838|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>PF01466 Skp1: Skp1 family, dimerisation domain; InterPro: IPR016072 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] Back     alignment and domain information
>KOG2714|consensus Back     alignment and domain information
>KOG3840|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query73
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 5e-05
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 5e-04
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 5e-04
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} Length = 119 Back     alignment and structure
 Score = 37.2 bits (87), Expect = 5e-05
 Identities = 18/62 (29%), Positives = 26/62 (41%), Gaps = 3/62 (4%)

Query: 3   SSEQFCHQFLEALFYVIMDKTFKHLTDILEFMYAGEVNVSQDQLPSFLKTADRLKIKGLA 62
            S+Q   +   AL   I   TF  L   L F+Y   V +   +L    + A  L ++ L 
Sbjct: 52  VSQQLGRRGQWALGEGISPSTFAQL---LNFVYGESVELQPGELRPLQEAARALGVQSLE 108

Query: 63  EA 64
           EA
Sbjct: 109 EA 110


>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} PDB: 3ohv_A Length = 125 Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Length = 127 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query73
2ihc_A124 Transcription regulator protein BACH1; BRIC-A-BRAC 99.78
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 99.78
3b84_A119 Zinc finger and BTB domain-containing protein 48; 99.77
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 99.77
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 99.77
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 99.75
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 99.75
2vpk_A116 Myoneurin; transcription regulation, transcription 99.75
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 99.75
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 99.75
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 99.75
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 99.74
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 99.74
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 99.74
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 99.69
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 99.67
3hve_A 256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 99.66
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 99.64
3i3n_A 279 Kelch-like protein 11; structural genomics, BTB, K 99.63
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 99.53
2ast_A159 S-phase kinase-associated protein 1A; SCF-substrat 99.3
4ajy_C97 Transcription elongation factor B polypeptide 1; E 99.18
1fs1_B141 SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, le 99.01
2p1m_A160 SKP1-like protein 1A; F-BOX, leucine rich repeat, 98.98
2fnj_C96 Transcription elongation factor B polypeptide 1; b 98.28
1hv2_A99 Elongin C, ELC1; protein-peptide complex, signalin 98.08
3v7d_A169 Suppressor of kinetochore protein 1; WD 40 domain, 97.98
1vcb_B112 Protein (elongin C); tumor suppressor, cancer, ubi 97.61
3drz_A107 BTB/POZ domain-containing protein KCTD5; potassium 97.23
1s1g_A124 Potassium voltage-gated channel subfamily D membe; 95.72
2nz0_B140 Potassium voltage-gated channel subfamily D membe; 95.65
1nn7_A105 Potassium channel KV4.2; teteramerization domain, 94.69
3drx_A202 BTB/POZ domain-containing protein KCTD5; golgi, gr 94.63
3kvt_A115 Potassium channel protein SHAW; tetramerization do 94.42
1t1d_A100 Protein (potassium channel KV1.1); potassium chann 92.85
2rbg_A126 Putative uncharacterized protein ST0493; hypotheti 83.14
>2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Back     alignment and structure
Probab=99.78  E-value=9.6e-20  Score=111.22  Aligned_cols=68  Identities=16%  Similarity=0.331  Sum_probs=63.0

Q ss_pred             EEEeeCCHHHHHhhh---------hc-CCCCHHHHHHHhHhhhcceEeecCCcHHHHHHHHhhcCccccccccccccc
Q psy14279          3 SSEQFCHQFLEALFY---------VI-MDKTFKHLTDILEFMYAGEVNVSQDQLPSFLKTADRLKIKGLAEAPQSSVK   70 (73)
Q Consensus         3 ~VLAa~S~YFr~lf~---------~l-~~v~~~~l~~ll~f~YtG~i~i~~~~v~~ll~aA~~Lqi~~l~~~~~~~~~   70 (73)
                      +||||+||||++||.         .+ .++++++++.+|+|+|||++.++.+++.+++.+|++|+++++.+.|++..+
T Consensus        46 ~vLaa~S~yF~~mf~~~~~e~~~i~l~~~v~~~~f~~lL~~iYtg~~~i~~~~v~~ll~~A~~~~~~~L~~~C~~~l~  123 (124)
T 2ihc_A           46 SVLAACSSYFHSRIVGQADGELNITLPEEVTVKGFEPLIQFAYTAKLILSKENVDEVCKCVEFLSVHNIEESCFQFLK  123 (124)
T ss_dssp             HHHHHHBHHHHHHHTTC---CEEEECCTTSCHHHHHHHHHHHHHSEEEEETTTHHHHHHHHHHHTBSSCCGGGGGTC-
T ss_pred             HHHHHcCHHHHHHHcCCCCCCceEeecCCcCHHHHHHHHHHhcCCCcccCHHHHHHHHHHHHHHCCHHHHHHHHHHHh
Confidence            479999999999998         46 589999999999999999999999999999999999999999999998653



>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} SCOP: d.42.1.0 PDB: 3ohv_A Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Back     alignment and structure
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Back     alignment and structure
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} SCOP: d.42.1.0 Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Back     alignment and structure
>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Back     alignment and structure
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} PDB: 4ap2_A* 4apf_A Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Back     alignment and structure
>4ajy_C Transcription elongation factor B polypeptide 1; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 2izv_C 3dcg_B 3zrc_B* 3zrf_B 3ztc_B* 3ztd_B* 3zun_B* 2c9w_C 4awj_B* 4b95_B* 4b9k_B* 2fnj_C 1lqb_B 1lm8_C 2jz3_C 2xai_B 4b9k_E* Back     alignment and structure
>1fs1_B SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.157.1.1 d.42.1.1 PDB: 1fs2_B 1ldk_D Back     alignment and structure
>2p1m_A SKP1-like protein 1A; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_A* 2p1o_A* 2p1p_A* 2p1q_A* 3c6n_A* 3c6o_A* 3c6p_A* 3ogk_A* 3ogl_A* 3ogm_A* Back     alignment and structure
>2fnj_C Transcription elongation factor B polypeptide 1; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.42.1.1 PDB: 1lqb_B 1lm8_C 2jz3_C 2xai_B 2c9w_C 2izv_C 3dcg_B 3zrc_B* 3zrf_B Back     alignment and structure
>1hv2_A Elongin C, ELC1; protein-peptide complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: d.42.1.1 Back     alignment and structure
>3v7d_A Suppressor of kinetochore protein 1; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_A* 3mks_A* Back     alignment and structure
>1vcb_B Protein (elongin C); tumor suppressor, cancer, ubiquitin, beta sandwich, transcription, transcriptional elongation; 2.70A {Homo sapiens} SCOP: d.42.1.1 Back     alignment and structure
>3drz_A BTB/POZ domain-containing protein KCTD5; potassium channel domain T1, pentamer, unkno function; 1.90A {Homo sapiens} Back     alignment and structure
>1s1g_A Potassium voltage-gated channel subfamily D membe; K+ channels, tetramerization domain, T1 domain, transport PR; 2.60A {Homo sapiens} SCOP: d.42.1.2 Back     alignment and structure
>2nz0_B Potassium voltage-gated channel subfamily D membe; KV4.3, kchip1, membrane protein; 3.20A {Homo sapiens} PDB: 2i2r_A Back     alignment and structure
>1nn7_A Potassium channel KV4.2; teteramerization domain, voltage gated potassium channel SHAL, membrane protein; 2.10A {Rattus norvegicus} SCOP: d.42.1.2 Back     alignment and structure
>3drx_A BTB/POZ domain-containing protein KCTD5; golgi, grAsp55, potassium channel domain T1, pentameric assembly, HOST-virus interaction, nucleus; 3.11A {Homo sapiens} PDB: 3dry_A Back     alignment and structure
>3kvt_A Potassium channel protein SHAW; tetramerization domain, molecular recogni zinc-binding; 2.00A {Aplysia californica} SCOP: d.42.1.2 Back     alignment and structure
>1t1d_A Protein (potassium channel KV1.1); potassium channels, tetramerization domain, aplysia KV1.1, proton transport, membrane protein; 1.51A {Aplysia californica} SCOP: d.42.1.2 PDB: 1eod_A 1eof_A 1eoe_A 1a68_A 1qdv_A 1exb_E* 1qdw_A 1dsx_A Back     alignment and structure
>2rbg_A Putative uncharacterized protein ST0493; hypothetical protein, structural genomics, unknown function, NPPSFA; 1.75A {Sulfolobus tokodaii} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 73
d1buoa_121 d.42.1.1 (A:) Promyelocytic leukaemia zinc finger 5e-06
d1r29a_122 d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB 8e-05
>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 121 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: POZ domain
superfamily: POZ domain
family: BTB/POZ domain
domain: Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 38.9 bits (90), Expect = 5e-06
 Identities = 14/64 (21%), Positives = 23/64 (35%)

Query: 1   MVSSEQFCHQFLEALFYVIMDKTFKHLTDILEFMYAGEVNVSQDQLPSFLKTADRLKIKG 60
             S          +  Y +   + K    ILE+ Y   +    + L   L  A+ L+I+ 
Sbjct: 49  CTSKMFEILFHRNSQHYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEY 108

Query: 61  LAEA 64
           L E 
Sbjct: 109 LEEQ 112


>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query73
d1buoa_121 Promyelocytic leukaemia zinc finger (PLZF) protein 99.77
d1r29a_122 B-cell lymphoma 6 (Bcl6) protein BTB domain {Human 99.76
d2c9wc196 Elongin C {Human (Homo sapiens) [TaxId: 9606]} 97.01
d1hv2a_99 Elongin C {Baker's yeast (Saccharomyces cerevisiae 96.75
d3kvta_103 akv3.1 voltage-gated potassium channel {California 95.12
d1nn7a_105 Potassium channel kv4.2 {Rat (Rattus norvegicus) [ 94.21
d1fs1b261 Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa 91.69
d1t1da_100 Shaker potassium channel {California sea hare (Apl 87.69
d1nexa272 Centromere DNA-binding protein complex Cbf3 subuni 87.48
d1fs1b155 Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa 84.72
d1nexa170 Centromere DNA-binding protein complex Cbf3 subuni 84.01
>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: POZ domain
superfamily: POZ domain
family: BTB/POZ domain
domain: Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.77  E-value=8.1e-21  Score=115.45  Aligned_cols=67  Identities=22%  Similarity=0.304  Sum_probs=63.7

Q ss_pred             EEEeeCCHHHHHhhh------hcCCCCHHHHHHHhHhhhcceEeecCCcHHHHHHHHhhcCcccccccccccc
Q psy14279          3 SSEQFCHQFLEALFY------VIMDKTFKHLTDILEFMYAGEVNVSQDQLPSFLKTADRLKIKGLAEAPQSSV   69 (73)
Q Consensus         3 ~VLAa~S~YFr~lf~------~l~~v~~~~l~~ll~f~YtG~i~i~~~~v~~ll~aA~~Lqi~~l~~~~~~~~   69 (73)
                      +|||++||||++||.      .++++++++++.+|+|+|||++.++.+++.+++.+|++|+++++.+.|.+..
T Consensus        45 ~vLaa~S~~F~~lf~~~~~~i~~~~v~~~~f~~ll~~~Ytg~i~l~~~~v~~ll~~A~~l~~~~L~~~C~~~L  117 (121)
T d1buoa_          45 TVLACTSKMFEILFHRNSQHYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLKML  117 (121)
T ss_dssp             HHHHHHCHHHHHHTTSCCSEEEECSSCHHHHHHHHHHHHHSCCCCCGGGHHHHHHHHHHHTCHHHHHHHHHHH
T ss_pred             HHhcccChhhhhhccCccceeecCCCCHHHHHHHHHheEccccCCcHHHHHHHHHHHHHhCCHHHHHHHHHHH
Confidence            479999999999999      7899999999999999999999999999999999999999999999998754



>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c9wc1 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv2a_ d.42.1.1 (A:) Elongin C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3kvta_ d.42.1.2 (A:) akv3.1 voltage-gated potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure
>d1nn7a_ d.42.1.2 (A:) Potassium channel kv4.2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fs1b2 d.42.1.1 (B:2-68) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1da_ d.42.1.2 (A:) Shaker potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure
>d1nexa2 d.42.1.1 (A:4-103) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fs1b1 a.157.1.1 (B:86-140) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexa1 a.157.1.1 (A:116-185) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure