Psyllid ID: psy14307


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230-----
MLLRTTVFEYLVLVRQQFLKPFLLMKLDLEKVRPVQTYVAYGTDITVPTNIYNVQCFSSTTVEHSRRPKNTQLHQDSSHGNILETKPPNLLQQNKSHENIPENSETPTPNLDGTGQLNDNNKSVIKWFLENVECLLDYLVQQKETANVNSADLVNNRENVVKPVERKDGKETTEKETGKIAGNGTTKEETEGTFAKLADSETNPTEVAERTAPESSKRTDSKEDIENRVDNNDGTIATDEALKAIESQRRVKRRAAKTRDKIKENIDPELGNLSDLNEDLKKPGEPEVQTPIVPEPTKQELPEVPETTKPQLPEVPEPTKSQLPEVPEPTKPQLPEVLEPTTLQLPEDPEPTKPQLPEDPEPTKPQLPEVPEPTKPQLPEVLEPTKLQLPEDPEPTKPQLPEDPETTKPQLPEVPEPTKLQLPEVPEPTKPELPEVPELTKTQLPEVPEPTKPQILDKKEPVLLDKKEPVLLDKKEPVLPPKPEPEILLPPKPEPELLLPPKPEPELLLPPKLEPKLLLPPKSEPELLLPPKPEPELLLPPKPKPELLLPPKPEPEKLLLPPKPKPKLLLPPKPESELLLPPKPEPELIIPPKPEPEILIPPKPEPELLLPPKPEPEILLPPKPEPELLLPPKPEPEILLPPKPEPELLLPPKPESELLLPLKPEPEILLPPKPEPELLLPPKPEPELLLPPKPETITTTKTLLLDKKEPVLLDKKEPVLLDKKEPVLLDKKEPVLLDKKEPVLLDEKEPVLLDKKEPVLLDKKERVLLDKKEPVLLDKKEPVLLDKKEHVLLDKKETVLLDKKEPVLLDKKEPILLDKKEPVLLDKKEPVLLDKKSPVLLDKKGPVILDKKEPVLLDKKEPVLLDKKEPVLLDKKAPVLLDKKEPVLLDKKEPVLLDKKEPVLLDKKEPILFEKAALKVQTKPEVFKVPPKDKDEDEPIFFNEPKSPPEKPHHSPIPPPPPVLNPPNSELVYKDKYTGVGGYFGAVPEIGQNYYFHQNQSQNYYYHQNLSQNYYYHQNLSLKYYCRRNLSQNYYCHQNQSPNNYYYHLNLSQNYYFHQNQSQNYYYHQNLSQNYYYHQNLSLKYYCRRNLSQNYYCHQNQSQNYYYHQNQSQNYYYHQNQSQKYYYHQNLSQNYYYHQNLSQNYYCHQNQSQNYYYHQNQSQKYYYHQNLSQNCYYHQNRSQNYYYHQNLSQNYYYHQNQSQKNYYYHLNLSQNYYYHQNLSQNYYYHQNSFTS
cccHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEcccccccccEEEEEEEccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccHHHHHHHHHHHHHHHHHHHHHHHHccHHcccccEEEEEEccccEccccEEEcccccccEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
MLLRTTVFEYLVLVRQQFLKPfllmkldlekvrpvqtyvaygtditvptniynvqcfssttvehsrrpkntqlhqdsshgniletkppnllqqnkshenipensetptpnldgtgqlndnNKSVIKWFLENVECLLDYLVQQKEtanvnsadlvnnrenvvkpverkdgketteketgkiagngttkeetegtfakladsetnptevaertapesskrtdskedienrvdnndgtiaTDEALKAIESQRRVKRRAAKTRDKikenidpelgnlsdlnedlkkpgepevqtpivpeptkqelpevpettkpqlpevpeptksqlpevpeptkpqlpevlepttlqlpedpeptkpqlpedpeptkpqlpevpeptkpqlpevleptklqlpedpeptkpqlpedpettkpqlpevpeptklqlpevpeptkpelpevpeltktqlpevpeptkpqildkkepvlldkkepvlldkkepvlppkpepeillppkpepelllppkpepelllppklepklllppksepelllppkpepelllppkpkpelllppkpepeklllppkpkpklllppkpeselllppkpepeliippkpepeilippkpepelllppkpepeillppkpepelllppkpepeillppkpepelllppkpeselllplkpepeillppkpepelllppkpepelllppkpetitTTKTllldkkepvlldkkepvlldkkepvlldkkepvlldkkepvlldekepvlldkkepvlldkkervlldkkepvlldkkepvlldkkehvlldkketvlldkkepvlldkkepilldkkepvlldkkepvlldkkspvlldkkgpvildkkepvlldkkepvlldkkepvlldkkapvlldkkepvlldkkepvlldkkepvlldkkepiLFEKAALkvqtkpevfkvppkdkdedepiffnepksppekphhspipppppvlnppnselvykdkytgvggyfgavpeigqnyyfhqnqsqnyyyhqNLSQNYYYHQNLSLKYYCRRNlsqnyychqnqspnnyyyHLNLSQNYYFHQNQSQNYYYHQNLSQNYYYHQNLSLKYYCRRNlsqnyychqnqsqnyyyhqnqsqnyyyhqnqsqkyYYHQNLSQNYYYHqnlsqnyychqnqsqnyyyhqnqsqkyyyhqnlsqncyyhqnrsqnyyYHQNLSQNYYYHQNQSQKNYYYHLNLSQNYYYHQNLsqnyyyhqnsfts
MLLRTTVFEYLVLVRQQFLKPFLLMKLDLEKVRPVQTYVAYgtditvptniYNVQCFSsttvehsrrpKNTQLHQDSSHGNILETKPPNLLQQNKSHENIPENSETPTPNLDGTGQLNDNNKSVIKWFLENVECLLDYLVQQKEtanvnsadlvnnrenvvkpverkdgketteketgkiagngttkeetegtfakladsetnptevaertapesskrtdskedienrvdnndgtiatdealkaiesqrrvkrraaktrdkikenidpelgnlsdlnedlkKPGEpevqtpivpeptkqelpevpettkpqlpevpeptksqlpevpeptkpqlPEVLEPTTLQLPEDPEPTKPQLPEDPEPTKPQLPEVPEPTKPQLPEVLEPTKLQLPEDPEPTkpqlpedpettkpqlpevpeptklqlpevpeptkpelpevpeltktqlpevpeptkpqildkkepvlldkkepvlldkkepvlppkpepeillppkpEPELLLPPKPEPELLLPPKLEPKLLLPPKSEPELLLPPKPEPELLLPPKPKPELLLPPKPEPEKLLLPPKPKPKLLLPPKPESELLLPPKPEPELIIPPKPEPEILIPPKPEPELLLPPKPEPEILLPPKPEPELLLPPKPEPEILLPPKPEPELLLPPKPESELLLPLKPEPEILLPPKPEPELLLPPKpepelllppkpeTITTtktllldkkepvlldkkepvlldkkepvlldkkepvlldkkepvlldekepvlldkkepvlldkkervlldkkepvlldkkepvlldkkehvlldkketvlldkkepvlldkkepilldkkepvlldkkepvlldkkspvlldkkgpvildkkepvlldkkepvlldkkepvlldkkapvlldkkepvlldkkepvlldkkepvlldkkepilfekaalkvqtkpevfkvppkdkdedePIFFNEPKSPPEKPHHSPIPPPPPVLNPPNSELVYKDKYTGVGGYFGAVPEIGQNYYFHQNQSQNYYYHQNLSQNYYYHQNLSLKYYCRRNLSQNYYCHQNQSPNNYYYHLNLSQNYYFHQNQSQNYYYHQNLSQNYYYHQNLSLKYYCRRNLSQNYYCHQNQSQNYYYHQNQSQNYYYHQNQSQKYYYHQNLSQNYYYHQNLSQNYYCHQNQSQNYYYHQNQSQKYYYHQNLSQNCYYHQNRSQNYYYHQNLSQNYYYHQNQSQKNYYYHLNLSQNYYYHQNLSQNYYYHQNSFTS
MLLRTTVFEYLVLVRQQFLKPFLLMKLDLEKVRPVQTYVAYGTDITVPTNIYNVQCFSSTTVEHSRRPKNTQLHQDSSHGNILETKPPNLLQQNKSHENIPENSETPTPNLDGTGQLNDNNKSVIKWFLENVECLLDYLVQQKETANVNSADLVNNRENVVKPVERKDGKETTEKETGKIAgngttkeetegtFAKLADSETNPTEVAERTAPESSKRTDSKEDIENRVDNNDGTIATDEALKAIESQRRVKRRAAKTRDKIKENIDPELGNLSDLNEDLKKPGEPEVQTPIVPEPTKQELPEVPETTKPQLPEVPEPTKSQLPEVPEPTKPQLPEVLEPTTLQLPEDPEPTKPQLPEDPEPTKPQLPEVPEPTKPQLPEVLEPTKLQLPEDPEPTKPQLPEDPETTKPQLPEVPEPTKLQLPEVPEPTKPELPEVPELTKTQLPEVPEPTKPQILDKKEPVLLDKKEPVLLDkkepvlppkpepeillppkpepelllppkpepelllppklepklllppksepelllppkpepelllppkpkpelllppkpepeklllppkpkpklllppkpeselllppkpepeliippkpepeilippkpepelllppkpepeillppkpepelllppkpepeillppkpepelllppkpeselllplkpepeillppkpepelllppkpepelllppkpetitttktllldkkEPVLLDKKEPVLLDKKEPVLLDKKEPVLLDKKEPVLLDEKEPVLLDKKEPVLLDKKERVLLDKKEPVLLDKKEPVLLDKKEHVLLDKKETVLLDKKEPVLLDKKEPILLDKKEPVLLDKKEPVLLDKKSPVLLDKKGPVILDKKEPVLLDKKEPVLLDKKEPVLLDKKAPVLLDKKEPVLLDKKEPVLLDKKEPVLLDKKEPILFEKAALKVQTKPEVFKVPPKDKDEDEPIFFNEpksppekphhspipppppvlnppnselvYKDKYTGVGGYFGAVPEIGqnyyfhqnqsqnyyyhqnlsqnyyyhqnlSLKYYCRRNLSQNYYCHQNQSPNNYYYHLNLsqnyyfhqnqsqnyyyhqnlsqnyyyhqnLSLKYYCRRNLsqnyychqnqsqnyyyhqnqsqnyyyhqnqsqkyyyhqnLSQNYYYHQNLsqnyychqnqsqnyyyhqnqsqkyyyhqnLSQNCYYHQNRsqnyyyhqnlsqnyyyhqnqsqknyyyhLNLSQNYYYHQNLSQNYYYHQNSFTS
**LRTTVFEYLVLVRQQFLKPFLLMKLDLEKVRPVQTYVAYGTDITVPTNIYNVQCFSS***************************************************************SVIKWFLENVECLLDYLVQQKETA****************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************LLL*****VLL******L*******L***********************LL*****VLLDKKERVLLDKKEPVLLDKKEPVLLDKKEHVLLDKKETVLLDKKEPVLLDKKEPILLDKKEPVLLDK**PVLLDK*SPVLLDKKGPVILDKKEPVLLDKKEPVLLDKKEPVLLDKKAPVLLDKKEPVLLDKKEPVLLDKKEPVLLDKKEPILFEKAALKV**************************************************LVYKDKYTGVGGYFGAVPEIGQNYYFHQNQSQNYYYHQNLSQNYYYHQNLSLKYYCRRNLSQNYYCHQNQSPNNYYYHLNLSQNYYFHQNQSQNYYYHQNLSQNYYYHQNLSLKYYCRRNLSQNYYCHQNQSQNYYYHQNQSQNYYYHQNQSQKYYYHQNLSQNYYYHQNLSQNYYCHQNQSQNYYYHQNQSQKYYYHQNLSQNCYYHQNRSQNYYYHQNLSQNYYYHQNQSQKNYYYHLNLSQNYYYHQNLSQNYYYH******
**LRTTVFEYLVLVRQQFLKPFLLMKLDLEKVRPVQTYVAYGTDITVPTNIYNVQCFSSTT*********************************************************************NVEC**************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************YY**N**************
MLLRTTVFEYLVLVRQQFLKPFLLMKLDLEKVRPVQTYVAYGTDITVPTNIYNVQCFSS********************GNILETKPPNLLQQNKSHENIPENSETPTPNLDGTGQLNDNNKSVIKWFLENVECLLDYLVQQKETANVNSADLVNNRENVVKPVERKDGKETTEKETGKIAGNGTTKEETEGTFAKLA*************************DIENRVDNNDGTIATDEALKAIES***********RDKIKENIDPELGNLSDLNEDLKKPGEPEVQTPIVPEPTKQELPEVPETTKPQLPEVPEPTKSQLPEVPEPTKPQLPEVLEPTTLQLPE************************EPTKPQLPEVLEPTKLQLP**********************EVPEPTKLQLPEVPEPTKPELPEVPELTKTQLPEVPEPTKPQILDKKEPVLLDKKEPVLLDKKEPVLPPKPEPEILLPPKPEPELLLPPKPEPELLLPPKLEPKLLLPPKSEPELLLPPKPEPELLLPPKPKPELLLPPKPEPEKLLLPPKPKPKLLLPPKPESELLLPPKPEPELIIPPKPEPEILIPPKPEPELLLPPKPEPEILLPPKPEPELLLPPKPEPEILLPPKPEPELLLPPKPESELLLPLKPEPEILLPPKPEPELLLPPKPEPELLLPPKPETITTTKTLLLDKKEPVLLDKKEPVLLDKKEPVLLDKKEPVLLDKKEPVLLDEKEPVLLDKKEPVLLDKKERVLLDKKEPVLLDKKEPVLLDKKEHVLLDKKETVLLDKKEPVLLDKKEPILLDKKEPVLLDKKEPVLLDKKSPVLLDKKGPVILDKKEPVLLDKKEPVLLDKKEPVLLDKKAPVLLDKKEPVLLDKKEPVLLDKKEPVLLDKKEPILFEKAALKVQTKPEVFKVPPKDKDEDEPIFFNEPK**********IPPPPPVLNPPNSELVYKDKYTGVGGYFGAVPEIGQNYYFHQNQSQNYYYHQNLSQNYYYHQNLSLKYYCRRNLSQNYYCHQNQSPNNYYYHLNLSQNYYFHQNQSQNYYYHQNLSQNYYYHQNLSLKYYCRRNLSQNYYCHQNQSQNYYYHQNQSQNYYYHQNQSQKYYYHQNLSQNYYYHQNLSQNYYCHQNQSQNYYYHQNQSQKYYYHQNLSQNCYYHQNRSQNYYYHQNLSQNYYYHQNQSQKNYYYHLNLSQNYYYHQNLSQNYYYHQNSFTS
MLLRTTVFEYLVLVRQQFLKPFLLMKLDLEKVRPVQTYVAYGTDITVPTNIYNVQCFS*****************************************************************VIKWFLENVECLLDYLVQ**************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLRTTVFEYLVLVRQQFLKPFLLMKLDLEKVRPVQTYVAYGTDITVPTNIYNVQCFSSTTVEHSRRPKNTQLHQDSSHGNILETKPPNLLQQNKSHENIPENSETPTPNLDGTGQLNDNNKSVIKWFLENVECLLDYLVQQKETANVNSADLVNNRENVVKPVERKDGKETTEKETGKIAGNGTTKEETEGTFAKLADSETNPTEVAERTAPESSKRTDSKEDIENRVDNNDGTIATDEALKAIESQRRVKRRAAKTRDKIKENIDPELGNLSDLNEDLKKPGEPEVQTPIVPEPTKQELPEVPETTKPQLPEVPEPTKSQLPEVPEPTKPQLPEVLEPTTLQLPEDPEPTKPQLPEDPEPTKPQLPEVPEPTKPQLPEVLEPTKLQLPEDPEPTKPQLPEDPETTKPQLPEVPEPTKLQLPEVPEPTKPELPEVPELTKTQLPEVPEPTKPQILDKKEPVLLDKKEPVLLDKKEPVLPPKPEPEILLPPKPEPELLLPPKPEPELLLPPKLEPKLLLPPKSEPELLLPPKPEPELLLPPKPKPELLLPPKPEPEKLLLPPKPKPKLLLPPKPESELLLPPKPEPELIIPPKPEPEILIPPKPEPELLLPPKPEPEILLPPKPEPELLLPPKPEPEILLPPKPEPELLLPPKPESELLLPLKPEPEILLPPKPEPELLLPPKPEPELLLPPKPETITTTKTLLLDKKEPVLLDKKEPVLLDKKEPVLLDKKEPVLLDKKEPVLLDEKEPVLLDKKEPVLLDKKERVLLDKKEPVLLDKKEPVLLDKKEHVLLDKKETVLLDKKEPVLLDKKEPILLDKKEPVLLDKKEPVLLDKKSPVLLDKKGPVILDKKEPVLLDKKEPVLLDKKEPVLLDKKAPVLLDKKEPVLLDKKEPVLLDKKEPVLLDKKEPILFEKAALKVQTKPEVFKVPPKDKDEDEPIFFNEPKSPPEKPHHSPIPPPPPVLNPPNSELVYKDKYTGVGGYFGAVPEIGQNYYFHQNQSQNYYYHQNLSQNYYYHQNLSLKYYCRRNLSQNYYCHQNQSPNNYYYHLNLSQNYYFHQNQSQNYYYHQNLSQNYYYHQNLSLKYYCRRNLSQNYYCHQNQSQNYYYHQNQSQNYYYHQNQSQKYYYHQNLSQNYYYHQNLSQNYYCHQNQSQNYYYHQNQSQKYYYHQNLSQNCYYHQNRSQNYYYHQNLSQNYYYHQNQSQKNYYYHLNLSQNYYYHQNLSQNYYYHQNSFTS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1235 2.2.26 [Sep-21-2011]
Q7Z2K8 1008 G protein-regulated induc yes N/A 0.188 0.231 0.275 6e-11
Q96JE9813 Microtubule-associated pr no N/A 0.129 0.196 0.394 2e-10
O428541611 SH3 domain-containing pro yes N/A 0.133 0.102 0.347 2e-08
Q634251383 Periaxin OS=Rattus norveg yes N/A 0.212 0.189 0.354 2e-07
Q9JM991054 Proteoglycan 4 OS=Mus mus no N/A 0.100 0.117 0.461 4e-07
Q9QYX7 5068 Protein piccolo OS=Mus mu no N/A 0.076 0.018 0.365 6e-07
Q9BXM01461 Periaxin OS=Homo sapiens no N/A 0.221 0.186 0.351 4e-05
Q6ZQX7453 Uncharacterized protein C no N/A 0.150 0.410 0.336 0.0001
O551031391 Periaxin OS=Mus musculus yes N/A 0.183 0.163 0.327 0.0001
Q9D9R9 1790 Protein FAM186A OS=Mus mu no N/A 0.172 0.118 0.296 0.0001
>sp|Q7Z2K8|GRIN1_HUMAN G protein-regulated inducer of neurite outgrowth 1 OS=Homo sapiens GN=GPRIN1 PE=2 SV=2 Back     alignment and function desciption
 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 65/236 (27%), Positives = 106/236 (44%)

Query: 676 PELLLPPKPEPELLLPPKPETITTTKTLLLDKKEPVLLDKKEPVLLDKKEPVLLDKKEPV 735
           PE     KPEP   +  +P++      + L+K +     + +   + K++P    K +P+
Sbjct: 121 PEATTSGKPEPVSSVKTEPKSSDDRNPMFLEKMDFKSSKQADSTSIGKEDPGSSRKADPM 180

Query: 736 LLDKKEPVLLDEKEPVLLDKKEPVLLDKKERVLLDKKEPVLLDKKEPVLLDKKEHVLLDK 795
              K EP +L + +PV   + +P+ + K++   L K +P+   K   V   K++   L K
Sbjct: 181 FTGKAEPEILGKGDPVAPGRMDPMTVRKEDLGSLGKVDPLCSSKTYTVSPRKEDPGSLRK 240

Query: 796 KETVLLDKKEPVLLDKKEPILLDKKEPVLLDKKEPVLLDKKSPVLLDKKGPVILDKKEPV 855
            + V  DK +PV   K+EP    K+ PV  +K  P   +K   VL  K+ P    K +P+
Sbjct: 241 VDPVSSDKVDPVFPRKEEPRYSGKEHPVSSEKVAPTSAEKVDLVLSGKRDPGPSGKADPM 300

Query: 856 LLDKKEPVLLDKKEPVLLDKKAPVLLDKKEPVLLDKKEPVLLDKKEPVLLDKKEPI 911
            L+  +     K EP LL K  P    K  PV      P  L + +P  L   +P 
Sbjct: 301 PLESMDSASTGKTEPGLLGKLIPGSSGKNGPVSSGTGAPGSLGRLDPTCLGMADPA 356




May be involved in neurite outgrowth.
Homo sapiens (taxid: 9606)
>sp|Q96JE9|MAP6_HUMAN Microtubule-associated protein 6 OS=Homo sapiens GN=MAP6 PE=1 SV=2 Back     alignment and function description
>sp|O42854|YFHH_SCHPO SH3 domain-containing protein C23A1.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23A1.17 PE=1 SV=1 Back     alignment and function description
>sp|Q63425|PRAX_RAT Periaxin OS=Rattus norvegicus GN=Prx PE=1 SV=2 Back     alignment and function description
>sp|Q9JM99|PRG4_MOUSE Proteoglycan 4 OS=Mus musculus GN=Prg4 PE=1 SV=2 Back     alignment and function description
>sp|Q9QYX7|PCLO_MOUSE Protein piccolo OS=Mus musculus GN=Pclo PE=1 SV=4 Back     alignment and function description
>sp|Q9BXM0|PRAX_HUMAN Periaxin OS=Homo sapiens GN=PRX PE=1 SV=2 Back     alignment and function description
>sp|Q6ZQX7|CQ097_HUMAN Uncharacterized protein C17orf97 OS=Homo sapiens GN=C17orf97 PE=2 SV=2 Back     alignment and function description
>sp|O55103|PRAX_MOUSE Periaxin OS=Mus musculus GN=Prx PE=1 SV=1 Back     alignment and function description
>sp|Q9D9R9|F186A_MOUSE Protein FAM186A OS=Mus musculus GN=FAM186A PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1235
221054317791 hypothetical protein, conserved in Plasm 0.177 0.276 0.306 4e-32
70942861453 hypothetical protein [Plasmodium chabaud 0.167 0.456 0.414 2e-30
401408671 2995 conserved hypothetical protein [Neospora 0.166 0.068 0.436 3e-29
156407240251 predicted protein [Nematostella vectensi 0.167 0.824 0.360 4e-26
3434695931059 unnamed protein product, partial [Trypan 0.176 0.205 0.331 5e-25
2136263481139 Mtap4 protein [Xenopus laevis] 0.170 0.184 0.436 6e-24
221060662677 hypothetical protein, conserved in Plasm 0.174 0.317 0.341 2e-23
156394511222 predicted protein [Nematostella vectensi 0.170 0.950 0.238 4e-22
1482308131224 microtubule-associated protein 4 [Xenopu 0.153 0.154 0.447 1e-21
291236357468 PREDICTED: predicted protein-like [Sacco 0.276 0.730 0.277 1e-21
>gi|221054317|ref|XP_002261906.1| hypothetical protein, conserved in Plasmodium species [Plasmodium knowlesi strain H] gi|193808366|emb|CAQ39070.1| hypothetical protein, conserved in Plasmodium species [Plasmodium knowlesi strain H] Back     alignment and taxonomy information
 Score =  147 bits (371), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 68/222 (30%), Positives = 127/222 (57%)

Query: 704 LLDKKEPVLLDKKEPVLLDKKEPVLLDKKEPVLLDKKEPVLLDEKEPVLLDKKEPVLLDK 763
           L D+ +  LLD+ +  LLD+ +  L+D+ +  L+D+ +  L+D  +  L+D+ +  LLD+
Sbjct: 271 LTDRSDGTLLDRSDGSLLDRSDGTLMDRSDGTLMDRSDGTLMDRSDGTLMDRSDGSLLDR 330

Query: 764 KERVLLDKKEPVLLDKKEPVLLDKKEHVLLDKKETVLLDKKEPVLLDKKEPILLDKKEPV 823
            +R L+D+ +  LLDK +  L+D+ +  L+D+ +  LLDK +   +D+ +  L+D+ +  
Sbjct: 331 SDRTLVDRSDGSLLDKSDRTLVDRSDRTLIDRSDGSLLDKSDRNFIDRSDGTLMDRSDRT 390

Query: 824 LLDKKEPVLLDKKSPVLLDKKGPVILDKKEPVLLDKKEPVLLDKKEPVLLDKKAPVLLDK 883
           L+D+ +  LLDK    L+D+    +LD  +  +LD  +  ++DK +  +LDK    +LDK
Sbjct: 391 LVDRSDGSLLDKSDRTLVDRSDETLLDASDRNVLDNFDRNVMDKFDRNVLDKFNRNVLDK 450

Query: 884 KEPVLLDKKEPVLLDKKEPVLLDKKEPILFEKAALKVQTKPE 925
            +  +LDK    +LD+ +  +LDK    + +K    V  K +
Sbjct: 451 FDRNVLDKFNRNVLDRFDRNVLDKFNRNVLDKFDRNVCDKFD 492




Source: Plasmodium knowlesi strain H

Species: Plasmodium knowlesi

Genus: Plasmodium

Family:

Order: Haemosporida

Class: Aconoidasida

Phylum: Apicomplexa

Superkingdom: Eukaryota

>gi|70942861|ref|XP_741546.1| hypothetical protein [Plasmodium chabaudi chabaudi] gi|56519994|emb|CAH86804.1| hypothetical protein PC302162.00.0 [Plasmodium chabaudi chabaudi] Back     alignment and taxonomy information
>gi|401408671|ref|XP_003883784.1| conserved hypothetical protein [Neospora caninum Liverpool] gi|325118201|emb|CBZ53752.1| conserved hypothetical protein [Neospora caninum Liverpool] Back     alignment and taxonomy information
>gi|156407240|ref|XP_001641452.1| predicted protein [Nematostella vectensis] gi|156228591|gb|EDO49389.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information
>gi|343469593|emb|CCD17471.1| unnamed protein product, partial [Trypanosoma congolense IL3000] Back     alignment and taxonomy information
>gi|213626348|gb|AAI70295.1| Mtap4 protein [Xenopus laevis] Back     alignment and taxonomy information
>gi|221060662|ref|XP_002260976.1| hypothetical protein, conserved in Plasmodium species [Plasmodium knowlesi strain H] gi|193811050|emb|CAQ42948.1| hypothetical protein, conserved in Plasmodium species [Plasmodium knowlesi strain H] Back     alignment and taxonomy information
>gi|156394511|ref|XP_001636869.1| predicted protein [Nematostella vectensis] gi|156223976|gb|EDO44806.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information
>gi|148230813|ref|NP_001083770.1| microtubule-associated protein 4 [Xenopus laevis] gi|4063005|dbj|BAA36221.1| XMAP4 [Xenopus laevis] Back     alignment and taxonomy information
>gi|291236357|ref|XP_002738106.1| PREDICTED: predicted protein-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1235
TAIR|locus:2144716370 PELPK1 "AT5G09530" [Arabidopsi 0.162 0.543 0.440 6.6e-41
GENEDB_PFALCIPARUM|PF10_03749563 PF10_0374 "Pf 11-1 protein" [P 0.180 0.023 0.415 9.5e-33
UNIPROTKB|Q8I6U69563 PF10_0374 "Pf11-1 protein" [Pl 0.180 0.023 0.415 9.5e-33
UNIPROTKB|F1MDS01337 F1MDS0 "Uncharacterized protei 0.319 0.295 0.259 6.7e-20
MGI|MGI:18913441054 Prg4 "proteoglycan 4 (megakary 0.243 0.285 0.329 1.3e-28
UNIPROTKB|J3KP74854 PRG4 "Proteoglycan 4" [Homo sa 0.199 0.288 0.313 1.6e-17
UNIPROTKB|Q929541404 PRG4 "Proteoglycan 4" [Homo sa 0.199 0.175 0.313 6.7e-17
UNIPROTKB|G3MYM81077 G3MYM8 "Uncharacterized protei 0.326 0.374 0.271 9.7e-19
UNIPROTKB|F1N75734 F1N757 "Uncharacterized protei 0.144 5.235 0.375 1.4e-19
RGD|1308976963 Prg4 "proteoglycan 4, (megakar 0.215 0.276 0.316 6.5e-24
TAIR|locus:2144716 PELPK1 "AT5G09530" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 442 (160.7 bits), Expect = 6.6e-41, P = 6.6e-41
 Identities = 93/211 (44%), Positives = 138/211 (65%)

Query:   261 KIKENIDPELGNLSDLN--EDLKKPGEPEVQTPIVPEPTKQELPEVPETTKPQLPEVPEP 318
             KI E   PEL  + ++   E+ K P  P+++ P  PE  K ELP++PE  KP+LP+VPE 
Sbjct:    80 KIPEIPKPELPKVPEIPKPEETKLPDIPKLELPKFPEIPKPELPKMPEIPKPELPKVPEI 139

Query:   319 TKSQLPEVPEPTKPQLPEVLEPTTLQLPEDPEPTKPQLPEDPEPTKPQLPEVPEPTKPQL 378
              K +LP++PE  KP+LP+  E     LP+ PE +KP++P+  E  KP+ P+VPE  KP+L
Sbjct:   140 QKPELPKMPEIPKPELPKFPEIPKPDLPKFPENSKPEVPKLMETEKPEAPKVPEIPKPEL 199

Query:   379 PEVLEPTKLQLPEDPE------PTKPQLPEDPETTKPQLPEVPEPTKLQLPEVPEPTKPE 432
             P++ E  KL+ P+ PE      P  P+LP+ PE  KP+LP++PE  KL+ P+VPE  KPE
Sbjct:   200 PKLPEVPKLEAPKVPEIQKPELPKMPELPKMPEIQKPELPKLPEVPKLEAPKVPEIQKPE 259

Query:   433 LPEVPELTKTQLPEVPEPTKPQILDKKEPVL 463
             LP++PEL K  +PE+ +P  P++ + ++P L
Sbjct:   260 LPKMPELPK--MPEIQKPELPKMPEIQKPEL 288


GO:0009791 "post-embryonic development" evidence=IMP
GENEDB_PFALCIPARUM|PF10_0374 PF10_0374 "Pf 11-1 protein" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8I6U6 PF10_0374 "Pf11-1 protein" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
UNIPROTKB|F1MDS0 F1MDS0 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1891344 Prg4 "proteoglycan 4 (megakaryocyte stimulating factor, articular superficial zone protein)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|J3KP74 PRG4 "Proteoglycan 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q92954 PRG4 "Proteoglycan 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G3MYM8 G3MYM8 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1N757 F1N757 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1308976 Prg4 "proteoglycan 4, (megakaryocyte stimulating factor, articular superficial zone protein, camptodactyly, arthropathy, coxa vara, pericarditis syndrome)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1235
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 1e-18
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 5e-14
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 5e-14
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 3e-11
PTZ00465565 PTZ00465, PTZ00465, rhoptry-associated protein 1 ( 8e-11
PHA03378991 PHA03378, PHA03378, EBNA-3B; Provisional 2e-08
pfam00577552 pfam00577, Usher, Type VII secretion system (T7SS) 3e-07
PRK15313955 PRK15313, PRK15313, autotransport protein MisL; Pr 6e-07
pfam03154979 pfam03154, Atrophin-1, Atrophin-1 family 3e-06
PRK10263 1355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 4e-06
PHA03378991 PHA03378, PHA03378, EBNA-3B; Provisional 5e-06
PRK102631355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 1e-05
PRK102631355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 1e-05
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 1e-05
PRK108111068 PRK10811, rne, ribonuclease E; Reviewed 1e-05
pfam05887145 pfam05887, Trypan_PARP, Procyclic acidic repetitiv 1e-05
PRK15313955 PRK15313, PRK15313, autotransport protein MisL; Pr 2e-05
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 2e-05
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 3e-05
PRK07994647 PRK07994, PRK07994, DNA polymerase III subunits ga 3e-05
PRK07994647 PRK07994, PRK07994, DNA polymerase III subunits ga 3e-05
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 4e-05
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 5e-05
pfam11912204 pfam11912, DUF3430, Protein of unknown function (D 6e-05
PRK03427333 PRK03427, PRK03427, cell division protein ZipA; Pr 6e-05
COG3087264 COG3087, FtsN, Cell division protein [Cell divisio 9e-05
pfam03154979 pfam03154, Atrophin-1, Atrophin-1 family 1e-04
pfam05887145 pfam05887, Trypan_PARP, Procyclic acidic repetitiv 1e-04
PLN03209576 PLN03209, PLN03209, translocon at the inner envelo 1e-04
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 2e-04
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 2e-04
PRK10819246 PRK10819, PRK10819, transport protein TonB; Provis 2e-04
pfam00577 552 pfam00577, Usher, Type VII secretion system (T7SS) 3e-04
PRK108111068 PRK10811, rne, ribonuclease E; Reviewed 3e-04
PRK10819246 PRK10819, PRK10819, transport protein TonB; Provis 3e-04
PRK10819246 PRK10819, PRK10819, transport protein TonB; Provis 3e-04
PRK10819246 PRK10819, PRK10819, transport protein TonB; Provis 3e-04
PRK15313955 PRK15313, PRK15313, autotransport protein MisL; Pr 4e-04
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 4e-04
COG5263313 COG5263, COG5263, FOG: Glucan-binding domain (YG r 4e-04
PRK102631355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 6e-04
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 9e-04
PRK10263 1355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 0.001
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 0.001
PRK108111068 PRK10811, rne, ribonuclease E; Reviewed 0.001
pfam05887145 pfam05887, Trypan_PARP, Procyclic acidic repetitiv 0.001
pfam05887145 pfam05887, Trypan_PARP, Procyclic acidic repetitiv 0.001
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 0.001
PRK07994647 PRK07994, PRK07994, DNA polymerase III subunits ga 0.001
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 0.001
pfam03154979 pfam03154, Atrophin-1, Atrophin-1 family 0.002
PRK03427333 PRK03427, PRK03427, cell division protein ZipA; Pr 0.002
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 0.002
PRK11633226 PRK11633, PRK11633, cell division protein DedD; Pr 0.002
PRK14971614 PRK14971, PRK14971, DNA polymerase III subunits ga 0.002
pfam05887145 pfam05887, Trypan_PARP, Procyclic acidic repetitiv 0.003
pfam05887145 pfam05887, Trypan_PARP, Procyclic acidic repetitiv 0.003
PRK10819246 PRK10819, PRK10819, transport protein TonB; Provis 0.003
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 0.003
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 0.003
PRK11633226 PRK11633, PRK11633, cell division protein DedD; Pr 0.003
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 0.004
pfam05887145 pfam05887, Trypan_PARP, Procyclic acidic repetitiv 0.004
pfam11912204 pfam11912, DUF3430, Protein of unknown function (D 0.004
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 0.004
PRK11633226 PRK11633, PRK11633, cell division protein DedD; Pr 0.004
TIGR04056 982 TIGR04056, OMP_RagA_SusC, TonB-linked outer membra 0.004
pfam05297382 pfam05297, Herpes_LMP1, Herpesvirus latent membran 0.004
PTZ00449943 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry anti 0.004
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
 Score = 92.3 bits (229), Expect = 1e-18
 Identities = 99/470 (21%), Positives = 134/470 (28%), Gaps = 76/470 (16%)

Query: 282  KPGEPEVQT----PIVP-EPTKQELPEVPETTKP-QLPEVPEPTKSQLPEVPEPT-KPQL 334
            +P EP V +    P  P +  +   P           P  P P  +  P+ P P+  P  
Sbjct: 2576 RPSEPAVTSRARRPDAPPQSARPRAPVDDRGDPRGPAPPSPLPPDTHAPDPPPPSPSPAA 2635

Query: 335  PEVLEPTTLQLPEDPEPTKPQLP-------EDPEPTKPQLPEVP--EPTKPQLPEVLEP- 384
             E        +P    P     P             +      P   P +      +   
Sbjct: 2636 NEPDPHPPPTVPPPERPRDDPAPGRVSRPRRARRLGRAAQASSPPQRPRRRAARPTVGSL 2695

Query: 385  TKLQLPEDPEPTKPQLPED-PETTKPQLPEVPEPTKLQLPEVPEPTKPELPEVPELTKTQ 443
            T L  P  P PT    PE  P       P  P P   +      P  P  P VP    T 
Sbjct: 2696 TSLADPPPPPPT----PEPAPHALVSATPLPPGPAAARQASPALPAAPAPPAVPAGPATP 2751

Query: 444  LPEVPEPTKPQILDKKEPVLLDKKEPVLLDKKEPVLPPKPEPEILLPPKPEPELL----L 499
                     P       P               P  P    P  L  P           L
Sbjct: 2752 GGPARPARPPTTAGPPAPA-------------PPAAPAAGPPRRLTRPAVASLSESRESL 2798

Query: 500  PPKPEPELLLPPKLEPKLLLPPKSEPELLLPPKPEPELLLPPKPKPELLL---------- 549
            P   +P       L P   LPP + P   LPP    +   PP P                
Sbjct: 2799 PSPWDPADPPAAVLAPAAALPPAASPAGPLPPPTSAQPTAPPPPPGPPPPSLPLGGSVAP 2858

Query: 550  --------PPKPEPEKLLLPPKPKPKLLLPPKPESELLLPPKPEPELIIPPKPEPEILIP 601
                    P +    K   P +P  + L  P              E    P  +PE    
Sbjct: 2859 GGDVRRRPPSRSPAAKPAAPARPPVRRLARP--------AVSRSTESFALPPDQPE---- 2906

Query: 602  PKPEPELLLPPKPEPEILLPPKPEPELLLPPKPEPEILLPPKPEPELL-----LPPKPES 656
              P+P+   PP+P+P+   PP+P+P    PP+P+P   L P  +P          P+P  
Sbjct: 2907 RPPQPQAPPPPQPQPQPPPPPQPQPPPPPPPRPQPP--LAPTTDPAGAGEPSGAVPQPWL 2964

Query: 657  ELLLPLKPEPEILLPPKPEPELLLPPKPEPELLLPPKPETITTTKTLLLD 706
              L+P +        P+P P    P    P L         +   +L L 
Sbjct: 2965 GALVPGRVAVPRFRVPQPAPSREAPASSTPPLTGHSLSRVSSWASSLALH 3014


Length = 3151

>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|185644 PTZ00465, PTZ00465, rhoptry-associated protein 1 (RAP-1); Provisional Back     alignment and domain information
>gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional Back     alignment and domain information
>gnl|CDD|216001 pfam00577, Usher, Type VII secretion system (T7SS), usher protein Back     alignment and domain information
>gnl|CDD|237940 PRK15313, PRK15313, autotransport protein MisL; Provisional Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed Back     alignment and domain information
>gnl|CDD|114603 pfam05887, Trypan_PARP, Procyclic acidic repetitive protein (PARP) Back     alignment and domain information
>gnl|CDD|237940 PRK15313, PRK15313, autotransport protein MisL; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|221309 pfam11912, DUF3430, Protein of unknown function (DUF3430) Back     alignment and domain information
>gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional Back     alignment and domain information
>gnl|CDD|225629 COG3087, FtsN, Cell division protein [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|114603 pfam05887, Trypan_PARP, Procyclic acidic repetitive protein (PARP) Back     alignment and domain information
>gnl|CDD|178748 PLN03209, PLN03209, translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|236768 PRK10819, PRK10819, transport protein TonB; Provisional Back     alignment and domain information
>gnl|CDD|216001 pfam00577, Usher, Type VII secretion system (T7SS), usher protein Back     alignment and domain information
>gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed Back     alignment and domain information
>gnl|CDD|236768 PRK10819, PRK10819, transport protein TonB; Provisional Back     alignment and domain information
>gnl|CDD|236768 PRK10819, PRK10819, transport protein TonB; Provisional Back     alignment and domain information
>gnl|CDD|236768 PRK10819, PRK10819, transport protein TonB; Provisional Back     alignment and domain information
>gnl|CDD|237940 PRK15313, PRK15313, autotransport protein MisL; Provisional Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|227588 COG5263, COG5263, FOG: Glucan-binding domain (YG repeat) [General function prediction only] Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed Back     alignment and domain information
>gnl|CDD|114603 pfam05887, Trypan_PARP, Procyclic acidic repetitive protein (PARP) Back     alignment and domain information
>gnl|CDD|114603 pfam05887, Trypan_PARP, Procyclic acidic repetitive protein (PARP) Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional Back     alignment and domain information
>gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|114603 pfam05887, Trypan_PARP, Procyclic acidic repetitive protein (PARP) Back     alignment and domain information
>gnl|CDD|114603 pfam05887, Trypan_PARP, Procyclic acidic repetitive protein (PARP) Back     alignment and domain information
>gnl|CDD|236768 PRK10819, PRK10819, transport protein TonB; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|114603 pfam05887, Trypan_PARP, Procyclic acidic repetitive protein (PARP) Back     alignment and domain information
>gnl|CDD|221309 pfam11912, DUF3430, Protein of unknown function (DUF3430) Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional Back     alignment and domain information
>gnl|CDD|234450 TIGR04056, OMP_RagA_SusC, TonB-linked outer membrane protein, SusC/RagA family Back     alignment and domain information
>gnl|CDD|114045 pfam05297, Herpes_LMP1, Herpesvirus latent membrane protein 1 (LMP1) Back     alignment and domain information
>gnl|CDD|185628 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry antigen; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1235
PHA032473151 large tegument protein UL36; Provisional 98.97
PHA032473151 large tegument protein UL36; Provisional 98.95
KOG3671|consensus569 95.72
KOG3671|consensus569 94.2
KOG1924|consensus1102 91.29
PTZ00491 850 major vault protein; Provisional 91.21
PTZ00491 850 major vault protein; Provisional 80.62
>PHA03247 large tegument protein UL36; Provisional Back     alignment and domain information
Probab=98.97  E-value=2.3e-05  Score=103.71  Aligned_cols=24  Identities=17%  Similarity=-0.017  Sum_probs=16.4

Q ss_pred             hhhhcccccccc-----------cccCccceeece
Q psy14307        141 QQKETANVNSAD-----------LVNNRENVVKPV  164 (1235)
Q Consensus       141 q~~~~~~v~~~~-----------~~~~~~~~~k~~  164 (1235)
                      ||+|-+=-|.++           |+|.+-+.+|+-
T Consensus      2377 ~QLe~LSaLiAsKPLa~aPPCLvlvD~~m~p~~VL 2411 (3151)
T PHA03247       2377 AQLPALSALIAARPLARSPPCLVLVDISMAPLFVL 2411 (3151)
T ss_pred             HHHHHHHHHHhcCcccCCCCeEEEEcCCCceeEEe
Confidence            777766655555           777777777764



>PHA03247 large tegument protein UL36; Provisional Back     alignment and domain information
>KOG3671|consensus Back     alignment and domain information
>KOG3671|consensus Back     alignment and domain information
>KOG1924|consensus Back     alignment and domain information
>PTZ00491 major vault protein; Provisional Back     alignment and domain information
>PTZ00491 major vault protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1235
2ahx_A617 P180ERBB4, receptor tyrosine-protein kinase ERBB-4 1e-13
2ahx_A617 P180ERBB4, receptor tyrosine-protein kinase ERBB-4 2e-11
2ahx_A617 P180ERBB4, receptor tyrosine-protein kinase ERBB-4 5e-11
2ahx_A 617 P180ERBB4, receptor tyrosine-protein kinase ERBB-4 1e-10
2ahx_A617 P180ERBB4, receptor tyrosine-protein kinase ERBB-4 1e-10
3ttq_A 1108 Dextransucrase; (beta/alpha)8 barrel, transferase; 1e-11
3ttq_A 1108 Dextransucrase; (beta/alpha)8 barrel, transferase; 1e-10
3ttq_A 1108 Dextransucrase; (beta/alpha)8 barrel, transferase; 2e-07
3ttq_A 1108 Dextransucrase; (beta/alpha)8 barrel, transferase; 3e-07
3ttq_A 1108 Dextransucrase; (beta/alpha)8 barrel, transferase; 9e-05
2qj6_A332 Toxin A; clostridial repetitive oligo peptides; 2. 4e-11
2qj6_A 332 Toxin A; clostridial repetitive oligo peptides; 2. 4e-06
3gdb_A937 Endo-D, putative uncharacterized protein SPR0440; 6e-11
3gdb_A937 Endo-D, putative uncharacterized protein SPR0440; 2e-10
3gdb_A937 Endo-D, putative uncharacterized protein SPR0440; 3e-10
3gdb_A937 Endo-D, putative uncharacterized protein SPR0440; 4e-10
3gdb_A937 Endo-D, putative uncharacterized protein SPR0440; 6e-10
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 7e-08
3gdb_A937 Endo-D, putative uncharacterized protein SPR0440; 1e-07
3gdb_A937 Endo-D, putative uncharacterized protein SPR0440; 1e-07
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 2e-07
3gdb_A937 Endo-D, putative uncharacterized protein SPR0440; 2e-07
3gdb_A937 Endo-D, putative uncharacterized protein SPR0440; 3e-07
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 3e-07
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 4e-07
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 6e-07
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 1e-06
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 2e-06
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 3e-06
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 4e-06
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 9e-06
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 2e-10
2ww5_A 468 LYTC autolysin, 1,4-beta-N-acetylmuramidase; hydro 3e-10
2ww5_A 468 LYTC autolysin, 1,4-beta-N-acetylmuramidase; hydro 1e-07
2ww5_A 468 LYTC autolysin, 1,4-beta-N-acetylmuramidase; hydro 5e-04
3fip_A493 Outer membrane usher protein PAPC; beta barrel, pr 5e-10
3fip_A493 Outer membrane usher protein PAPC; beta barrel, pr 1e-09
2v05_A311 Choline binding protein F; CBPF, lipid-binding-pro 9e-10
2v05_A 311 Choline binding protein F; CBPF, lipid-binding-pro 2e-07
2j8g_A339 Lysozyme; antimicrobial, muein hydrolase, bacterio 3e-09
2j8g_A339 Lysozyme; antimicrobial, muein hydrolase, bacterio 9e-07
2j8g_A339 Lysozyme; antimicrobial, muein hydrolase, bacterio 1e-06
2hr7_A 486 Insulin receptor; hormone receptor, leucine rich r 1e-07
2hr7_A 486 Insulin receptor; hormone receptor, leucine rich r 6e-06
3aj6_A286 Main hemagglutinin component; toxin, beta-trefoil; 2e-07
2bib_A 547 CBPE, teichoic acid phosphorylcholine esterase/ ch 8e-07
2bib_A547 CBPE, teichoic acid phosphorylcholine esterase/ ch 4e-06
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 9e-07
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 1e-05
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 7e-05
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 2e-04
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
3q15_A 378 PSP28, response regulator aspartate phosphatase H; 2e-06
3q15_A378 PSP28, response regulator aspartate phosphatase H; 8e-05
1ybi_A288 HA33A, HA33/A, non-toxin haemagglutinin HA34; beta 4e-06
1ybi_A288 HA33A, HA33/A, non-toxin haemagglutinin HA34; beta 2e-05
1m6b_A 621 C-ER, receptor protein-tyrosine kinase ERBB-3; cel 4e-06
1m6b_A 621 C-ER, receptor protein-tyrosine kinase ERBB-3; cel 7e-06
1m6b_A 621 C-ER, receptor protein-tyrosine kinase ERBB-3; cel 3e-05
1m6b_A621 C-ER, receptor protein-tyrosine kinase ERBB-3; cel 2e-04
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 5e-06
3ulq_A 383 Response regulator aspartate phosphatase F; tetrat 2e-05
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 5e-04
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 7e-04
1igr_A 478 Insulin-like growth factor receptor 1; hormone rec 5e-06
1igr_A 478 Insulin-like growth factor receptor 1; hormone rec 1e-05
2wvr_C546 DNA replication factor CDT1; DNA replication licen 7e-06
2wvr_C546 DNA replication factor CDT1; DNA replication licen 1e-05
2wvr_C546 DNA replication factor CDT1; DNA replication licen 2e-05
2wvr_C546 DNA replication factor CDT1; DNA replication licen 8e-05
2wvr_C546 DNA replication factor CDT1; DNA replication licen 2e-04
3rfz_B 843 Outer membrane usher protein, type 1 fimbrial SYN; 9e-06
3rfz_B 843 Outer membrane usher protein, type 1 fimbrial SYN; 3e-05
3v1v_A433 2-MIB synthase, 2-methylisoborneol synthase; class 2e-05
3v1v_A433 2-MIB synthase, 2-methylisoborneol synthase; class 4e-05
3v1v_A433 2-MIB synthase, 2-methylisoborneol synthase; class 1e-04
3v1v_A433 2-MIB synthase, 2-methylisoborneol synthase; class 2e-04
3v1v_A433 2-MIB synthase, 2-methylisoborneol synthase; class 2e-04
2g7c_A255 Toxin A; linear B trisaccharide, protein-carbohydr 2e-05
2g7c_A255 Toxin A; linear B trisaccharide, protein-carbohydr 4e-05
2g7c_A255 Toxin A; linear B trisaccharide, protein-carbohydr 4e-05
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 3e-05
3i2t_A 551 Epidermal growth factor receptor, isoform A; EGFR, 3e-05
3i2t_A551 Epidermal growth factor receptor, isoform A; EGFR, 3e-04
1yy9_A 624 Epidermal growth factor receptor; cell surface rec 4e-05
1yy9_A 624 Epidermal growth factor receptor; cell surface rec 3e-04
1n8y_C608 Protooncoprotein; tyrosin kinase receptor, cell su 7e-05
3klk_A1039 Glucansucrase; native form, open conformation, mul 1e-04
1ki0_A253 Angiostatin; kringle domains, hydrolase; HET: BCN; 1e-04
2grx_C229 Protein TONB; beta barrel, outer membrane, heteroc 2e-04
2grx_C229 Protein TONB; beta barrel, outer membrane, heteroc 3e-04
2grx_C229 Protein TONB; beta barrel, outer membrane, heteroc 7e-04
2grx_C229 Protein TONB; beta barrel, outer membrane, heteroc 9e-04
>2ahx_A P180ERBB4, receptor tyrosine-protein kinase ERBB-4; X-RAY crystallography, neuregulins, heparin-binding, cell CY signaling protein; HET: NAG NDG; 2.40A {Homo sapiens} PDB: 3u2p_A* Length = 617 Back     alignment and structure
 Score = 74.7 bits (182), Expect = 1e-13
 Identities = 22/244 (9%), Positives = 52/244 (21%), Gaps = 25/244 (10%)

Query: 992  QNYYFHQNQSQNYYYHQNLSQNYYYHQNLSLKYYCRRNLSQNYYCHQNQSPNNYYYHLNL 1051
                    +  N +        +   Q+           S           +     +  
Sbjct: 355  NAIEAIDPEKLNVFRTVREITGFLNIQSWPPNMTDFSVFSNLVTIGGRVLYSGLSLLILK 414

Query: 1052 SQNYYFHQNQSQNYYYHQNLSQNYYYHQNLSLKYYCRRNLSQNYYCHQNQSQNYYYHQNQ 1111
             Q     Q QS         + N Y   N +L YY   N +         +Q      N+
Sbjct: 415  QQGITSLQFQSLKEIS----AGNIYITDNSNLCYYHTINWTT---LFSTINQRIVIRDNR 467

Query: 1112 SQNYYYHQNQSQKYYYHQNLSQNYYYHQNLSQNYYCHQNQSQNYYYHQNQSQKYYYHQNL 1171
                      ++    +   S +  +     Q   C +                 + +  
Sbjct: 468  ----KAENCTAEGMVCNHLCSSDGCWGPGPDQCLSCRRFSRGRICIESCNLYDGEFREFE 523

Query: 1172 SQN--------CYYHQNRSQNYY---YHQNLSQNYYYHQNQSQK---NYYYHLNLSQNYY 1217
            + +        C   ++     +          +++       +   +     N     Y
Sbjct: 524  NDSICVECDPQCEKMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKCPDGLQGANSFIFKY 583

Query: 1218 YHQN 1221
               +
Sbjct: 584  ADPD 587


>2ahx_A P180ERBB4, receptor tyrosine-protein kinase ERBB-4; X-RAY crystallography, neuregulins, heparin-binding, cell CY signaling protein; HET: NAG NDG; 2.40A {Homo sapiens} PDB: 3u2p_A* Length = 617 Back     alignment and structure
>2ahx_A P180ERBB4, receptor tyrosine-protein kinase ERBB-4; X-RAY crystallography, neuregulins, heparin-binding, cell CY signaling protein; HET: NAG NDG; 2.40A {Homo sapiens} PDB: 3u2p_A* Length = 617 Back     alignment and structure
>2ahx_A P180ERBB4, receptor tyrosine-protein kinase ERBB-4; X-RAY crystallography, neuregulins, heparin-binding, cell CY signaling protein; HET: NAG NDG; 2.40A {Homo sapiens} PDB: 3u2p_A* Length = 617 Back     alignment and structure
>2ahx_A P180ERBB4, receptor tyrosine-protein kinase ERBB-4; X-RAY crystallography, neuregulins, heparin-binding, cell CY signaling protein; HET: NAG NDG; 2.40A {Homo sapiens} PDB: 3u2p_A* Length = 617 Back     alignment and structure
>3ttq_A Dextransucrase; (beta/alpha)8 barrel, transferase; HET: PG4; 1.90A {Leuconostoc mesenteroides} PDB: 3tto_A* Length = 1108 Back     alignment and structure
>3ttq_A Dextransucrase; (beta/alpha)8 barrel, transferase; HET: PG4; 1.90A {Leuconostoc mesenteroides} PDB: 3tto_A* Length = 1108 Back     alignment and structure
>3ttq_A Dextransucrase; (beta/alpha)8 barrel, transferase; HET: PG4; 1.90A {Leuconostoc mesenteroides} PDB: 3tto_A* Length = 1108 Back     alignment and structure
>3ttq_A Dextransucrase; (beta/alpha)8 barrel, transferase; HET: PG4; 1.90A {Leuconostoc mesenteroides} PDB: 3tto_A* Length = 1108 Back     alignment and structure
>3ttq_A Dextransucrase; (beta/alpha)8 barrel, transferase; HET: PG4; 1.90A {Leuconostoc mesenteroides} PDB: 3tto_A* Length = 1108 Back     alignment and structure
>2qj6_A Toxin A; clostridial repetitive oligo peptides; 2.50A {Clostridium difficile} Length = 332 Back     alignment and structure
>2qj6_A Toxin A; clostridial repetitive oligo peptides; 2.50A {Clostridium difficile} Length = 332 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Length = 503 Back     alignment and structure
>2ww5_A LYTC autolysin, 1,4-beta-N-acetylmuramidase; hydrolase, glycosidase, choline-binding protein; 1.61A {Streptococcus pneumoniae} PDB: 2wwd_A* 2wwc_A Length = 468 Back     alignment and structure
>2ww5_A LYTC autolysin, 1,4-beta-N-acetylmuramidase; hydrolase, glycosidase, choline-binding protein; 1.61A {Streptococcus pneumoniae} PDB: 2wwd_A* 2wwc_A Length = 468 Back     alignment and structure
>2ww5_A LYTC autolysin, 1,4-beta-N-acetylmuramidase; hydrolase, glycosidase, choline-binding protein; 1.61A {Streptococcus pneumoniae} PDB: 2wwd_A* 2wwc_A Length = 468 Back     alignment and structure
>3fip_A Outer membrane usher protein PAPC; beta barrel, protein translocase, cell membrane, cell outer fimbrium, transmembrane, transport; 3.15A {Escherichia coli} PDB: 2vqi_A* Length = 493 Back     alignment and structure
>3fip_A Outer membrane usher protein PAPC; beta barrel, protein translocase, cell membrane, cell outer fimbrium, transmembrane, transport; 3.15A {Escherichia coli} PDB: 2vqi_A* Length = 493 Back     alignment and structure
>2v05_A Choline binding protein F; CBPF, lipid-binding-protein; 1.67A {Streptococcus pneumoniae} PDB: 2v04_A 2x8m_A* 2x8o_A* 2x8p_A* 2vyu_A Length = 311 Back     alignment and structure
>2v05_A Choline binding protein F; CBPF, lipid-binding-protein; 1.67A {Streptococcus pneumoniae} PDB: 2v04_A 2x8m_A* 2x8o_A* 2x8p_A* 2vyu_A Length = 311 Back     alignment and structure
>2j8g_A Lysozyme; antimicrobial, muein hydrolase, bacteriolytic enzyme, pneumococcal cell WALL degradation, hydrolase, glycosidase, multimodular; HET: NAG AMV; 1.69A {Bacteriophage cp-1} SCOP: b.109.1.1 c.1.8.8 PDB: 2ixv_A* 2j8f_A* 2ixu_A* 1h09_A 1oba_A Length = 339 Back     alignment and structure
>2j8g_A Lysozyme; antimicrobial, muein hydrolase, bacteriolytic enzyme, pneumococcal cell WALL degradation, hydrolase, glycosidase, multimodular; HET: NAG AMV; 1.69A {Bacteriophage cp-1} SCOP: b.109.1.1 c.1.8.8 PDB: 2ixv_A* 2j8f_A* 2ixu_A* 1h09_A 1oba_A Length = 339 Back     alignment and structure
>2j8g_A Lysozyme; antimicrobial, muein hydrolase, bacteriolytic enzyme, pneumococcal cell WALL degradation, hydrolase, glycosidase, multimodular; HET: NAG AMV; 1.69A {Bacteriophage cp-1} SCOP: b.109.1.1 c.1.8.8 PDB: 2ixv_A* 2j8f_A* 2ixu_A* 1h09_A 1oba_A Length = 339 Back     alignment and structure
>2hr7_A Insulin receptor; hormone receptor, leucine rich repeat, transferase; HET: NAG BMA MAN FUC P33; 2.32A {Homo sapiens} Length = 486 Back     alignment and structure
>2hr7_A Insulin receptor; hormone receptor, leucine rich repeat, transferase; HET: NAG BMA MAN FUC P33; 2.32A {Homo sapiens} Length = 486 Back     alignment and structure
>3aj6_A Main hemagglutinin component; toxin, beta-trefoil; HET: NGA; 1.48A {Clostridium botulinum} PDB: 1qxm_A 3aj5_A* 2ehm_A* 2ehi_A* 2ehn_A* 3ah1_A* 3ah2_A* 3ah4_A* 2e4m_A Length = 286 Back     alignment and structure
>2bib_A CBPE, teichoic acid phosphorylcholine esterase/ choline protein; choline-binding protein, PCE, phosphorylcholine estera hydrolase; HET: PC BTB; 1.92A {Streptococcus pneumoniae} SCOP: b.109.1.1 d.157.1.8 PDB: 1wra_A* Length = 547 Back     alignment and structure
>2bib_A CBPE, teichoic acid phosphorylcholine esterase/ choline protein; choline-binding protein, PCE, phosphorylcholine estera hydrolase; HET: PC BTB; 1.92A {Streptococcus pneumoniae} SCOP: b.109.1.1 d.157.1.8 PDB: 1wra_A* Length = 547 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>1ybi_A HA33A, HA33/A, non-toxin haemagglutinin HA34; beta-trefoil; 1.50A {Clostridium botulinum} Length = 288 Back     alignment and structure
>1ybi_A HA33A, HA33/A, non-toxin haemagglutinin HA34; beta-trefoil; 1.50A {Clostridium botulinum} Length = 288 Back     alignment and structure
>1m6b_A C-ER, receptor protein-tyrosine kinase ERBB-3; cell surface receptor, immunity, signaling transferase; HET: NAG NDG; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 PDB: 3p11_A* Length = 621 Back     alignment and structure
>1m6b_A C-ER, receptor protein-tyrosine kinase ERBB-3; cell surface receptor, immunity, signaling transferase; HET: NAG NDG; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 PDB: 3p11_A* Length = 621 Back     alignment and structure
>1m6b_A C-ER, receptor protein-tyrosine kinase ERBB-3; cell surface receptor, immunity, signaling transferase; HET: NAG NDG; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 PDB: 3p11_A* Length = 621 Back     alignment and structure
>1m6b_A C-ER, receptor protein-tyrosine kinase ERBB-3; cell surface receptor, immunity, signaling transferase; HET: NAG NDG; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 PDB: 3p11_A* Length = 621 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>1igr_A Insulin-like growth factor receptor 1; hormone receptor, insulin receptor family; HET: NAG FUC BMA MAN; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 Length = 478 Back     alignment and structure
>1igr_A Insulin-like growth factor receptor 1; hormone receptor, insulin receptor family; HET: NAG FUC BMA MAN; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 Length = 478 Back     alignment and structure
>2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 Back     alignment and structure
>2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 Back     alignment and structure
>2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 Back     alignment and structure
>2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 Back     alignment and structure
>2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 Back     alignment and structure
>3rfz_B Outer membrane usher protein, type 1 fimbrial SYN; beta-barrel, pilus assembly, outer-membrane, cell adhesion-T protein-chaperone complex; 2.80A {Escherichia coli} PDB: 3ohn_A 1zdv_A Length = 843 Back     alignment and structure
>3rfz_B Outer membrane usher protein, type 1 fimbrial SYN; beta-barrel, pilus assembly, outer-membrane, cell adhesion-T protein-chaperone complex; 2.80A {Escherichia coli} PDB: 3ohn_A 1zdv_A Length = 843 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>2g7c_A Toxin A; linear B trisaccharide, protein-carbohydrate complex, bacter toxin; HET: GLA GAL NAG; 2.00A {Clostridium difficile} Length = 255 Back     alignment and structure
>2g7c_A Toxin A; linear B trisaccharide, protein-carbohydrate complex, bacter toxin; HET: GLA GAL NAG; 2.00A {Clostridium difficile} Length = 255 Back     alignment and structure
>2g7c_A Toxin A; linear B trisaccharide, protein-carbohydrate complex, bacter toxin; HET: GLA GAL NAG; 2.00A {Clostridium difficile} Length = 255 Back     alignment and structure
>3i2t_A Epidermal growth factor receptor, isoform A; EGFR, ectodomain, unliganded, autoinhibited, ATP nucleotide-binding, tyrosine-protein kinase; HET: NDG NAG BMA; 2.70A {Drosophila melanogaster} PDB: 3ltf_A* 3ltg_A Length = 551 Back     alignment and structure
>3i2t_A Epidermal growth factor receptor, isoform A; EGFR, ectodomain, unliganded, autoinhibited, ATP nucleotide-binding, tyrosine-protein kinase; HET: NDG NAG BMA; 2.70A {Drosophila melanogaster} PDB: 3ltf_A* 3ltg_A Length = 551 Back     alignment and structure
>1yy9_A Epidermal growth factor receptor; cell surface receptor, tyrosine kinase, glycoprotein, antigen:antibody complex, FAB fragment, antitumor, drug; HET: NDG NAG BMA MAN; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 PDB: 3qwq_A* 1nql_A* 3b2v_A* 1ivo_A* 3njp_A* Length = 624 Back     alignment and structure
>1yy9_A Epidermal growth factor receptor; cell surface receptor, tyrosine kinase, glycoprotein, antigen:antibody complex, FAB fragment, antitumor, drug; HET: NDG NAG BMA MAN; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 PDB: 3qwq_A* 1nql_A* 3b2v_A* 1ivo_A* 3njp_A* Length = 624 Back     alignment and structure
>1n8y_C Protooncoprotein; tyrosin kinase receptor, cell surface receptor, transferase; HET: NAG; 2.40A {Rattus norvegicus} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 PDB: 1n8z_C* 3be1_A* 1s78_A* 3mzw_A* 3n85_A* 2a91_A* 3h3b_A Length = 608 Back     alignment and structure
>3klk_A Glucansucrase; native form, open conformation, multidomain protein, glycosyltransferase, transferase; 1.65A {Lactobacillus reuteri} PDB: 3kll_A* 3hz3_A* Length = 1039 Back     alignment and structure
>1ki0_A Angiostatin; kringle domains, hydrolase; HET: BCN; 1.75A {Homo sapiens} SCOP: g.14.1.1 g.14.1.1 g.14.1.1 PDB: 2doh_X* 2doi_X 1cea_A 1ceb_A* 1b2i_A* 1pkr_A 2l0s_A 2kj4_A 1i5k_A 1hpj_A 1hpk_A* Length = 253 Back     alignment and structure
>2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 Back     alignment and structure
>2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 Back     alignment and structure
>2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 Back     alignment and structure
>2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1235
2zuo_A 861 MVP, major vault protein; repeat domains, protein- 95.97
2zuo_A 861 MVP, major vault protein; repeat domains, protein- 95.15
3gnf_B387 MVP, major vault protein; beta sheets, phosphoprot 88.84
>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Back     alignment and structure
Probab=95.97  E-value=0.052  Score=66.73  Aligned_cols=210  Identities=18%  Similarity=0.152  Sum_probs=126.2

Q ss_pred             ccccccccCCCCcccccCCcccccccCCcccccCCCceeccCCCcccccCCCcccccCCCccccccccceeccCCCcccc
Q psy14307        698 TTTKTLLLDKKEPVLLDKKEPVLLDKKEPVLLDKKEPVLLDKKEPVLLDEKEPVLLDKKEPVLLDKKERVLLDKKEPVLL  777 (1235)
Q Consensus       698 ~tpk~dlLdk~EaVV~~e~e~vvl~esE~VV~~k~E~VvldE~e~Vv~dE~E~Vvlde~E~vV~de~E~Vv~de~E~vv~  777 (1235)
                      .-|+|+.++.+|.++...-.-++..-+.+.+  =..+|+.++...++.|+..+|.+.-|+.=++-..+..-|--||.++.
T Consensus        30 ~GP~t~~~q~~E~v~~~P~~mi~vPp~~YCi--I~NPv~r~~~g~~v~d~~gq~klr~g~~EiR~~q~pFPLyPgE~l~~  107 (861)
T 2zuo_A           30 VGPKTYIRQDNERVLFAPVRMVTVPPRHYCI--VANPVSRDTQSSVLFDITGQVRLRHADQEIRLAQDPFPLYPGEVLEK  107 (861)
T ss_dssp             CCSCCBCCSSCBCCSCSSSCCBCCCCCCCCC--CSSTTCEEEECCCCSCCSSCCCCSSSSEEEECTTCCCCCCSCCCSCC
T ss_pred             ECCeEEEeccCcccccCCceeEEeCCCceEE--EeCceeecCCCCeeeccCCceeecccceeeeccCCCCCCCCCccccc
Confidence            4578999999999887766666666666665  23556666666666666666666666555555555555555555533


Q ss_pred             cCCCceeeccCCceee------cCCcceeecCCCceeecCCCceeecCCCCeeecCCCCeEeccCCCeEec------cCC
Q psy14307        778 DKKEPVLLDKKEHVLL------DKKETVLLDKKEPVLLDKKEPILLDKKEPVLLDKKEPVLLDKKSPVLLD------KKG  845 (1235)
Q Consensus       778 deke~vv~~e~e~Vml------~e~e~vv~~~~e~v~l~~~ep~vl~~~~~Vvl~~k~pvvl~~k~~vvl~------~k~  845 (1235)
                      .=..--++....++.|      .+..++.+.+|+=.|+++=+.|+-...+-|+ +.=.++||..++++-|.      +..
T Consensus       108 ~v~~L~VI~~N~ALrLrAl~df~D~~g~~R~AGEeWLv~gPGtY~P~veEeVv-e~v~A~vl~~n~AL~LrA~~~f~D~~  186 (861)
T 2zuo_A          108 DITPLQVVLPNTALHLKALLDFEDKNGDKVMAGDEWLFEGPGTYIPQKEVEVV-EIIQATVIKQNQALRLRARKECFDRE  186 (861)
T ss_dssp             CCCCCCCCGGGCCEEEBCSSCSSCSSSSCCCTTCBCCBCSSCCCCSSSCCEEE-ECCCCCCCGGGCCEEECCCSSCCCTT
T ss_pred             CceeeeEecCCceEEEEEeeeEEcCCCcEeecCCEEEEECCceecCCCceEEE-EEEEEEEecCCcEEEEEEeeeEEcCC
Confidence            2222223444444433      1345667777776666655555544433332 23335555555555553      334


Q ss_pred             ceeecCCCceEecCCCceEecCCCCeeecCCCceeecCCCCeecc------CCCceeecCCCceeeccCCch
Q psy14307        846 PVILDKKEPVLLDKKEPVLLDKKEPVLLDKKAPVLLDKKEPVLLD------KKEPVLLDKKEPVLLDKKEPI  911 (1235)
Q Consensus       846 p~v~e~~~~vvl~~k~pvv~~~~~~Vvl~~k~pvv~~~k~~Vvl~------~~~p~m~d~~~~v~l~~k~p~  911 (1235)
                      ++.|..|+--|+..-|+++.+.-|-|+ +...++||..+++++|-      +.-.+.+.+|.--||+..++-
T Consensus       187 G~~R~aGEEWLVt~~gayiP~v~Eevv-~~V~a~VLte~eAL~LrA~~~F~D~~gv~RkaGe~WLVT~~gp~  257 (861)
T 2zuo_A          187 GKGRVTGEEWLVRSVGAYLPAVFEEVL-DLVDAVILTEKTALHLRALQNFRDLRGVLHRTGEEWLVTVQDTE  257 (861)
T ss_dssp             SSCCCTTCCCCBCSSSCCCCTTCCEEE-ECCCCCCCCTTCEEEEECCSSCBCTTCCBCCTTCEEEECSSCCC
T ss_pred             CcCccCCCeEEEeccceecCCCceEEE-EEEeeEEecCCcEEEEEEeeeeccccCceecCCCEEEEecCCcc
Confidence            666888888888887888888777665 44466666666666655      334556777777777655543



>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Back     alignment and structure
>3gnf_B MVP, major vault protein; beta sheets, phosphoprotein, ribonucleoprotein, structural P; 2.10A {Mus musculus} PDB: 3gf5_A 3gng_A 1y7x_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1235
d2biba1233 b.109.1.1 (A:309-541) Teichoic acid phosphorylchol 2e-19
d2biba1233 b.109.1.1 (A:309-541) Teichoic acid phosphorylchol 3e-18
d2biba1233 b.109.1.1 (A:309-541) Teichoic acid phosphorylchol 2e-17
d2biba1233 b.109.1.1 (A:309-541) Teichoic acid phosphorylchol 2e-17
d2biba1233 b.109.1.1 (A:309-541) Teichoic acid phosphorylchol 5e-17
d2biba1233 b.109.1.1 (A:309-541) Teichoic acid phosphorylchol 7e-13
d2biba1233 b.109.1.1 (A:309-541) Teichoic acid phosphorylchol 4e-12
d2biba1 233 b.109.1.1 (A:309-541) Teichoic acid phosphorylchol 1e-07
d2biba1233 b.109.1.1 (A:309-541) Teichoic acid phosphorylchol 0.001
d2j8ga1149 b.109.1.1 (A:191-339) C-terminal domain of endolys 1e-10
d2j8ga1149 b.109.1.1 (A:191-339) C-terminal domain of endolys 7e-10
d2j8ga1149 b.109.1.1 (A:191-339) C-terminal domain of endolys 6e-08
d2j8ga1149 b.109.1.1 (A:191-339) C-terminal domain of endolys 7e-08
d2j8ga1149 b.109.1.1 (A:191-339) C-terminal domain of endolys 2e-07
d2j8ga1149 b.109.1.1 (A:191-339) C-terminal domain of endolys 5e-05
d2j8ga1149 b.109.1.1 (A:191-339) C-terminal domain of endolys 3e-04
d2j8ga1149 b.109.1.1 (A:191-339) C-terminal domain of endolys 0.003
d1ouva_265 a.118.18.1 (A:) Cysteine rich protein C (HcpC) {He 2e-10
d3bmva4406 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase 9e-09
d2aaaa2381 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergill 4e-08
d2aaaa2381 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergill 2e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-07
d1h3ga3 422 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central d 5e-07
d1jtdb_273 b.69.5.2 (B:) beta-lactamase inhibitor protein-II, 8e-07
d1jtdb_273 b.69.5.2 (B:) beta-lactamase inhibitor protein-II, 1e-05
d1jtdb_273 b.69.5.2 (B:) beta-lactamase inhibitor protein-II, 0.001
d2bm5a1181 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M 9e-07
d2bm5a1181 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M 2e-05
d2bm5a1181 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M 2e-05
d2bm5a1181 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M 4e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-06
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 1e-05
d2dtge6155 g.3.9.1 (E:157-311) Insulin receptor {Human (Homo 2e-05
d2dtge6155 g.3.9.1 (E:157-311) Insulin receptor {Human (Homo 2e-05
d2dtge6155 g.3.9.1 (E:157-311) Insulin receptor {Human (Homo 0.004
d2j8ka1175 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme 2e-05
d2j8ka1175 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme 1e-04
d1n8yc3157 g.3.9.1 (C:166-322) Protooncoprotein Her2 extracel 3e-05
d1n8yc3157 g.3.9.1 (C:166-322) Protooncoprotein Her2 extracel 0.004
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 3e-05
d1hupa1117 d.169.1.1 (A:112-228) Mannose-binding protein A, C 6e-05
d1hupa1117 d.169.1.1 (A:112-228) Mannose-binding protein A, C 0.001
d1hupa1117 d.169.1.1 (A:112-228) Mannose-binding protein A, C 0.002
d1aeca_218 d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwi 7e-05
d1igra3150 g.3.9.1 (A:150-299) Type 1 insulin-like growth fac 7e-05
d1igra3150 g.3.9.1 (A:150-299) Type 1 insulin-like growth fac 0.002
d1m6ba3145 g.3.9.1 (A:166-310) Receptor protein-tyrosine kina 1e-04
d1m6ba3145 g.3.9.1 (A:166-310) Receptor protein-tyrosine kina 2e-04
d1m6ba3145 g.3.9.1 (A:166-310) Receptor protein-tyrosine kina 0.002
d1rdl1_111 d.169.1.1 (1:) Mannose-binding protein A, C-lectin 2e-04
d1qg8a_255 c.68.1.1 (A:) Spore coat polysaccharide biosynthes 2e-04
d1moxa3149 g.3.9.1 (A:163-311) EGF receptor Cys-rich domains 2e-04
d1moxa3149 g.3.9.1 (A:163-311) EGF receptor Cys-rich domains 3e-04
d1moxa3149 g.3.9.1 (A:163-311) EGF receptor Cys-rich domains 5e-04
d1moxa3149 g.3.9.1 (A:163-311) EGF receptor Cys-rich domains 0.001
d1moxa3149 g.3.9.1 (A:163-311) EGF receptor Cys-rich domains 0.002
d1olta_441 c.1.28.2 (A:) Oxygen-independent coproporphyrinoge 3e-04
d1olta_441 c.1.28.2 (A:) Oxygen-independent coproporphyrinoge 0.001
d1v2da_368 c.67.1.1 (A:) Glutamine aminotransferase {Thermus 3e-04
g1k3b.1233 d.3.1.1 (B:,C:) Cathepsin C (dipeptidyl peptidase 3e-04
d1me4a_215 d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 56 3e-04
d1o69a_374 c.67.1.4 (A:) Aminotransferase homolog WlaK (PglE, 3e-04
d1wmza_140 d.169.1.1 (A:) Lectin CEL-I {Cucumaria echinata [T 4e-04
d1qhoa4407 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase 4e-04
d1qhoa4 407 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase 0.003
d1upsa2131 b.42.2.3 (A:290-420) GlcNAc-alpha-1,4-Gal-releasin 4e-04
d1upsa2131 b.42.2.3 (A:290-420) GlcNAc-alpha-1,4-Gal-releasin 0.002
d1zu2a1145 a.118.8.1 (A:1-145) Mitochondrial import receptor 5e-04
d1hc7a2272 d.104.1.1 (A:5-276) Prolyl-tRNA synthetase (ProRS) 5e-04
d1mdoa_376 c.67.1.4 (A:) Aminotransferase ArnB {Salmonella ty 6e-04
d1mdoa_376 c.67.1.4 (A:) Aminotransferase ArnB {Salmonella ty 0.001
d2r6na1215 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sa 6e-04
d1i24a_ 393 c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 6e-04
d1r7aa2 434 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobac 7e-04
d1r7aa2 434 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobac 0.001
d1gy8a_ 383 c.2.1.2 (A:) Uridine diphosphogalactose-4-epimeras 8e-04
d1wpxa1421 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Bak 0.001
d1tn3a_137 d.169.1.1 (A:) Tetranectin {Human (Homo sapiens) [ 0.001
d2guya2381 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergill 0.001
d1khqa_212 d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId 0.001
d1iwda_215 d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia 0.002
d1s4va_224 d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor 0.002
d1qxma2138 b.42.2.1 (A:149-286) Hemagglutinin component Ha1 { 0.002
d1jc9a_220 d.171.1.1 (A:) Tachylectin 5a {Japanese horseshoe 0.002
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 0.002
d1ppoa_216 d.3.1.1 (A:) Caricain (protease omega) {Papaya (Ca 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
d1cd0a_111 b.1.1.1 (A:) Immunoglobulin light chain lambda var 0.003
d1m6da_214 d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [Ta 0.003
d1b9ha_384 c.67.1.4 (A:) 3-amino-5-hydroxybenzoic acid syntha 0.004
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Length = 265 Back     information, alignment and structure
>d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} Length = 406 Back     information, alignment and structure
>d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} Length = 381 Back     information, alignment and structure
>d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} Length = 381 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1h3ga3 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]} Length = 422 Back     information, alignment and structure
>d1jtdb_ b.69.5.2 (B:) beta-lactamase inhibitor protein-II, BLIP-II {Streptomyces exfoliatus [TaxId: 1905]} Length = 273 Back     information, alignment and structure
>d1jtdb_ b.69.5.2 (B:) beta-lactamase inhibitor protein-II, BLIP-II {Streptomyces exfoliatus [TaxId: 1905]} Length = 273 Back     information, alignment and structure
>d1jtdb_ b.69.5.2 (B:) beta-lactamase inhibitor protein-II, BLIP-II {Streptomyces exfoliatus [TaxId: 1905]} Length = 273 Back     information, alignment and structure
>d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 Back     information, alignment and structure
>d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 Back     information, alignment and structure
>d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 Back     information, alignment and structure
>d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2dtge6 g.3.9.1 (E:157-311) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 155 Back     information, alignment and structure
>d2dtge6 g.3.9.1 (E:157-311) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 155 Back     information, alignment and structure
>d2dtge6 g.3.9.1 (E:157-311) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 155 Back     information, alignment and structure
>d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Length = 175 Back     information, alignment and structure
>d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Length = 175 Back     information, alignment and structure
>d1n8yc3 g.3.9.1 (C:166-322) Protooncoprotein Her2 extracellular domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 157 Back     information, alignment and structure
>d1n8yc3 g.3.9.1 (C:166-322) Protooncoprotein Her2 extracellular domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 157 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1hupa1 d.169.1.1 (A:112-228) Mannose-binding protein A, C-lectin domain {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1hupa1 d.169.1.1 (A:112-228) Mannose-binding protein A, C-lectin domain {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1hupa1 d.169.1.1 (A:112-228) Mannose-binding protein A, C-lectin domain {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Length = 218 Back     information, alignment and structure
>d1igra3 g.3.9.1 (A:150-299) Type 1 insulin-like growth factor receptor Cys-rich domain {Human (Homo sapiens) [TaxId: 9606]} Length = 150 Back     information, alignment and structure
>d1igra3 g.3.9.1 (A:150-299) Type 1 insulin-like growth factor receptor Cys-rich domain {Human (Homo sapiens) [TaxId: 9606]} Length = 150 Back     information, alignment and structure
>d1m6ba3 g.3.9.1 (A:166-310) Receptor protein-tyrosine kinase Erbb-3 Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]} Length = 145 Back     information, alignment and structure
>d1m6ba3 g.3.9.1 (A:166-310) Receptor protein-tyrosine kinase Erbb-3 Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]} Length = 145 Back     information, alignment and structure
>d1m6ba3 g.3.9.1 (A:166-310) Receptor protein-tyrosine kinase Erbb-3 Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]} Length = 145 Back     information, alignment and structure
>d1rdl1_ d.169.1.1 (1:) Mannose-binding protein A, C-lectin domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 111 Back     information, alignment and structure
>d1qg8a_ c.68.1.1 (A:) Spore coat polysaccharide biosynthesis protein SpsA {Bacillus subtilis [TaxId: 1423]} Length = 255 Back     information, alignment and structure
>d1moxa3 g.3.9.1 (A:163-311) EGF receptor Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]} Length = 149 Back     information, alignment and structure
>d1moxa3 g.3.9.1 (A:163-311) EGF receptor Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]} Length = 149 Back     information, alignment and structure
>d1moxa3 g.3.9.1 (A:163-311) EGF receptor Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]} Length = 149 Back     information, alignment and structure
>d1moxa3 g.3.9.1 (A:163-311) EGF receptor Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]} Length = 149 Back     information, alignment and structure
>d1moxa3 g.3.9.1 (A:163-311) EGF receptor Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]} Length = 149 Back     information, alignment and structure
>d1olta_ c.1.28.2 (A:) Oxygen-independent coproporphyrinogen III oxidase HemN {Escherichia coli [TaxId: 562]} Length = 441 Back     information, alignment and structure
>d1olta_ c.1.28.2 (A:) Oxygen-independent coproporphyrinogen III oxidase HemN {Escherichia coli [TaxId: 562]} Length = 441 Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Length = 368 Back     information, alignment and structure
>d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Length = 215 Back     information, alignment and structure
>d1o69a_ c.67.1.4 (A:) Aminotransferase homolog WlaK (PglE, Cj1121c) {Campylobacter jejuni [TaxId: 197]} Length = 374 Back     information, alignment and structure
>d1wmza_ d.169.1.1 (A:) Lectin CEL-I {Cucumaria echinata [TaxId: 40245]} Length = 140 Back     information, alignment and structure
>d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} Length = 407 Back     information, alignment and structure
>d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} Length = 407 Back     information, alignment and structure
>d1upsa2 b.42.2.3 (A:290-420) GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosidase, GngC, C-terminal domain {Clostridium perfringens [TaxId: 1502]} Length = 131 Back     information, alignment and structure
>d1upsa2 b.42.2.3 (A:290-420) GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosidase, GngC, C-terminal domain {Clostridium perfringens [TaxId: 1502]} Length = 131 Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 145 Back     information, alignment and structure
>d1hc7a2 d.104.1.1 (A:5-276) Prolyl-tRNA synthetase (ProRS) {Thermus thermophilus [TaxId: 274]} Length = 272 Back     information, alignment and structure
>d1mdoa_ c.67.1.4 (A:) Aminotransferase ArnB {Salmonella typhimurium [TaxId: 90371]} Length = 376 Back     information, alignment and structure
>d1mdoa_ c.67.1.4 (A:) Aminotransferase ArnB {Salmonella typhimurium [TaxId: 90371]} Length = 376 Back     information, alignment and structure
>d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Length = 215 Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 393 Back     information, alignment and structure
>d1r7aa2 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]} Length = 434 Back     information, alignment and structure
>d1r7aa2 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]} Length = 434 Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Length = 383 Back     information, alignment and structure
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 421 Back     information, alignment and structure
>d1tn3a_ d.169.1.1 (A:) Tetranectin {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} Length = 381 Back     information, alignment and structure
>d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Length = 212 Back     information, alignment and structure
>d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Length = 215 Back     information, alignment and structure
>d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Length = 224 Back     information, alignment and structure
>d1qxma2 b.42.2.1 (A:149-286) Hemagglutinin component Ha1 {Clostridium botulinum D phage [TaxId: 29342]} Length = 138 Back     information, alignment and structure
>d1jc9a_ d.171.1.1 (A:) Tachylectin 5a {Japanese horseshoe crab (Tachypleus tridentatus) [TaxId: 6853]} Length = 220 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Length = 216 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1cd0a_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Length = 214 Back     information, alignment and structure
>d1b9ha_ c.67.1.4 (A:) 3-amino-5-hydroxybenzoic acid synthase (AHBA synthase) {Amycolatopsis mediterranei [TaxId: 33910]} Length = 384 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

No hit with probability above 80.00