Psyllid ID: psy14307
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1235 | ||||||
| 221054317 | 791 | hypothetical protein, conserved in Plasm | 0.177 | 0.276 | 0.306 | 4e-32 | |
| 70942861 | 453 | hypothetical protein [Plasmodium chabaud | 0.167 | 0.456 | 0.414 | 2e-30 | |
| 401408671 | 2995 | conserved hypothetical protein [Neospora | 0.166 | 0.068 | 0.436 | 3e-29 | |
| 156407240 | 251 | predicted protein [Nematostella vectensi | 0.167 | 0.824 | 0.360 | 4e-26 | |
| 343469593 | 1059 | unnamed protein product, partial [Trypan | 0.176 | 0.205 | 0.331 | 5e-25 | |
| 213626348 | 1139 | Mtap4 protein [Xenopus laevis] | 0.170 | 0.184 | 0.436 | 6e-24 | |
| 221060662 | 677 | hypothetical protein, conserved in Plasm | 0.174 | 0.317 | 0.341 | 2e-23 | |
| 156394511 | 222 | predicted protein [Nematostella vectensi | 0.170 | 0.950 | 0.238 | 4e-22 | |
| 148230813 | 1224 | microtubule-associated protein 4 [Xenopu | 0.153 | 0.154 | 0.447 | 1e-21 | |
| 291236357 | 468 | PREDICTED: predicted protein-like [Sacco | 0.276 | 0.730 | 0.277 | 1e-21 |
| >gi|221054317|ref|XP_002261906.1| hypothetical protein, conserved in Plasmodium species [Plasmodium knowlesi strain H] gi|193808366|emb|CAQ39070.1| hypothetical protein, conserved in Plasmodium species [Plasmodium knowlesi strain H] | Back alignment and taxonomy information |
|---|
Score = 147 bits (371), Expect = 4e-32, Method: Compositional matrix adjust.
Identities = 68/222 (30%), Positives = 127/222 (57%)
Query: 704 LLDKKEPVLLDKKEPVLLDKKEPVLLDKKEPVLLDKKEPVLLDEKEPVLLDKKEPVLLDK 763
L D+ + LLD+ + LLD+ + L+D+ + L+D+ + L+D + L+D+ + LLD+
Sbjct: 271 LTDRSDGTLLDRSDGSLLDRSDGTLMDRSDGTLMDRSDGTLMDRSDGTLMDRSDGSLLDR 330
Query: 764 KERVLLDKKEPVLLDKKEPVLLDKKEHVLLDKKETVLLDKKEPVLLDKKEPILLDKKEPV 823
+R L+D+ + LLDK + L+D+ + L+D+ + LLDK + +D+ + L+D+ +
Sbjct: 331 SDRTLVDRSDGSLLDKSDRTLVDRSDRTLIDRSDGSLLDKSDRNFIDRSDGTLMDRSDRT 390
Query: 824 LLDKKEPVLLDKKSPVLLDKKGPVILDKKEPVLLDKKEPVLLDKKEPVLLDKKAPVLLDK 883
L+D+ + LLDK L+D+ +LD + +LD + ++DK + +LDK +LDK
Sbjct: 391 LVDRSDGSLLDKSDRTLVDRSDETLLDASDRNVLDNFDRNVMDKFDRNVLDKFNRNVLDK 450
Query: 884 KEPVLLDKKEPVLLDKKEPVLLDKKEPILFEKAALKVQTKPE 925
+ +LDK +LD+ + +LDK + +K V K +
Sbjct: 451 FDRNVLDKFNRNVLDRFDRNVLDKFNRNVLDKFDRNVCDKFD 492
|
Source: Plasmodium knowlesi strain H Species: Plasmodium knowlesi Genus: Plasmodium Family: Order: Haemosporida Class: Aconoidasida Phylum: Apicomplexa Superkingdom: Eukaryota |
| >gi|70942861|ref|XP_741546.1| hypothetical protein [Plasmodium chabaudi chabaudi] gi|56519994|emb|CAH86804.1| hypothetical protein PC302162.00.0 [Plasmodium chabaudi chabaudi] | Back alignment and taxonomy information |
|---|
| >gi|401408671|ref|XP_003883784.1| conserved hypothetical protein [Neospora caninum Liverpool] gi|325118201|emb|CBZ53752.1| conserved hypothetical protein [Neospora caninum Liverpool] | Back alignment and taxonomy information |
|---|
| >gi|156407240|ref|XP_001641452.1| predicted protein [Nematostella vectensis] gi|156228591|gb|EDO49389.1| predicted protein [Nematostella vectensis] | Back alignment and taxonomy information |
|---|
| >gi|343469593|emb|CCD17471.1| unnamed protein product, partial [Trypanosoma congolense IL3000] | Back alignment and taxonomy information |
|---|
| >gi|213626348|gb|AAI70295.1| Mtap4 protein [Xenopus laevis] | Back alignment and taxonomy information |
|---|
| >gi|221060662|ref|XP_002260976.1| hypothetical protein, conserved in Plasmodium species [Plasmodium knowlesi strain H] gi|193811050|emb|CAQ42948.1| hypothetical protein, conserved in Plasmodium species [Plasmodium knowlesi strain H] | Back alignment and taxonomy information |
|---|
| >gi|156394511|ref|XP_001636869.1| predicted protein [Nematostella vectensis] gi|156223976|gb|EDO44806.1| predicted protein [Nematostella vectensis] | Back alignment and taxonomy information |
|---|
| >gi|148230813|ref|NP_001083770.1| microtubule-associated protein 4 [Xenopus laevis] gi|4063005|dbj|BAA36221.1| XMAP4 [Xenopus laevis] | Back alignment and taxonomy information |
|---|
| >gi|291236357|ref|XP_002738106.1| PREDICTED: predicted protein-like [Saccoglossus kowalevskii] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1235 | ||||||
| TAIR|locus:2144716 | 370 | PELPK1 "AT5G09530" [Arabidopsi | 0.162 | 0.543 | 0.440 | 6.6e-41 | |
| GENEDB_PFALCIPARUM|PF10_0374 | 9563 | PF10_0374 "Pf 11-1 protein" [P | 0.180 | 0.023 | 0.415 | 9.5e-33 | |
| UNIPROTKB|Q8I6U6 | 9563 | PF10_0374 "Pf11-1 protein" [Pl | 0.180 | 0.023 | 0.415 | 9.5e-33 | |
| UNIPROTKB|F1MDS0 | 1337 | F1MDS0 "Uncharacterized protei | 0.319 | 0.295 | 0.259 | 6.7e-20 | |
| MGI|MGI:1891344 | 1054 | Prg4 "proteoglycan 4 (megakary | 0.243 | 0.285 | 0.329 | 1.3e-28 | |
| UNIPROTKB|J3KP74 | 854 | PRG4 "Proteoglycan 4" [Homo sa | 0.199 | 0.288 | 0.313 | 1.6e-17 | |
| UNIPROTKB|Q92954 | 1404 | PRG4 "Proteoglycan 4" [Homo sa | 0.199 | 0.175 | 0.313 | 6.7e-17 | |
| UNIPROTKB|G3MYM8 | 1077 | G3MYM8 "Uncharacterized protei | 0.326 | 0.374 | 0.271 | 9.7e-19 | |
| UNIPROTKB|F1N757 | 34 | F1N757 "Uncharacterized protei | 0.144 | 5.235 | 0.375 | 1.4e-19 | |
| RGD|1308976 | 963 | Prg4 "proteoglycan 4, (megakar | 0.215 | 0.276 | 0.316 | 6.5e-24 |
| TAIR|locus:2144716 PELPK1 "AT5G09530" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 442 (160.7 bits), Expect = 6.6e-41, P = 6.6e-41
Identities = 93/211 (44%), Positives = 138/211 (65%)
Query: 261 KIKENIDPELGNLSDLN--EDLKKPGEPEVQTPIVPEPTKQELPEVPETTKPQLPEVPEP 318
KI E PEL + ++ E+ K P P+++ P PE K ELP++PE KP+LP+VPE
Sbjct: 80 KIPEIPKPELPKVPEIPKPEETKLPDIPKLELPKFPEIPKPELPKMPEIPKPELPKVPEI 139
Query: 319 TKSQLPEVPEPTKPQLPEVLEPTTLQLPEDPEPTKPQLPEDPEPTKPQLPEVPEPTKPQL 378
K +LP++PE KP+LP+ E LP+ PE +KP++P+ E KP+ P+VPE KP+L
Sbjct: 140 QKPELPKMPEIPKPELPKFPEIPKPDLPKFPENSKPEVPKLMETEKPEAPKVPEIPKPEL 199
Query: 379 PEVLEPTKLQLPEDPE------PTKPQLPEDPETTKPQLPEVPEPTKLQLPEVPEPTKPE 432
P++ E KL+ P+ PE P P+LP+ PE KP+LP++PE KL+ P+VPE KPE
Sbjct: 200 PKLPEVPKLEAPKVPEIQKPELPKMPELPKMPEIQKPELPKLPEVPKLEAPKVPEIQKPE 259
Query: 433 LPEVPELTKTQLPEVPEPTKPQILDKKEPVL 463
LP++PEL K +PE+ +P P++ + ++P L
Sbjct: 260 LPKMPELPK--MPEIQKPELPKMPEIQKPEL 288
|
|
| GENEDB_PFALCIPARUM|PF10_0374 PF10_0374 "Pf 11-1 protein" [Plasmodium falciparum (taxid:5833)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8I6U6 PF10_0374 "Pf11-1 protein" [Plasmodium falciparum 3D7 (taxid:36329)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MDS0 F1MDS0 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1891344 Prg4 "proteoglycan 4 (megakaryocyte stimulating factor, articular superficial zone protein)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J3KP74 PRG4 "Proteoglycan 4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q92954 PRG4 "Proteoglycan 4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3MYM8 G3MYM8 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N757 F1N757 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| RGD|1308976 Prg4 "proteoglycan 4, (megakaryocyte stimulating factor, articular superficial zone protein, camptodactyly, arthropathy, coxa vara, pericarditis syndrome)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1235 | |||
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 1e-18 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 5e-14 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 5e-14 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 3e-11 | |
| PTZ00465 | 565 | PTZ00465, PTZ00465, rhoptry-associated protein 1 ( | 8e-11 | |
| PHA03378 | 991 | PHA03378, PHA03378, EBNA-3B; Provisional | 2e-08 | |
| pfam00577 | 552 | pfam00577, Usher, Type VII secretion system (T7SS) | 3e-07 | |
| PRK15313 | 955 | PRK15313, PRK15313, autotransport protein MisL; Pr | 6e-07 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 3e-06 | |
| PRK10263 | 1355 | PRK10263, PRK10263, DNA translocase FtsK; Provisio | 4e-06 | |
| PHA03378 | 991 | PHA03378, PHA03378, EBNA-3B; Provisional | 5e-06 | |
| PRK10263 | 1355 | PRK10263, PRK10263, DNA translocase FtsK; Provisio | 1e-05 | |
| PRK10263 | 1355 | PRK10263, PRK10263, DNA translocase FtsK; Provisio | 1e-05 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 1e-05 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 1e-05 | |
| pfam05887 | 145 | pfam05887, Trypan_PARP, Procyclic acidic repetitiv | 1e-05 | |
| PRK15313 | 955 | PRK15313, PRK15313, autotransport protein MisL; Pr | 2e-05 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 2e-05 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 3e-05 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 3e-05 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 3e-05 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 4e-05 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 5e-05 | |
| pfam11912 | 204 | pfam11912, DUF3430, Protein of unknown function (D | 6e-05 | |
| PRK03427 | 333 | PRK03427, PRK03427, cell division protein ZipA; Pr | 6e-05 | |
| COG3087 | 264 | COG3087, FtsN, Cell division protein [Cell divisio | 9e-05 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 1e-04 | |
| pfam05887 | 145 | pfam05887, Trypan_PARP, Procyclic acidic repetitiv | 1e-04 | |
| PLN03209 | 576 | PLN03209, PLN03209, translocon at the inner envelo | 1e-04 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 2e-04 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 2e-04 | |
| PRK10819 | 246 | PRK10819, PRK10819, transport protein TonB; Provis | 2e-04 | |
| pfam00577 | 552 | pfam00577, Usher, Type VII secretion system (T7SS) | 3e-04 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 3e-04 | |
| PRK10819 | 246 | PRK10819, PRK10819, transport protein TonB; Provis | 3e-04 | |
| PRK10819 | 246 | PRK10819, PRK10819, transport protein TonB; Provis | 3e-04 | |
| PRK10819 | 246 | PRK10819, PRK10819, transport protein TonB; Provis | 3e-04 | |
| PRK15313 | 955 | PRK15313, PRK15313, autotransport protein MisL; Pr | 4e-04 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 4e-04 | |
| COG5263 | 313 | COG5263, COG5263, FOG: Glucan-binding domain (YG r | 4e-04 | |
| PRK10263 | 1355 | PRK10263, PRK10263, DNA translocase FtsK; Provisio | 6e-04 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 9e-04 | |
| PRK10263 | 1355 | PRK10263, PRK10263, DNA translocase FtsK; Provisio | 0.001 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 0.001 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 0.001 | |
| pfam05887 | 145 | pfam05887, Trypan_PARP, Procyclic acidic repetitiv | 0.001 | |
| pfam05887 | 145 | pfam05887, Trypan_PARP, Procyclic acidic repetitiv | 0.001 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 0.001 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 0.001 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 0.001 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 0.002 | |
| PRK03427 | 333 | PRK03427, PRK03427, cell division protein ZipA; Pr | 0.002 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 0.002 | |
| PRK11633 | 226 | PRK11633, PRK11633, cell division protein DedD; Pr | 0.002 | |
| PRK14971 | 614 | PRK14971, PRK14971, DNA polymerase III subunits ga | 0.002 | |
| pfam05887 | 145 | pfam05887, Trypan_PARP, Procyclic acidic repetitiv | 0.003 | |
| pfam05887 | 145 | pfam05887, Trypan_PARP, Procyclic acidic repetitiv | 0.003 | |
| PRK10819 | 246 | PRK10819, PRK10819, transport protein TonB; Provis | 0.003 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 0.003 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 0.003 | |
| PRK11633 | 226 | PRK11633, PRK11633, cell division protein DedD; Pr | 0.003 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 0.004 | |
| pfam05887 | 145 | pfam05887, Trypan_PARP, Procyclic acidic repetitiv | 0.004 | |
| pfam11912 | 204 | pfam11912, DUF3430, Protein of unknown function (D | 0.004 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 0.004 | |
| PRK11633 | 226 | PRK11633, PRK11633, cell division protein DedD; Pr | 0.004 | |
| TIGR04056 | 982 | TIGR04056, OMP_RagA_SusC, TonB-linked outer membra | 0.004 | |
| pfam05297 | 382 | pfam05297, Herpes_LMP1, Herpesvirus latent membran | 0.004 | |
| PTZ00449 | 943 | PTZ00449, PTZ00449, 104 kDa microneme/rhoptry anti | 0.004 |
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
Score = 92.3 bits (229), Expect = 1e-18
Identities = 99/470 (21%), Positives = 134/470 (28%), Gaps = 76/470 (16%)
Query: 282 KPGEPEVQT----PIVP-EPTKQELPEVPETTKP-QLPEVPEPTKSQLPEVPEPT-KPQL 334
+P EP V + P P + + P P P P + P+ P P+ P
Sbjct: 2576 RPSEPAVTSRARRPDAPPQSARPRAPVDDRGDPRGPAPPSPLPPDTHAPDPPPPSPSPAA 2635
Query: 335 PEVLEPTTLQLPEDPEPTKPQLP-------EDPEPTKPQLPEVP--EPTKPQLPEVLEP- 384
E +P P P + P P + +
Sbjct: 2636 NEPDPHPPPTVPPPERPRDDPAPGRVSRPRRARRLGRAAQASSPPQRPRRRAARPTVGSL 2695
Query: 385 TKLQLPEDPEPTKPQLPED-PETTKPQLPEVPEPTKLQLPEVPEPTKPELPEVPELTKTQ 443
T L P P PT PE P P P P + P P P VP T
Sbjct: 2696 TSLADPPPPPPT----PEPAPHALVSATPLPPGPAAARQASPALPAAPAPPAVPAGPATP 2751
Query: 444 LPEVPEPTKPQILDKKEPVLLDKKEPVLLDKKEPVLPPKPEPEILLPPKPEPELL----L 499
P P P P P L P L
Sbjct: 2752 GGPARPARPPTTAGPPAPA-------------PPAAPAAGPPRRLTRPAVASLSESRESL 2798
Query: 500 PPKPEPELLLPPKLEPKLLLPPKSEPELLLPPKPEPELLLPPKPKPELLL---------- 549
P +P L P LPP + P LPP + PP P
Sbjct: 2799 PSPWDPADPPAAVLAPAAALPPAASPAGPLPPPTSAQPTAPPPPPGPPPPSLPLGGSVAP 2858
Query: 550 --------PPKPEPEKLLLPPKPKPKLLLPPKPESELLLPPKPEPELIIPPKPEPEILIP 601
P + K P +P + L P E P +PE
Sbjct: 2859 GGDVRRRPPSRSPAAKPAAPARPPVRRLARP--------AVSRSTESFALPPDQPE---- 2906
Query: 602 PKPEPELLLPPKPEPEILLPPKPEPELLLPPKPEPEILLPPKPEPELL-----LPPKPES 656
P+P+ PP+P+P+ PP+P+P PP+P+P L P +P P+P
Sbjct: 2907 RPPQPQAPPPPQPQPQPPPPPQPQPPPPPPPRPQPP--LAPTTDPAGAGEPSGAVPQPWL 2964
Query: 657 ELLLPLKPEPEILLPPKPEPELLLPPKPEPELLLPPKPETITTTKTLLLD 706
L+P + P+P P P P L + +L L
Sbjct: 2965 GALVPGRVAVPRFRVPQPAPSREAPASSTPPLTGHSLSRVSSWASSLALH 3014
|
Length = 3151 |
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185644 PTZ00465, PTZ00465, rhoptry-associated protein 1 (RAP-1); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216001 pfam00577, Usher, Type VII secretion system (T7SS), usher protein | Back alignment and domain information |
|---|
| >gnl|CDD|237940 PRK15313, PRK15313, autotransport protein MisL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|114603 pfam05887, Trypan_PARP, Procyclic acidic repetitive protein (PARP) | Back alignment and domain information |
|---|
| >gnl|CDD|237940 PRK15313, PRK15313, autotransport protein MisL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221309 pfam11912, DUF3430, Protein of unknown function (DUF3430) | Back alignment and domain information |
|---|
| >gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225629 COG3087, FtsN, Cell division protein [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|114603 pfam05887, Trypan_PARP, Procyclic acidic repetitive protein (PARP) | Back alignment and domain information |
|---|
| >gnl|CDD|178748 PLN03209, PLN03209, translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236768 PRK10819, PRK10819, transport protein TonB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216001 pfam00577, Usher, Type VII secretion system (T7SS), usher protein | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236768 PRK10819, PRK10819, transport protein TonB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236768 PRK10819, PRK10819, transport protein TonB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236768 PRK10819, PRK10819, transport protein TonB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237940 PRK15313, PRK15313, autotransport protein MisL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227588 COG5263, COG5263, FOG: Glucan-binding domain (YG repeat) [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|114603 pfam05887, Trypan_PARP, Procyclic acidic repetitive protein (PARP) | Back alignment and domain information |
|---|
| >gnl|CDD|114603 pfam05887, Trypan_PARP, Procyclic acidic repetitive protein (PARP) | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|114603 pfam05887, Trypan_PARP, Procyclic acidic repetitive protein (PARP) | Back alignment and domain information |
|---|
| >gnl|CDD|114603 pfam05887, Trypan_PARP, Procyclic acidic repetitive protein (PARP) | Back alignment and domain information |
|---|
| >gnl|CDD|236768 PRK10819, PRK10819, transport protein TonB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|114603 pfam05887, Trypan_PARP, Procyclic acidic repetitive protein (PARP) | Back alignment and domain information |
|---|
| >gnl|CDD|221309 pfam11912, DUF3430, Protein of unknown function (DUF3430) | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234450 TIGR04056, OMP_RagA_SusC, TonB-linked outer membrane protein, SusC/RagA family | Back alignment and domain information |
|---|
| >gnl|CDD|114045 pfam05297, Herpes_LMP1, Herpesvirus latent membrane protein 1 (LMP1) | Back alignment and domain information |
|---|
| >gnl|CDD|185628 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry antigen; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1235 | |||
| PHA03247 | 3151 | large tegument protein UL36; Provisional | 98.97 | |
| PHA03247 | 3151 | large tegument protein UL36; Provisional | 98.95 | |
| KOG3671|consensus | 569 | 95.72 | ||
| KOG3671|consensus | 569 | 94.2 | ||
| KOG1924|consensus | 1102 | 91.29 | ||
| PTZ00491 | 850 | major vault protein; Provisional | 91.21 | |
| PTZ00491 | 850 | major vault protein; Provisional | 80.62 |
| >PHA03247 large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
Probab=98.97 E-value=2.3e-05 Score=103.71 Aligned_cols=24 Identities=17% Similarity=-0.017 Sum_probs=16.4
Q ss_pred hhhhcccccccc-----------cccCccceeece
Q psy14307 141 QQKETANVNSAD-----------LVNNRENVVKPV 164 (1235)
Q Consensus 141 q~~~~~~v~~~~-----------~~~~~~~~~k~~ 164 (1235)
||+|-+=-|.++ |+|.+-+.+|+-
T Consensus 2377 ~QLe~LSaLiAsKPLa~aPPCLvlvD~~m~p~~VL 2411 (3151)
T PHA03247 2377 AQLPALSALIAARPLARSPPCLVLVDISMAPLFVL 2411 (3151)
T ss_pred HHHHHHHHHHhcCcccCCCCeEEEEcCCCceeEEe
Confidence 777766655555 777777777764
|
|
| >PHA03247 large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >KOG3671|consensus | Back alignment and domain information |
|---|
| >KOG3671|consensus | Back alignment and domain information |
|---|
| >KOG1924|consensus | Back alignment and domain information |
|---|
| >PTZ00491 major vault protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00491 major vault protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1235 | |||
| 2ahx_A | 617 | P180ERBB4, receptor tyrosine-protein kinase ERBB-4 | 1e-13 | |
| 2ahx_A | 617 | P180ERBB4, receptor tyrosine-protein kinase ERBB-4 | 2e-11 | |
| 2ahx_A | 617 | P180ERBB4, receptor tyrosine-protein kinase ERBB-4 | 5e-11 | |
| 2ahx_A | 617 | P180ERBB4, receptor tyrosine-protein kinase ERBB-4 | 1e-10 | |
| 2ahx_A | 617 | P180ERBB4, receptor tyrosine-protein kinase ERBB-4 | 1e-10 | |
| 3ttq_A | 1108 | Dextransucrase; (beta/alpha)8 barrel, transferase; | 1e-11 | |
| 3ttq_A | 1108 | Dextransucrase; (beta/alpha)8 barrel, transferase; | 1e-10 | |
| 3ttq_A | 1108 | Dextransucrase; (beta/alpha)8 barrel, transferase; | 2e-07 | |
| 3ttq_A | 1108 | Dextransucrase; (beta/alpha)8 barrel, transferase; | 3e-07 | |
| 3ttq_A | 1108 | Dextransucrase; (beta/alpha)8 barrel, transferase; | 9e-05 | |
| 2qj6_A | 332 | Toxin A; clostridial repetitive oligo peptides; 2. | 4e-11 | |
| 2qj6_A | 332 | Toxin A; clostridial repetitive oligo peptides; 2. | 4e-06 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 6e-11 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 2e-10 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 3e-10 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 4e-10 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 6e-10 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 7e-08 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 1e-07 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 1e-07 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 2e-07 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 2e-07 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 3e-07 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 3e-07 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 4e-07 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 6e-07 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 1e-06 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 2e-06 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 3e-06 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 4e-06 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 9e-06 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 2e-10 | |
| 2ww5_A | 468 | LYTC autolysin, 1,4-beta-N-acetylmuramidase; hydro | 3e-10 | |
| 2ww5_A | 468 | LYTC autolysin, 1,4-beta-N-acetylmuramidase; hydro | 1e-07 | |
| 2ww5_A | 468 | LYTC autolysin, 1,4-beta-N-acetylmuramidase; hydro | 5e-04 | |
| 3fip_A | 493 | Outer membrane usher protein PAPC; beta barrel, pr | 5e-10 | |
| 3fip_A | 493 | Outer membrane usher protein PAPC; beta barrel, pr | 1e-09 | |
| 2v05_A | 311 | Choline binding protein F; CBPF, lipid-binding-pro | 9e-10 | |
| 2v05_A | 311 | Choline binding protein F; CBPF, lipid-binding-pro | 2e-07 | |
| 2j8g_A | 339 | Lysozyme; antimicrobial, muein hydrolase, bacterio | 3e-09 | |
| 2j8g_A | 339 | Lysozyme; antimicrobial, muein hydrolase, bacterio | 9e-07 | |
| 2j8g_A | 339 | Lysozyme; antimicrobial, muein hydrolase, bacterio | 1e-06 | |
| 2hr7_A | 486 | Insulin receptor; hormone receptor, leucine rich r | 1e-07 | |
| 2hr7_A | 486 | Insulin receptor; hormone receptor, leucine rich r | 6e-06 | |
| 3aj6_A | 286 | Main hemagglutinin component; toxin, beta-trefoil; | 2e-07 | |
| 2bib_A | 547 | CBPE, teichoic acid phosphorylcholine esterase/ ch | 8e-07 | |
| 2bib_A | 547 | CBPE, teichoic acid phosphorylcholine esterase/ ch | 4e-06 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 9e-07 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 1e-05 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 7e-05 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 2e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-06 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 2e-06 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 8e-05 | |
| 1ybi_A | 288 | HA33A, HA33/A, non-toxin haemagglutinin HA34; beta | 4e-06 | |
| 1ybi_A | 288 | HA33A, HA33/A, non-toxin haemagglutinin HA34; beta | 2e-05 | |
| 1m6b_A | 621 | C-ER, receptor protein-tyrosine kinase ERBB-3; cel | 4e-06 | |
| 1m6b_A | 621 | C-ER, receptor protein-tyrosine kinase ERBB-3; cel | 7e-06 | |
| 1m6b_A | 621 | C-ER, receptor protein-tyrosine kinase ERBB-3; cel | 3e-05 | |
| 1m6b_A | 621 | C-ER, receptor protein-tyrosine kinase ERBB-3; cel | 2e-04 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 5e-06 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 2e-05 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 5e-04 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 7e-04 | |
| 1igr_A | 478 | Insulin-like growth factor receptor 1; hormone rec | 5e-06 | |
| 1igr_A | 478 | Insulin-like growth factor receptor 1; hormone rec | 1e-05 | |
| 2wvr_C | 546 | DNA replication factor CDT1; DNA replication licen | 7e-06 | |
| 2wvr_C | 546 | DNA replication factor CDT1; DNA replication licen | 1e-05 | |
| 2wvr_C | 546 | DNA replication factor CDT1; DNA replication licen | 2e-05 | |
| 2wvr_C | 546 | DNA replication factor CDT1; DNA replication licen | 8e-05 | |
| 2wvr_C | 546 | DNA replication factor CDT1; DNA replication licen | 2e-04 | |
| 3rfz_B | 843 | Outer membrane usher protein, type 1 fimbrial SYN; | 9e-06 | |
| 3rfz_B | 843 | Outer membrane usher protein, type 1 fimbrial SYN; | 3e-05 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 2e-05 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 4e-05 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 1e-04 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 2e-04 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 2e-04 | |
| 2g7c_A | 255 | Toxin A; linear B trisaccharide, protein-carbohydr | 2e-05 | |
| 2g7c_A | 255 | Toxin A; linear B trisaccharide, protein-carbohydr | 4e-05 | |
| 2g7c_A | 255 | Toxin A; linear B trisaccharide, protein-carbohydr | 4e-05 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 3e-05 | |
| 3i2t_A | 551 | Epidermal growth factor receptor, isoform A; EGFR, | 3e-05 | |
| 3i2t_A | 551 | Epidermal growth factor receptor, isoform A; EGFR, | 3e-04 | |
| 1yy9_A | 624 | Epidermal growth factor receptor; cell surface rec | 4e-05 | |
| 1yy9_A | 624 | Epidermal growth factor receptor; cell surface rec | 3e-04 | |
| 1n8y_C | 608 | Protooncoprotein; tyrosin kinase receptor, cell su | 7e-05 | |
| 3klk_A | 1039 | Glucansucrase; native form, open conformation, mul | 1e-04 | |
| 1ki0_A | 253 | Angiostatin; kringle domains, hydrolase; HET: BCN; | 1e-04 | |
| 2grx_C | 229 | Protein TONB; beta barrel, outer membrane, heteroc | 2e-04 | |
| 2grx_C | 229 | Protein TONB; beta barrel, outer membrane, heteroc | 3e-04 | |
| 2grx_C | 229 | Protein TONB; beta barrel, outer membrane, heteroc | 7e-04 | |
| 2grx_C | 229 | Protein TONB; beta barrel, outer membrane, heteroc | 9e-04 |
| >2ahx_A P180ERBB4, receptor tyrosine-protein kinase ERBB-4; X-RAY crystallography, neuregulins, heparin-binding, cell CY signaling protein; HET: NAG NDG; 2.40A {Homo sapiens} PDB: 3u2p_A* Length = 617 | Back alignment and structure |
|---|
Score = 74.7 bits (182), Expect = 1e-13
Identities = 22/244 (9%), Positives = 52/244 (21%), Gaps = 25/244 (10%)
Query: 992 QNYYFHQNQSQNYYYHQNLSQNYYYHQNLSLKYYCRRNLSQNYYCHQNQSPNNYYYHLNL 1051
+ N + + Q+ S + +
Sbjct: 355 NAIEAIDPEKLNVFRTVREITGFLNIQSWPPNMTDFSVFSNLVTIGGRVLYSGLSLLILK 414
Query: 1052 SQNYYFHQNQSQNYYYHQNLSQNYYYHQNLSLKYYCRRNLSQNYYCHQNQSQNYYYHQNQ 1111
Q Q QS + N Y N +L YY N + +Q N+
Sbjct: 415 QQGITSLQFQSLKEIS----AGNIYITDNSNLCYYHTINWTT---LFSTINQRIVIRDNR 467
Query: 1112 SQNYYYHQNQSQKYYYHQNLSQNYYYHQNLSQNYYCHQNQSQNYYYHQNQSQKYYYHQNL 1171
++ + S + + Q C + + +
Sbjct: 468 ----KAENCTAEGMVCNHLCSSDGCWGPGPDQCLSCRRFSRGRICIESCNLYDGEFREFE 523
Query: 1172 SQN--------CYYHQNRSQNYY---YHQNLSQNYYYHQNQSQK---NYYYHLNLSQNYY 1217
+ + C ++ + +++ + + N Y
Sbjct: 524 NDSICVECDPQCEKMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKCPDGLQGANSFIFKY 583
Query: 1218 YHQN 1221
+
Sbjct: 584 ADPD 587
|
| >2ahx_A P180ERBB4, receptor tyrosine-protein kinase ERBB-4; X-RAY crystallography, neuregulins, heparin-binding, cell CY signaling protein; HET: NAG NDG; 2.40A {Homo sapiens} PDB: 3u2p_A* Length = 617 | Back alignment and structure |
|---|
| >2ahx_A P180ERBB4, receptor tyrosine-protein kinase ERBB-4; X-RAY crystallography, neuregulins, heparin-binding, cell CY signaling protein; HET: NAG NDG; 2.40A {Homo sapiens} PDB: 3u2p_A* Length = 617 | Back alignment and structure |
|---|
| >2ahx_A P180ERBB4, receptor tyrosine-protein kinase ERBB-4; X-RAY crystallography, neuregulins, heparin-binding, cell CY signaling protein; HET: NAG NDG; 2.40A {Homo sapiens} PDB: 3u2p_A* Length = 617 | Back alignment and structure |
|---|
| >2ahx_A P180ERBB4, receptor tyrosine-protein kinase ERBB-4; X-RAY crystallography, neuregulins, heparin-binding, cell CY signaling protein; HET: NAG NDG; 2.40A {Homo sapiens} PDB: 3u2p_A* Length = 617 | Back alignment and structure |
|---|
| >3ttq_A Dextransucrase; (beta/alpha)8 barrel, transferase; HET: PG4; 1.90A {Leuconostoc mesenteroides} PDB: 3tto_A* Length = 1108 | Back alignment and structure |
|---|
| >3ttq_A Dextransucrase; (beta/alpha)8 barrel, transferase; HET: PG4; 1.90A {Leuconostoc mesenteroides} PDB: 3tto_A* Length = 1108 | Back alignment and structure |
|---|
| >3ttq_A Dextransucrase; (beta/alpha)8 barrel, transferase; HET: PG4; 1.90A {Leuconostoc mesenteroides} PDB: 3tto_A* Length = 1108 | Back alignment and structure |
|---|
| >3ttq_A Dextransucrase; (beta/alpha)8 barrel, transferase; HET: PG4; 1.90A {Leuconostoc mesenteroides} PDB: 3tto_A* Length = 1108 | Back alignment and structure |
|---|
| >3ttq_A Dextransucrase; (beta/alpha)8 barrel, transferase; HET: PG4; 1.90A {Leuconostoc mesenteroides} PDB: 3tto_A* Length = 1108 | Back alignment and structure |
|---|
| >2qj6_A Toxin A; clostridial repetitive oligo peptides; 2.50A {Clostridium difficile} Length = 332 | Back alignment and structure |
|---|
| >2qj6_A Toxin A; clostridial repetitive oligo peptides; 2.50A {Clostridium difficile} Length = 332 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Length = 503 | Back alignment and structure |
|---|
| >2ww5_A LYTC autolysin, 1,4-beta-N-acetylmuramidase; hydrolase, glycosidase, choline-binding protein; 1.61A {Streptococcus pneumoniae} PDB: 2wwd_A* 2wwc_A Length = 468 | Back alignment and structure |
|---|
| >2ww5_A LYTC autolysin, 1,4-beta-N-acetylmuramidase; hydrolase, glycosidase, choline-binding protein; 1.61A {Streptococcus pneumoniae} PDB: 2wwd_A* 2wwc_A Length = 468 | Back alignment and structure |
|---|
| >2ww5_A LYTC autolysin, 1,4-beta-N-acetylmuramidase; hydrolase, glycosidase, choline-binding protein; 1.61A {Streptococcus pneumoniae} PDB: 2wwd_A* 2wwc_A Length = 468 | Back alignment and structure |
|---|
| >3fip_A Outer membrane usher protein PAPC; beta barrel, protein translocase, cell membrane, cell outer fimbrium, transmembrane, transport; 3.15A {Escherichia coli} PDB: 2vqi_A* Length = 493 | Back alignment and structure |
|---|
| >3fip_A Outer membrane usher protein PAPC; beta barrel, protein translocase, cell membrane, cell outer fimbrium, transmembrane, transport; 3.15A {Escherichia coli} PDB: 2vqi_A* Length = 493 | Back alignment and structure |
|---|
| >2v05_A Choline binding protein F; CBPF, lipid-binding-protein; 1.67A {Streptococcus pneumoniae} PDB: 2v04_A 2x8m_A* 2x8o_A* 2x8p_A* 2vyu_A Length = 311 | Back alignment and structure |
|---|
| >2v05_A Choline binding protein F; CBPF, lipid-binding-protein; 1.67A {Streptococcus pneumoniae} PDB: 2v04_A 2x8m_A* 2x8o_A* 2x8p_A* 2vyu_A Length = 311 | Back alignment and structure |
|---|
| >2j8g_A Lysozyme; antimicrobial, muein hydrolase, bacteriolytic enzyme, pneumococcal cell WALL degradation, hydrolase, glycosidase, multimodular; HET: NAG AMV; 1.69A {Bacteriophage cp-1} SCOP: b.109.1.1 c.1.8.8 PDB: 2ixv_A* 2j8f_A* 2ixu_A* 1h09_A 1oba_A Length = 339 | Back alignment and structure |
|---|
| >2j8g_A Lysozyme; antimicrobial, muein hydrolase, bacteriolytic enzyme, pneumococcal cell WALL degradation, hydrolase, glycosidase, multimodular; HET: NAG AMV; 1.69A {Bacteriophage cp-1} SCOP: b.109.1.1 c.1.8.8 PDB: 2ixv_A* 2j8f_A* 2ixu_A* 1h09_A 1oba_A Length = 339 | Back alignment and structure |
|---|
| >2j8g_A Lysozyme; antimicrobial, muein hydrolase, bacteriolytic enzyme, pneumococcal cell WALL degradation, hydrolase, glycosidase, multimodular; HET: NAG AMV; 1.69A {Bacteriophage cp-1} SCOP: b.109.1.1 c.1.8.8 PDB: 2ixv_A* 2j8f_A* 2ixu_A* 1h09_A 1oba_A Length = 339 | Back alignment and structure |
|---|
| >2hr7_A Insulin receptor; hormone receptor, leucine rich repeat, transferase; HET: NAG BMA MAN FUC P33; 2.32A {Homo sapiens} Length = 486 | Back alignment and structure |
|---|
| >2hr7_A Insulin receptor; hormone receptor, leucine rich repeat, transferase; HET: NAG BMA MAN FUC P33; 2.32A {Homo sapiens} Length = 486 | Back alignment and structure |
|---|
| >3aj6_A Main hemagglutinin component; toxin, beta-trefoil; HET: NGA; 1.48A {Clostridium botulinum} PDB: 1qxm_A 3aj5_A* 2ehm_A* 2ehi_A* 2ehn_A* 3ah1_A* 3ah2_A* 3ah4_A* 2e4m_A Length = 286 | Back alignment and structure |
|---|
| >2bib_A CBPE, teichoic acid phosphorylcholine esterase/ choline protein; choline-binding protein, PCE, phosphorylcholine estera hydrolase; HET: PC BTB; 1.92A {Streptococcus pneumoniae} SCOP: b.109.1.1 d.157.1.8 PDB: 1wra_A* Length = 547 | Back alignment and structure |
|---|
| >2bib_A CBPE, teichoic acid phosphorylcholine esterase/ choline protein; choline-binding protein, PCE, phosphorylcholine estera hydrolase; HET: PC BTB; 1.92A {Streptococcus pneumoniae} SCOP: b.109.1.1 d.157.1.8 PDB: 1wra_A* Length = 547 | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 | Back alignment and structure |
|---|
| >1ybi_A HA33A, HA33/A, non-toxin haemagglutinin HA34; beta-trefoil; 1.50A {Clostridium botulinum} Length = 288 | Back alignment and structure |
|---|
| >1ybi_A HA33A, HA33/A, non-toxin haemagglutinin HA34; beta-trefoil; 1.50A {Clostridium botulinum} Length = 288 | Back alignment and structure |
|---|
| >1m6b_A C-ER, receptor protein-tyrosine kinase ERBB-3; cell surface receptor, immunity, signaling transferase; HET: NAG NDG; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 PDB: 3p11_A* Length = 621 | Back alignment and structure |
|---|
| >1m6b_A C-ER, receptor protein-tyrosine kinase ERBB-3; cell surface receptor, immunity, signaling transferase; HET: NAG NDG; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 PDB: 3p11_A* Length = 621 | Back alignment and structure |
|---|
| >1m6b_A C-ER, receptor protein-tyrosine kinase ERBB-3; cell surface receptor, immunity, signaling transferase; HET: NAG NDG; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 PDB: 3p11_A* Length = 621 | Back alignment and structure |
|---|
| >1m6b_A C-ER, receptor protein-tyrosine kinase ERBB-3; cell surface receptor, immunity, signaling transferase; HET: NAG NDG; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 PDB: 3p11_A* Length = 621 | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 | Back alignment and structure |
|---|
| >1igr_A Insulin-like growth factor receptor 1; hormone receptor, insulin receptor family; HET: NAG FUC BMA MAN; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 Length = 478 | Back alignment and structure |
|---|
| >1igr_A Insulin-like growth factor receptor 1; hormone receptor, insulin receptor family; HET: NAG FUC BMA MAN; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 Length = 478 | Back alignment and structure |
|---|
| >2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 | Back alignment and structure |
|---|
| >2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 | Back alignment and structure |
|---|
| >2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 | Back alignment and structure |
|---|
| >2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 | Back alignment and structure |
|---|
| >2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 | Back alignment and structure |
|---|
| >3rfz_B Outer membrane usher protein, type 1 fimbrial SYN; beta-barrel, pilus assembly, outer-membrane, cell adhesion-T protein-chaperone complex; 2.80A {Escherichia coli} PDB: 3ohn_A 1zdv_A Length = 843 | Back alignment and structure |
|---|
| >3rfz_B Outer membrane usher protein, type 1 fimbrial SYN; beta-barrel, pilus assembly, outer-membrane, cell adhesion-T protein-chaperone complex; 2.80A {Escherichia coli} PDB: 3ohn_A 1zdv_A Length = 843 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >2g7c_A Toxin A; linear B trisaccharide, protein-carbohydrate complex, bacter toxin; HET: GLA GAL NAG; 2.00A {Clostridium difficile} Length = 255 | Back alignment and structure |
|---|
| >2g7c_A Toxin A; linear B trisaccharide, protein-carbohydrate complex, bacter toxin; HET: GLA GAL NAG; 2.00A {Clostridium difficile} Length = 255 | Back alignment and structure |
|---|
| >2g7c_A Toxin A; linear B trisaccharide, protein-carbohydrate complex, bacter toxin; HET: GLA GAL NAG; 2.00A {Clostridium difficile} Length = 255 | Back alignment and structure |
|---|
| >3i2t_A Epidermal growth factor receptor, isoform A; EGFR, ectodomain, unliganded, autoinhibited, ATP nucleotide-binding, tyrosine-protein kinase; HET: NDG NAG BMA; 2.70A {Drosophila melanogaster} PDB: 3ltf_A* 3ltg_A Length = 551 | Back alignment and structure |
|---|
| >3i2t_A Epidermal growth factor receptor, isoform A; EGFR, ectodomain, unliganded, autoinhibited, ATP nucleotide-binding, tyrosine-protein kinase; HET: NDG NAG BMA; 2.70A {Drosophila melanogaster} PDB: 3ltf_A* 3ltg_A Length = 551 | Back alignment and structure |
|---|
| >1yy9_A Epidermal growth factor receptor; cell surface receptor, tyrosine kinase, glycoprotein, antigen:antibody complex, FAB fragment, antitumor, drug; HET: NDG NAG BMA MAN; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 PDB: 3qwq_A* 1nql_A* 3b2v_A* 1ivo_A* 3njp_A* Length = 624 | Back alignment and structure |
|---|
| >1yy9_A Epidermal growth factor receptor; cell surface receptor, tyrosine kinase, glycoprotein, antigen:antibody complex, FAB fragment, antitumor, drug; HET: NDG NAG BMA MAN; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 PDB: 3qwq_A* 1nql_A* 3b2v_A* 1ivo_A* 3njp_A* Length = 624 | Back alignment and structure |
|---|
| >1n8y_C Protooncoprotein; tyrosin kinase receptor, cell surface receptor, transferase; HET: NAG; 2.40A {Rattus norvegicus} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 PDB: 1n8z_C* 3be1_A* 1s78_A* 3mzw_A* 3n85_A* 2a91_A* 3h3b_A Length = 608 | Back alignment and structure |
|---|
| >3klk_A Glucansucrase; native form, open conformation, multidomain protein, glycosyltransferase, transferase; 1.65A {Lactobacillus reuteri} PDB: 3kll_A* 3hz3_A* Length = 1039 | Back alignment and structure |
|---|
| >1ki0_A Angiostatin; kringle domains, hydrolase; HET: BCN; 1.75A {Homo sapiens} SCOP: g.14.1.1 g.14.1.1 g.14.1.1 PDB: 2doh_X* 2doi_X 1cea_A 1ceb_A* 1b2i_A* 1pkr_A 2l0s_A 2kj4_A 1i5k_A 1hpj_A 1hpk_A* Length = 253 | Back alignment and structure |
|---|
| >2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 | Back alignment and structure |
|---|
| >2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 | Back alignment and structure |
|---|
| >2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 | Back alignment and structure |
|---|
| >2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1235 | |||
| 2zuo_A | 861 | MVP, major vault protein; repeat domains, protein- | 95.97 | |
| 2zuo_A | 861 | MVP, major vault protein; repeat domains, protein- | 95.15 | |
| 3gnf_B | 387 | MVP, major vault protein; beta sheets, phosphoprot | 88.84 |
| >2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A | Back alignment and structure |
|---|
Probab=95.97 E-value=0.052 Score=66.73 Aligned_cols=210 Identities=18% Similarity=0.152 Sum_probs=126.2
Q ss_pred ccccccccCCCCcccccCCcccccccCCcccccCCCceeccCCCcccccCCCcccccCCCccccccccceeccCCCcccc
Q psy14307 698 TTTKTLLLDKKEPVLLDKKEPVLLDKKEPVLLDKKEPVLLDKKEPVLLDEKEPVLLDKKEPVLLDKKERVLLDKKEPVLL 777 (1235)
Q Consensus 698 ~tpk~dlLdk~EaVV~~e~e~vvl~esE~VV~~k~E~VvldE~e~Vv~dE~E~Vvlde~E~vV~de~E~Vv~de~E~vv~ 777 (1235)
.-|+|+.++.+|.++...-.-++..-+.+.+ =..+|+.++...++.|+..+|.+.-|+.=++-..+..-|--||.++.
T Consensus 30 ~GP~t~~~q~~E~v~~~P~~mi~vPp~~YCi--I~NPv~r~~~g~~v~d~~gq~klr~g~~EiR~~q~pFPLyPgE~l~~ 107 (861)
T 2zuo_A 30 VGPKTYIRQDNERVLFAPVRMVTVPPRHYCI--VANPVSRDTQSSVLFDITGQVRLRHADQEIRLAQDPFPLYPGEVLEK 107 (861)
T ss_dssp CCSCCBCCSSCBCCSCSSSCCBCCCCCCCCC--CSSTTCEEEECCCCSCCSSCCCCSSSSEEEECTTCCCCCCSCCCSCC
T ss_pred ECCeEEEeccCcccccCCceeEEeCCCceEE--EeCceeecCCCCeeeccCCceeecccceeeeccCCCCCCCCCccccc
Confidence 4578999999999887766666666666665 23556666666666666666666666555555555555555555533
Q ss_pred cCCCceeeccCCceee------cCCcceeecCCCceeecCCCceeecCCCCeeecCCCCeEeccCCCeEec------cCC
Q psy14307 778 DKKEPVLLDKKEHVLL------DKKETVLLDKKEPVLLDKKEPILLDKKEPVLLDKKEPVLLDKKSPVLLD------KKG 845 (1235)
Q Consensus 778 deke~vv~~e~e~Vml------~e~e~vv~~~~e~v~l~~~ep~vl~~~~~Vvl~~k~pvvl~~k~~vvl~------~k~ 845 (1235)
.=..--++....++.| .+..++.+.+|+=.|+++=+.|+-...+-|+ +.=.++||..++++-|. +..
T Consensus 108 ~v~~L~VI~~N~ALrLrAl~df~D~~g~~R~AGEeWLv~gPGtY~P~veEeVv-e~v~A~vl~~n~AL~LrA~~~f~D~~ 186 (861)
T 2zuo_A 108 DITPLQVVLPNTALHLKALLDFEDKNGDKVMAGDEWLFEGPGTYIPQKEVEVV-EIIQATVIKQNQALRLRARKECFDRE 186 (861)
T ss_dssp CCCCCCCCGGGCCEEEBCSSCSSCSSSSCCCTTCBCCBCSSCCCCSSSCCEEE-ECCCCCCCGGGCCEEECCCSSCCCTT
T ss_pred CceeeeEecCCceEEEEEeeeEEcCCCcEeecCCEEEEECCceecCCCceEEE-EEEEEEEecCCcEEEEEEeeeEEcCC
Confidence 2222223444444433 1345667777776666655555544433332 23335555555555553 334
Q ss_pred ceeecCCCceEecCCCceEecCCCCeeecCCCceeecCCCCeecc------CCCceeecCCCceeeccCCch
Q psy14307 846 PVILDKKEPVLLDKKEPVLLDKKEPVLLDKKAPVLLDKKEPVLLD------KKEPVLLDKKEPVLLDKKEPI 911 (1235)
Q Consensus 846 p~v~e~~~~vvl~~k~pvv~~~~~~Vvl~~k~pvv~~~k~~Vvl~------~~~p~m~d~~~~v~l~~k~p~ 911 (1235)
++.|..|+--|+..-|+++.+.-|-|+ +...++||..+++++|- +.-.+.+.+|.--||+..++-
T Consensus 187 G~~R~aGEEWLVt~~gayiP~v~Eevv-~~V~a~VLte~eAL~LrA~~~F~D~~gv~RkaGe~WLVT~~gp~ 257 (861)
T 2zuo_A 187 GKGRVTGEEWLVRSVGAYLPAVFEEVL-DLVDAVILTEKTALHLRALQNFRDLRGVLHRTGEEWLVTVQDTE 257 (861)
T ss_dssp SSCCCTTCCCCBCSSSCCCCTTCCEEE-ECCCCCCCCTTCEEEEECCSSCBCTTCCBCCTTCEEEECSSCCC
T ss_pred CcCccCCCeEEEeccceecCCCceEEE-EEEeeEEecCCcEEEEEEeeeeccccCceecCCCEEEEecCCcc
Confidence 666888888888887888888777665 44466666666666655 334556777777777655543
|
| >2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A | Back alignment and structure |
|---|
| >3gnf_B MVP, major vault protein; beta sheets, phosphoprotein, ribonucleoprotein, structural P; 2.10A {Mus musculus} PDB: 3gf5_A 3gng_A 1y7x_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 1235 | ||||
| d2biba1 | 233 | b.109.1.1 (A:309-541) Teichoic acid phosphorylchol | 2e-19 | |
| d2biba1 | 233 | b.109.1.1 (A:309-541) Teichoic acid phosphorylchol | 3e-18 | |
| d2biba1 | 233 | b.109.1.1 (A:309-541) Teichoic acid phosphorylchol | 2e-17 | |
| d2biba1 | 233 | b.109.1.1 (A:309-541) Teichoic acid phosphorylchol | 2e-17 | |
| d2biba1 | 233 | b.109.1.1 (A:309-541) Teichoic acid phosphorylchol | 5e-17 | |
| d2biba1 | 233 | b.109.1.1 (A:309-541) Teichoic acid phosphorylchol | 7e-13 | |
| d2biba1 | 233 | b.109.1.1 (A:309-541) Teichoic acid phosphorylchol | 4e-12 | |
| d2biba1 | 233 | b.109.1.1 (A:309-541) Teichoic acid phosphorylchol | 1e-07 | |
| d2biba1 | 233 | b.109.1.1 (A:309-541) Teichoic acid phosphorylchol | 0.001 | |
| d2j8ga1 | 149 | b.109.1.1 (A:191-339) C-terminal domain of endolys | 1e-10 | |
| d2j8ga1 | 149 | b.109.1.1 (A:191-339) C-terminal domain of endolys | 7e-10 | |
| d2j8ga1 | 149 | b.109.1.1 (A:191-339) C-terminal domain of endolys | 6e-08 | |
| d2j8ga1 | 149 | b.109.1.1 (A:191-339) C-terminal domain of endolys | 7e-08 | |
| d2j8ga1 | 149 | b.109.1.1 (A:191-339) C-terminal domain of endolys | 2e-07 | |
| d2j8ga1 | 149 | b.109.1.1 (A:191-339) C-terminal domain of endolys | 5e-05 | |
| d2j8ga1 | 149 | b.109.1.1 (A:191-339) C-terminal domain of endolys | 3e-04 | |
| d2j8ga1 | 149 | b.109.1.1 (A:191-339) C-terminal domain of endolys | 0.003 | |
| d1ouva_ | 265 | a.118.18.1 (A:) Cysteine rich protein C (HcpC) {He | 2e-10 | |
| d3bmva4 | 406 | c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase | 9e-09 | |
| d2aaaa2 | 381 | c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergill | 4e-08 | |
| d2aaaa2 | 381 | c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergill | 2e-05 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 2e-07 | |
| d1h3ga3 | 422 | c.1.8.1 (A:96-517) Cyclomaltodextrinase, central d | 5e-07 | |
| d1jtdb_ | 273 | b.69.5.2 (B:) beta-lactamase inhibitor protein-II, | 8e-07 | |
| d1jtdb_ | 273 | b.69.5.2 (B:) beta-lactamase inhibitor protein-II, | 1e-05 | |
| d1jtdb_ | 273 | b.69.5.2 (B:) beta-lactamase inhibitor protein-II, | 0.001 | |
| d2bm5a1 | 181 | b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M | 9e-07 | |
| d2bm5a1 | 181 | b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M | 2e-05 | |
| d2bm5a1 | 181 | b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M | 2e-05 | |
| d2bm5a1 | 181 | b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (M | 4e-05 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 1e-06 | |
| d2h6fa1 | 315 | a.118.6.1 (A:55-369) Protein farnesyltransferase a | 1e-05 | |
| d2dtge6 | 155 | g.3.9.1 (E:157-311) Insulin receptor {Human (Homo | 2e-05 | |
| d2dtge6 | 155 | g.3.9.1 (E:157-311) Insulin receptor {Human (Homo | 2e-05 | |
| d2dtge6 | 155 | g.3.9.1 (E:157-311) Insulin receptor {Human (Homo | 0.004 | |
| d2j8ka1 | 175 | b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme | 2e-05 | |
| d2j8ka1 | 175 | b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme | 1e-04 | |
| d1n8yc3 | 157 | g.3.9.1 (C:166-322) Protooncoprotein Her2 extracel | 3e-05 | |
| d1n8yc3 | 157 | g.3.9.1 (C:166-322) Protooncoprotein Her2 extracel | 0.004 | |
| d1xnfa_ | 259 | a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli | 3e-05 | |
| d1hupa1 | 117 | d.169.1.1 (A:112-228) Mannose-binding protein A, C | 6e-05 | |
| d1hupa1 | 117 | d.169.1.1 (A:112-228) Mannose-binding protein A, C | 0.001 | |
| d1hupa1 | 117 | d.169.1.1 (A:112-228) Mannose-binding protein A, C | 0.002 | |
| d1aeca_ | 218 | d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwi | 7e-05 | |
| d1igra3 | 150 | g.3.9.1 (A:150-299) Type 1 insulin-like growth fac | 7e-05 | |
| d1igra3 | 150 | g.3.9.1 (A:150-299) Type 1 insulin-like growth fac | 0.002 | |
| d1m6ba3 | 145 | g.3.9.1 (A:166-310) Receptor protein-tyrosine kina | 1e-04 | |
| d1m6ba3 | 145 | g.3.9.1 (A:166-310) Receptor protein-tyrosine kina | 2e-04 | |
| d1m6ba3 | 145 | g.3.9.1 (A:166-310) Receptor protein-tyrosine kina | 0.002 | |
| d1rdl1_ | 111 | d.169.1.1 (1:) Mannose-binding protein A, C-lectin | 2e-04 | |
| d1qg8a_ | 255 | c.68.1.1 (A:) Spore coat polysaccharide biosynthes | 2e-04 | |
| d1moxa3 | 149 | g.3.9.1 (A:163-311) EGF receptor Cys-rich domains | 2e-04 | |
| d1moxa3 | 149 | g.3.9.1 (A:163-311) EGF receptor Cys-rich domains | 3e-04 | |
| d1moxa3 | 149 | g.3.9.1 (A:163-311) EGF receptor Cys-rich domains | 5e-04 | |
| d1moxa3 | 149 | g.3.9.1 (A:163-311) EGF receptor Cys-rich domains | 0.001 | |
| d1moxa3 | 149 | g.3.9.1 (A:163-311) EGF receptor Cys-rich domains | 0.002 | |
| d1olta_ | 441 | c.1.28.2 (A:) Oxygen-independent coproporphyrinoge | 3e-04 | |
| d1olta_ | 441 | c.1.28.2 (A:) Oxygen-independent coproporphyrinoge | 0.001 | |
| d1v2da_ | 368 | c.67.1.1 (A:) Glutamine aminotransferase {Thermus | 3e-04 | |
| g1k3b.1 | 233 | d.3.1.1 (B:,C:) Cathepsin C (dipeptidyl peptidase | 3e-04 | |
| d1me4a_ | 215 | d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 56 | 3e-04 | |
| d1o69a_ | 374 | c.67.1.4 (A:) Aminotransferase homolog WlaK (PglE, | 3e-04 | |
| d1wmza_ | 140 | d.169.1.1 (A:) Lectin CEL-I {Cucumaria echinata [T | 4e-04 | |
| d1qhoa4 | 407 | c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase | 4e-04 | |
| d1qhoa4 | 407 | c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase | 0.003 | |
| d1upsa2 | 131 | b.42.2.3 (A:290-420) GlcNAc-alpha-1,4-Gal-releasin | 4e-04 | |
| d1upsa2 | 131 | b.42.2.3 (A:290-420) GlcNAc-alpha-1,4-Gal-releasin | 0.002 | |
| d1zu2a1 | 145 | a.118.8.1 (A:1-145) Mitochondrial import receptor | 5e-04 | |
| d1hc7a2 | 272 | d.104.1.1 (A:5-276) Prolyl-tRNA synthetase (ProRS) | 5e-04 | |
| d1mdoa_ | 376 | c.67.1.4 (A:) Aminotransferase ArnB {Salmonella ty | 6e-04 | |
| d1mdoa_ | 376 | c.67.1.4 (A:) Aminotransferase ArnB {Salmonella ty | 0.001 | |
| d2r6na1 | 215 | d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sa | 6e-04 | |
| d1i24a_ | 393 | c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 | 6e-04 | |
| d1r7aa2 | 434 | c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobac | 7e-04 | |
| d1r7aa2 | 434 | c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobac | 0.001 | |
| d1gy8a_ | 383 | c.2.1.2 (A:) Uridine diphosphogalactose-4-epimeras | 8e-04 | |
| d1wpxa1 | 421 | c.69.1.5 (A:1-421) Serine carboxypeptidase II {Bak | 0.001 | |
| d1tn3a_ | 137 | d.169.1.1 (A:) Tetranectin {Human (Homo sapiens) [ | 0.001 | |
| d2guya2 | 381 | c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergill | 0.001 | |
| d1khqa_ | 212 | d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId | 0.001 | |
| d1iwda_ | 215 | d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia | 0.002 | |
| d1s4va_ | 224 | d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor | 0.002 | |
| d1qxma2 | 138 | b.42.2.1 (A:149-286) Hemagglutinin component Ha1 { | 0.002 | |
| d1jc9a_ | 220 | d.171.1.1 (A:) Tachylectin 5a {Japanese horseshoe | 0.002 | |
| d1fcha_ | 323 | a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting | 0.002 | |
| d1ppoa_ | 216 | d.3.1.1 (A:) Caricain (protease omega) {Papaya (Ca | 0.002 | |
| d1xwdc1 | 242 | c.10.2.7 (C:18-259) Follicle-stimulating hormone r | 0.003 | |
| d1cd0a_ | 111 | b.1.1.1 (A:) Immunoglobulin light chain lambda var | 0.003 | |
| d1m6da_ | 214 | d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [Ta | 0.003 | |
| d1b9ha_ | 384 | c.67.1.4 (A:) 3-amino-5-hydroxybenzoic acid syntha | 0.004 |
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Length = 265 | Back information, alignment and structure |
|---|
| >d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} Length = 406 | Back information, alignment and structure |
|---|
| >d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} Length = 381 | Back information, alignment and structure |
|---|
| >d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} Length = 381 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1h3ga3 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]} Length = 422 | Back information, alignment and structure |
|---|
| >d1jtdb_ b.69.5.2 (B:) beta-lactamase inhibitor protein-II, BLIP-II {Streptomyces exfoliatus [TaxId: 1905]} Length = 273 | Back information, alignment and structure |
|---|
| >d1jtdb_ b.69.5.2 (B:) beta-lactamase inhibitor protein-II, BLIP-II {Streptomyces exfoliatus [TaxId: 1905]} Length = 273 | Back information, alignment and structure |
|---|
| >d1jtdb_ b.69.5.2 (B:) beta-lactamase inhibitor protein-II, BLIP-II {Streptomyces exfoliatus [TaxId: 1905]} Length = 273 | Back information, alignment and structure |
|---|
| >d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 | Back information, alignment and structure |
|---|
| >d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 | Back information, alignment and structure |
|---|
| >d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 | Back information, alignment and structure |
|---|
| >d2bm5a1 b.80.8.1 (A:2-182) Hypothetical protein Rv3361c (MT3469) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 | Back information, alignment and structure |
|---|
| >d2dtge6 g.3.9.1 (E:157-311) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 155 | Back information, alignment and structure |
|---|
| >d2dtge6 g.3.9.1 (E:157-311) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 155 | Back information, alignment and structure |
|---|
| >d2dtge6 g.3.9.1 (E:157-311) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 155 | Back information, alignment and structure |
|---|
| >d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Length = 175 | Back information, alignment and structure |
|---|
| >d2j8ka1 b.80.8.1 (A:1-175) NP275-NP276 {Nostoc punctiforme [TaxId: 272131]} Length = 175 | Back information, alignment and structure |
|---|
| >d1n8yc3 g.3.9.1 (C:166-322) Protooncoprotein Her2 extracellular domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 157 | Back information, alignment and structure |
|---|
| >d1n8yc3 g.3.9.1 (C:166-322) Protooncoprotein Her2 extracellular domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 157 | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 | Back information, alignment and structure |
|---|
| >d1hupa1 d.169.1.1 (A:112-228) Mannose-binding protein A, C-lectin domain {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1hupa1 d.169.1.1 (A:112-228) Mannose-binding protein A, C-lectin domain {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1hupa1 d.169.1.1 (A:112-228) Mannose-binding protein A, C-lectin domain {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Length = 218 | Back information, alignment and structure |
|---|
| >d1igra3 g.3.9.1 (A:150-299) Type 1 insulin-like growth factor receptor Cys-rich domain {Human (Homo sapiens) [TaxId: 9606]} Length = 150 | Back information, alignment and structure |
|---|
| >d1igra3 g.3.9.1 (A:150-299) Type 1 insulin-like growth factor receptor Cys-rich domain {Human (Homo sapiens) [TaxId: 9606]} Length = 150 | Back information, alignment and structure |
|---|
| >d1m6ba3 g.3.9.1 (A:166-310) Receptor protein-tyrosine kinase Erbb-3 Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]} Length = 145 | Back information, alignment and structure |
|---|
| >d1m6ba3 g.3.9.1 (A:166-310) Receptor protein-tyrosine kinase Erbb-3 Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]} Length = 145 | Back information, alignment and structure |
|---|
| >d1m6ba3 g.3.9.1 (A:166-310) Receptor protein-tyrosine kinase Erbb-3 Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]} Length = 145 | Back information, alignment and structure |
|---|
| >d1rdl1_ d.169.1.1 (1:) Mannose-binding protein A, C-lectin domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 111 | Back information, alignment and structure |
|---|
| >d1qg8a_ c.68.1.1 (A:) Spore coat polysaccharide biosynthesis protein SpsA {Bacillus subtilis [TaxId: 1423]} Length = 255 | Back information, alignment and structure |
|---|
| >d1moxa3 g.3.9.1 (A:163-311) EGF receptor Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]} Length = 149 | Back information, alignment and structure |
|---|
| >d1moxa3 g.3.9.1 (A:163-311) EGF receptor Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]} Length = 149 | Back information, alignment and structure |
|---|
| >d1moxa3 g.3.9.1 (A:163-311) EGF receptor Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]} Length = 149 | Back information, alignment and structure |
|---|
| >d1moxa3 g.3.9.1 (A:163-311) EGF receptor Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]} Length = 149 | Back information, alignment and structure |
|---|
| >d1moxa3 g.3.9.1 (A:163-311) EGF receptor Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]} Length = 149 | Back information, alignment and structure |
|---|
| >d1olta_ c.1.28.2 (A:) Oxygen-independent coproporphyrinogen III oxidase HemN {Escherichia coli [TaxId: 562]} Length = 441 | Back information, alignment and structure |
|---|
| >d1olta_ c.1.28.2 (A:) Oxygen-independent coproporphyrinogen III oxidase HemN {Escherichia coli [TaxId: 562]} Length = 441 | Back information, alignment and structure |
|---|
| >d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Length = 368 | Back information, alignment and structure |
|---|
| >d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Length = 215 | Back information, alignment and structure |
|---|
| >d1o69a_ c.67.1.4 (A:) Aminotransferase homolog WlaK (PglE, Cj1121c) {Campylobacter jejuni [TaxId: 197]} Length = 374 | Back information, alignment and structure |
|---|
| >d1wmza_ d.169.1.1 (A:) Lectin CEL-I {Cucumaria echinata [TaxId: 40245]} Length = 140 | Back information, alignment and structure |
|---|
| >d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} Length = 407 | Back information, alignment and structure |
|---|
| >d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} Length = 407 | Back information, alignment and structure |
|---|
| >d1upsa2 b.42.2.3 (A:290-420) GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosidase, GngC, C-terminal domain {Clostridium perfringens [TaxId: 1502]} Length = 131 | Back information, alignment and structure |
|---|
| >d1upsa2 b.42.2.3 (A:290-420) GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosidase, GngC, C-terminal domain {Clostridium perfringens [TaxId: 1502]} Length = 131 | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 145 | Back information, alignment and structure |
|---|
| >d1hc7a2 d.104.1.1 (A:5-276) Prolyl-tRNA synthetase (ProRS) {Thermus thermophilus [TaxId: 274]} Length = 272 | Back information, alignment and structure |
|---|
| >d1mdoa_ c.67.1.4 (A:) Aminotransferase ArnB {Salmonella typhimurium [TaxId: 90371]} Length = 376 | Back information, alignment and structure |
|---|
| >d1mdoa_ c.67.1.4 (A:) Aminotransferase ArnB {Salmonella typhimurium [TaxId: 90371]} Length = 376 | Back information, alignment and structure |
|---|
| >d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Length = 215 | Back information, alignment and structure |
|---|
| >d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 393 | Back information, alignment and structure |
|---|
| >d1r7aa2 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]} Length = 434 | Back information, alignment and structure |
|---|
| >d1r7aa2 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]} Length = 434 | Back information, alignment and structure |
|---|
| >d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Length = 383 | Back information, alignment and structure |
|---|
| >d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 421 | Back information, alignment and structure |
|---|
| >d1tn3a_ d.169.1.1 (A:) Tetranectin {Human (Homo sapiens) [TaxId: 9606]} Length = 137 | Back information, alignment and structure |
|---|
| >d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} Length = 381 | Back information, alignment and structure |
|---|
| >d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Length = 212 | Back information, alignment and structure |
|---|
| >d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Length = 215 | Back information, alignment and structure |
|---|
| >d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Length = 224 | Back information, alignment and structure |
|---|
| >d1qxma2 b.42.2.1 (A:149-286) Hemagglutinin component Ha1 {Clostridium botulinum D phage [TaxId: 29342]} Length = 138 | Back information, alignment and structure |
|---|
| >d1jc9a_ d.171.1.1 (A:) Tachylectin 5a {Japanese horseshoe crab (Tachypleus tridentatus) [TaxId: 6853]} Length = 220 | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 | Back information, alignment and structure |
|---|
| >d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Length = 216 | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 | Back information, alignment and structure |
|---|
| >d1cd0a_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Length = 214 | Back information, alignment and structure |
|---|
| >d1b9ha_ c.67.1.4 (A:) 3-amino-5-hydroxybenzoic acid synthase (AHBA synthase) {Amycolatopsis mediterranei [TaxId: 33910]} Length = 384 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00