Psyllid ID: psy14377
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 848 | ||||||
| 443419066 | 623 | NADP-dependent malic enzyme-like protein | 0.275 | 0.375 | 0.793 | 1e-108 | |
| 321468728 | 557 | hypothetical protein DAPPUDRAFT_304467 [ | 0.261 | 0.398 | 0.803 | 1e-104 | |
| 193676231 | 573 | PREDICTED: NADP-dependent malic enzyme-l | 0.265 | 0.392 | 0.771 | 1e-104 | |
| 380024737 | 631 | PREDICTED: LOW QUALITY PROTEIN: NADP-dep | 0.262 | 0.353 | 0.747 | 1e-101 | |
| 328778238 | 637 | PREDICTED: NADP-dependent malic enzyme i | 0.259 | 0.345 | 0.743 | 1e-101 | |
| 350405161 | 606 | PREDICTED: NADP-dependent malic enzyme-l | 0.261 | 0.366 | 0.76 | 1e-100 | |
| 340726186 | 632 | PREDICTED: NADP-dependent malic enzyme-l | 0.259 | 0.348 | 0.762 | 1e-100 | |
| 340726184 | 606 | PREDICTED: NADP-dependent malic enzyme-l | 0.259 | 0.363 | 0.762 | 1e-100 | |
| 242011898 | 1184 | NADP-dependent malic enzyme, putative [P | 0.262 | 0.188 | 0.786 | 1e-100 | |
| 91093507 | 608 | PREDICTED: similar to malate dehydrogena | 0.252 | 0.351 | 0.746 | 1e-100 |
| >gi|443419066|gb|AGC84405.1| NADP-dependent malic enzyme-like protein [Locusta migratoria] | Back alignment and taxonomy information |
|---|
Score = 400 bits (1027), Expect = e-108, Method: Compositional matrix adjust.
Identities = 188/237 (79%), Positives = 213/237 (89%), Gaps = 3/237 (1%)
Query: 505 EYVVELMPIVYTPTVGLACQKYGLIFRRPRGLFISIHDKGHISEVLRNWPETDIRAIVVT 564
E V +MPIVYTPTVG ACQ YGLI+RRPRGLFI+IHDKGH+ E+L+NWPE+D+RAIVVT
Sbjct: 152 ENVQTMMPIVYTPTVGQACQNYGLIYRRPRGLFITIHDKGHVYEILKNWPESDVRAIVVT 211
Query: 565 DGERILGLGDLGAYGMGIPVGKLSLYTALAGIKPHQCLPITLDVGTNTQQLLDDPLYIGL 624
DGERILGLGDLGAYGMGIPVGKL+LYTALAGIKPHQCLPITLDVGTNTQ+LLDDPLYIGL
Sbjct: 212 DGERILGLGDLGAYGMGIPVGKLALYTALAGIKPHQCLPITLDVGTNTQKLLDDPLYIGL 271
Query: 625 RQRRTTGQAYDDFIEEFMQAVVARYGQHVLIQFEDFANHSAFRFLDTYRNRYCVFNDDIQ 684
R +R TG+ YDDF+EEFMQAVV RYGQ+ LIQFEDFAN +AFRFL+ YR+RYC FNDDIQ
Sbjct: 272 RHKRITGKEYDDFVEEFMQAVVKRYGQNTLIQFEDFANSNAFRFLEKYRDRYCTFNDDIQ 331
Query: 685 GTASVAVAGLLASLRITKTRLSDNTILFQGAGEGTASVAVAGL-LASLRITKTRLSD 740
GTASVAVAGLLASLR+TKTRLSD+TILFQGAGE AS+ +AGL + +++ T L D
Sbjct: 332 GTASVAVAGLLASLRVTKTRLSDHTILFQGAGE--ASLGIAGLCVMAMQKEGTSLQD 386
|
Source: Locusta migratoria Species: Locusta migratoria Genus: Locusta Family: Acrididae Order: Orthoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|321468728|gb|EFX79712.1| hypothetical protein DAPPUDRAFT_304467 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|193676231|ref|XP_001943996.1| PREDICTED: NADP-dependent malic enzyme-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|380024737|ref|XP_003696148.1| PREDICTED: LOW QUALITY PROTEIN: NADP-dependent malic enzyme-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|328778238|ref|XP_395280.4| PREDICTED: NADP-dependent malic enzyme isoform 1 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|350405161|ref|XP_003487345.1| PREDICTED: NADP-dependent malic enzyme-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340726186|ref|XP_003401442.1| PREDICTED: NADP-dependent malic enzyme-like isoform 2 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|340726184|ref|XP_003401441.1| PREDICTED: NADP-dependent malic enzyme-like isoform 1 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|242011898|ref|XP_002426680.1| NADP-dependent malic enzyme, putative [Pediculus humanus corporis] gi|212510851|gb|EEB13942.1| NADP-dependent malic enzyme, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|91093507|ref|XP_969226.1| PREDICTED: similar to malate dehydrogenase [Tribolium castaneum] gi|270002679|gb|EEZ99126.1| hypothetical protein TcasGA2_TC005233 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 848 | ||||||
| FB|FBgn0029155 | 624 | Men-b "Malic enzyme b" [Drosop | 0.251 | 0.341 | 0.694 | 3.3e-98 | |
| FB|FBgn0002719 | 763 | Men "Malic enzyme" [Drosophila | 0.245 | 0.272 | 0.711 | 3.4e-92 | |
| UNIPROTKB|F1P0Y6 | 576 | ME1 "Malic enzyme" [Gallus gal | 0.248 | 0.366 | 0.687 | 3.4e-90 | |
| ZFIN|ZDB-GENE-041111-294 | 603 | me3 "malic enzyme 3, NADP(+)-d | 0.248 | 0.349 | 0.691 | 4.4e-90 | |
| UNIPROTKB|E1C7M4 | 541 | ME1 "Malic enzyme" [Gallus gal | 0.248 | 0.390 | 0.687 | 1.5e-89 | |
| UNIPROTKB|F1MPH4 | 603 | ME3 "Malic enzyme" [Bos taurus | 0.248 | 0.349 | 0.663 | 2.7e-88 | |
| UNIPROTKB|F1MH32 | 604 | ME3 "Malic enzyme" [Bos taurus | 0.248 | 0.349 | 0.663 | 2.7e-88 | |
| UNIPROTKB|F1STS4 | 545 | ME3 "Malic enzyme" [Sus scrofa | 0.248 | 0.387 | 0.672 | 4.4e-88 | |
| UNIPROTKB|F1PQ35 | 604 | ME3 "Malic enzyme" [Canis lupu | 0.248 | 0.349 | 0.663 | 7.2e-88 | |
| UNIPROTKB|E9PMB9 | 581 | ME3 "Malic enzyme" [Homo sapie | 0.248 | 0.363 | 0.663 | 1.5e-87 |
| FB|FBgn0029155 Men-b "Malic enzyme b" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 808 (289.5 bits), Expect = 3.3e-98, Sum P(2) = 3.3e-98
Identities = 148/213 (69%), Positives = 172/213 (80%)
Query: 505 EYVVELMPIVYTPTVGLACQKYGLIFRRPRGLFISIHDKGHISEVLRNWPETDIRAIVVT 564
E + +LMPIVYTPTVGLACQ++GLI+RRP GLFI+ +D+GHI +V++NWPE ++RAI VT
Sbjct: 130 ENIEDLMPIVYTPTVGLACQRFGLIYRRPHGLFITYNDRGHIFDVMKNWPEPNVRAICVT 189
Query: 565 DGERILGLGDLGAYGMGIPVGKLSLYTALAGIKPHQCLPITLDVGTNTQQLLDDPLYIGL 624
DGERILGLGDLGA GMGIPVGKL+LYTALAGIKPHQCLPI +DVGTN LL+DPLY+GL
Sbjct: 190 DGERILGLGDLGACGMGIPVGKLALYTALAGIKPHQCLPIVVDVGTNNIDLLEDPLYVGL 249
Query: 625 RQRRTTGQAYDDFIEEFMQAVVARYGQHVLIQFEDFANHSAFRFLDTYRNRYCVFNDDIQ 684
RQ+R G+ YD+FI+EFM+AVV RYGQ+ LIQFEDF NH+AFRFLD YRN YC FNDDIQ
Sbjct: 250 RQKRVVGREYDEFIDEFMEAVVQRYGQNTLIQFEDFGNHNAFRFLDKYRNTYCTFNDDIQ 309
Query: 685 GTXXXXXXXXXXXXRITKTRLSDNTILFQGAGE 717
GT RIT D T LF GAGE
Sbjct: 310 GTASVAVAGLYASKRITGKSFKDYTFLFAGAGE 342
|
|
| FB|FBgn0002719 Men "Malic enzyme" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P0Y6 ME1 "Malic enzyme" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-041111-294 me3 "malic enzyme 3, NADP(+)-dependent, mitochondrial" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C7M4 ME1 "Malic enzyme" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MPH4 ME3 "Malic enzyme" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MH32 ME3 "Malic enzyme" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1STS4 ME3 "Malic enzyme" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PQ35 ME3 "Malic enzyme" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PMB9 ME3 "Malic enzyme" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 848 | |||
| PLN03129 | 581 | PLN03129, PLN03129, NADP-dependent malic enzyme; P | 1e-136 | |
| PRK13529 | 563 | PRK13529, PRK13529, malate dehydrogenase; Provisio | 1e-126 | |
| PTZ00317 | 559 | PTZ00317, PTZ00317, NADP-dependent malic enzyme; P | 1e-99 | |
| pfam00390 | 182 | pfam00390, malic, Malic enzyme, N-terminal domain | 5e-96 | |
| COG0281 | 432 | COG0281, SfcA, Malic enzyme [Energy production and | 4e-46 | |
| cd05312 | 279 | cd05312, NAD_bind_1_malic_enz, NAD(P) binding doma | 8e-38 | |
| cd05312 | 279 | cd05312, NAD_bind_1_malic_enz, NAD(P) binding doma | 6e-35 | |
| cd05312 | 279 | cd05312, NAD_bind_1_malic_enz, NAD(P) binding doma | 7e-35 | |
| PLN03129 | 581 | PLN03129, PLN03129, NADP-dependent malic enzyme; P | 5e-34 | |
| pfam03949 | 255 | pfam03949, Malic_M, Malic enzyme, NAD binding doma | 1e-32 | |
| PTZ00317 | 559 | PTZ00317, PTZ00317, NADP-dependent malic enzyme; P | 2e-32 | |
| pfam03949 | 255 | pfam03949, Malic_M, Malic enzyme, NAD binding doma | 7e-31 | |
| pfam03949 | 255 | pfam03949, Malic_M, Malic enzyme, NAD binding doma | 5e-30 | |
| PLN03129 | 581 | PLN03129, PLN03129, NADP-dependent malic enzyme; P | 8e-30 | |
| PRK13529 | 563 | PRK13529, PRK13529, malate dehydrogenase; Provisio | 2e-29 | |
| pfam00390 | 182 | pfam00390, malic, Malic enzyme, N-terminal domain | 2e-29 | |
| PLN03129 | 581 | PLN03129, PLN03129, NADP-dependent malic enzyme; P | 3e-29 | |
| PRK13529 | 563 | PRK13529, PRK13529, malate dehydrogenase; Provisio | 1e-28 | |
| PLN03129 | 581 | PLN03129, PLN03129, NADP-dependent malic enzyme; P | 6e-28 | |
| cd00762 | 254 | cd00762, NAD_bind_malic_enz, NAD(P) binding domain | 1e-27 | |
| PRK13529 | 563 | PRK13529, PRK13529, malate dehydrogenase; Provisio | 2e-27 | |
| PTZ00317 | 559 | PTZ00317, PTZ00317, NADP-dependent malic enzyme; P | 2e-27 | |
| cd05312 | 279 | cd05312, NAD_bind_1_malic_enz, NAD(P) binding doma | 2e-26 | |
| PRK13529 | 563 | PRK13529, PRK13529, malate dehydrogenase; Provisio | 1e-25 | |
| cd00762 | 254 | cd00762, NAD_bind_malic_enz, NAD(P) binding domain | 1e-24 | |
| smart00919 | 231 | smart00919, Malic_M, Malic enzyme, NAD binding dom | 1e-24 | |
| smart00919 | 231 | smart00919, Malic_M, Malic enzyme, NAD binding dom | 1e-24 | |
| cd00762 | 254 | cd00762, NAD_bind_malic_enz, NAD(P) binding domain | 1e-23 | |
| pfam03949 | 255 | pfam03949, Malic_M, Malic enzyme, NAD binding doma | 7e-23 | |
| PLN03129 | 581 | PLN03129, PLN03129, NADP-dependent malic enzyme; P | 5e-20 | |
| PRK13529 | 563 | PRK13529, PRK13529, malate dehydrogenase; Provisio | 2e-19 | |
| PTZ00317 | 559 | PTZ00317, PTZ00317, NADP-dependent malic enzyme; P | 2e-18 | |
| smart00919 | 231 | smart00919, Malic_M, Malic enzyme, NAD binding dom | 1e-16 | |
| PTZ00317 | 559 | PTZ00317, PTZ00317, NADP-dependent malic enzyme; P | 3e-16 | |
| COG0281 | 432 | COG0281, SfcA, Malic enzyme [Energy production and | 2e-14 | |
| cd00762 | 254 | cd00762, NAD_bind_malic_enz, NAD(P) binding domain | 2e-14 | |
| smart00919 | 231 | smart00919, Malic_M, Malic enzyme, NAD binding dom | 3e-14 | |
| PRK13529 | 563 | PRK13529, PRK13529, malate dehydrogenase; Provisio | 3e-13 | |
| PTZ00317 | 559 | PTZ00317, PTZ00317, NADP-dependent malic enzyme; P | 3e-13 | |
| COG0281 | 432 | COG0281, SfcA, Malic enzyme [Energy production and | 5e-13 | |
| PLN03129 | 581 | PLN03129, PLN03129, NADP-dependent malic enzyme; P | 9e-13 | |
| COG0281 | 432 | COG0281, SfcA, Malic enzyme [Energy production and | 2e-12 | |
| PRK13529 | 563 | PRK13529, PRK13529, malate dehydrogenase; Provisio | 3e-12 | |
| pfam00390 | 182 | pfam00390, malic, Malic enzyme, N-terminal domain | 3e-12 | |
| cd05312 | 279 | cd05312, NAD_bind_1_malic_enz, NAD(P) binding doma | 3e-12 | |
| pfam03949 | 255 | pfam03949, Malic_M, Malic enzyme, NAD binding doma | 2e-11 | |
| smart00919 | 231 | smart00919, Malic_M, Malic enzyme, NAD binding dom | 2e-11 | |
| cd05312 | 279 | cd05312, NAD_bind_1_malic_enz, NAD(P) binding doma | 1e-10 | |
| smart00919 | 231 | smart00919, Malic_M, Malic enzyme, NAD binding dom | 2e-10 | |
| PLN03129 | 581 | PLN03129, PLN03129, NADP-dependent malic enzyme; P | 4e-10 | |
| pfam03949 | 255 | pfam03949, Malic_M, Malic enzyme, NAD binding doma | 5e-10 | |
| cd00762 | 254 | cd00762, NAD_bind_malic_enz, NAD(P) binding domain | 5e-10 | |
| cd00762 | 254 | cd00762, NAD_bind_malic_enz, NAD(P) binding domain | 4e-09 | |
| cd05312 | 279 | cd05312, NAD_bind_1_malic_enz, NAD(P) binding doma | 6e-09 | |
| cd05311 | 226 | cd05311, NAD_bind_2_malic_enz, NAD(P) binding doma | 9e-09 | |
| cd05312 | 279 | cd05312, NAD_bind_1_malic_enz, NAD(P) binding doma | 1e-08 | |
| PTZ00317 | 559 | PTZ00317, PTZ00317, NADP-dependent malic enzyme; P | 2e-08 | |
| COG0281 | 432 | COG0281, SfcA, Malic enzyme [Energy production and | 3e-08 | |
| PLN03129 | 581 | PLN03129, PLN03129, NADP-dependent malic enzyme; P | 1e-07 | |
| PLN03129 | 581 | PLN03129, PLN03129, NADP-dependent malic enzyme; P | 1e-07 | |
| smart00919 | 231 | smart00919, Malic_M, Malic enzyme, NAD binding dom | 1e-07 | |
| PRK13529 | 563 | PRK13529, PRK13529, malate dehydrogenase; Provisio | 2e-07 | |
| pfam03949 | 255 | pfam03949, Malic_M, Malic enzyme, NAD binding doma | 2e-07 | |
| pfam03949 | 255 | pfam03949, Malic_M, Malic enzyme, NAD binding doma | 2e-07 | |
| cd00762 | 254 | cd00762, NAD_bind_malic_enz, NAD(P) binding domain | 2e-07 | |
| cd00762 | 254 | cd00762, NAD_bind_malic_enz, NAD(P) binding domain | 2e-07 | |
| smart00919 | 231 | smart00919, Malic_M, Malic enzyme, NAD binding dom | 3e-07 | |
| cd05311 | 226 | cd05311, NAD_bind_2_malic_enz, NAD(P) binding doma | 3e-07 | |
| PRK07232 | 752 | PRK07232, PRK07232, bifunctional malic enzyme oxid | 6e-07 | |
| cd05191 | 86 | cd05191, NAD_bind_amino_acid_DH, NAD(P) binding do | 2e-06 | |
| cd05191 | 86 | cd05191, NAD_bind_amino_acid_DH, NAD(P) binding do | 3e-06 | |
| PRK12862 | 763 | PRK12862, PRK12862, malic enzyme; Reviewed | 3e-06 | |
| PRK13529 | 563 | PRK13529, PRK13529, malate dehydrogenase; Provisio | 4e-06 | |
| COG0281 | 432 | COG0281, SfcA, Malic enzyme [Energy production and | 6e-06 | |
| PRK07232 | 752 | PRK07232, PRK07232, bifunctional malic enzyme oxid | 1e-05 | |
| PRK12862 | 763 | PRK12862, PRK12862, malic enzyme; Reviewed | 3e-05 | |
| cd05311 | 226 | cd05311, NAD_bind_2_malic_enz, NAD(P) binding doma | 4e-05 | |
| cd05311 | 226 | cd05311, NAD_bind_2_malic_enz, NAD(P) binding doma | 4e-05 | |
| PRK12862 | 763 | PRK12862, PRK12862, malic enzyme; Reviewed | 4e-05 | |
| COG0281 | 432 | COG0281, SfcA, Malic enzyme [Energy production and | 1e-04 | |
| PRK12861 | 764 | PRK12861, PRK12861, malic enzyme; Reviewed | 4e-04 | |
| COG0281 | 432 | COG0281, SfcA, Malic enzyme [Energy production and | 5e-04 | |
| PRK07232 | 752 | PRK07232, PRK07232, bifunctional malic enzyme oxid | 6e-04 | |
| PTZ00317 | 559 | PTZ00317, PTZ00317, NADP-dependent malic enzyme; P | 7e-04 | |
| COG0281 | 432 | COG0281, SfcA, Malic enzyme [Energy production and | 0.001 | |
| cd05191 | 86 | cd05191, NAD_bind_amino_acid_DH, NAD(P) binding do | 0.001 | |
| cd05311 | 226 | cd05311, NAD_bind_2_malic_enz, NAD(P) binding doma | 0.003 | |
| cd05191 | 86 | cd05191, NAD_bind_amino_acid_DH, NAD(P) binding do | 0.003 |
| >gnl|CDD|215594 PLN03129, PLN03129, NADP-dependent malic enzyme; Provisional | Back alignment and domain information |
|---|
Score = 418 bits (1076), Expect = e-136
Identities = 143/226 (63%), Positives = 175/226 (77%), Gaps = 2/226 (0%)
Query: 505 EYVVELMPIVYTPTVGLACQKYGLIFRRPRGLFISIHDKGHISEVLRNWPETDIRAIVVT 564
+ + EL+PIVYTPTVG ACQKYG +FRRPRGL+IS+ DKG + +L+NWPE D++ IVVT
Sbjct: 119 DNIEELLPIVYTPTVGEACQKYGSLFRRPRGLYISLKDKGRVLSMLKNWPERDVQVIVVT 178
Query: 565 DGERILGLGDLGAYGMGIPVGKLSLYTALAGIKPHQCLPITLDVGTNTQQLLDDPLYIGL 624
DGERILGLGDLG GMGIPVGKL LYTA GI+P LP+ +DVGTN ++LL+DP YIGL
Sbjct: 179 DGERILGLGDLGVQGMGIPVGKLDLYTAAGGIRPSAVLPVCIDVGTNNEKLLNDPFYIGL 238
Query: 625 RQRRTTGQAYDDFIEEFMQAVVARYGQHVLIQFEDFANHSAFRFLDTYRNRYCVFNDDIQ 684
RQ R TG+ YD+ ++EFM+AV R+G VL+QFEDFAN +AFR L YR + FNDDIQ
Sbjct: 239 RQPRLTGEEYDELVDEFMEAVKQRWGPKVLVQFEDFANKNAFRLLQRYRTTHLCFNDDIQ 298
Query: 685 GTASVAVAGLLASLRITKTRLSDNTILFQGAGEGTASVAVAGLLAS 730
GTA+VA+AGLLA+LR T L+D ILF GAGE A +A L+A
Sbjct: 299 GTAAVALAGLLAALRATGGDLADQRILFAGAGE--AGTGIAELIAL 342
|
Length = 581 |
| >gnl|CDD|237414 PRK13529, PRK13529, malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240357 PTZ00317, PTZ00317, NADP-dependent malic enzyme; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215894 pfam00390, malic, Malic enzyme, N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|223358 COG0281, SfcA, Malic enzyme [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|133454 cd05312, NAD_bind_1_malic_enz, NAD(P) binding domain of malic enzyme (ME), subgroup 1 | Back alignment and domain information |
|---|
| >gnl|CDD|133454 cd05312, NAD_bind_1_malic_enz, NAD(P) binding domain of malic enzyme (ME), subgroup 1 | Back alignment and domain information |
|---|
| >gnl|CDD|133454 cd05312, NAD_bind_1_malic_enz, NAD(P) binding domain of malic enzyme (ME), subgroup 1 | Back alignment and domain information |
|---|
| >gnl|CDD|215594 PLN03129, PLN03129, NADP-dependent malic enzyme; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217809 pfam03949, Malic_M, Malic enzyme, NAD binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|240357 PTZ00317, PTZ00317, NADP-dependent malic enzyme; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217809 pfam03949, Malic_M, Malic enzyme, NAD binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|217809 pfam03949, Malic_M, Malic enzyme, NAD binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|215594 PLN03129, PLN03129, NADP-dependent malic enzyme; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237414 PRK13529, PRK13529, malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215894 pfam00390, malic, Malic enzyme, N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|215594 PLN03129, PLN03129, NADP-dependent malic enzyme; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237414 PRK13529, PRK13529, malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215594 PLN03129, PLN03129, NADP-dependent malic enzyme; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133442 cd00762, NAD_bind_malic_enz, NAD(P) binding domain of malic enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|237414 PRK13529, PRK13529, malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240357 PTZ00317, PTZ00317, NADP-dependent malic enzyme; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133454 cd05312, NAD_bind_1_malic_enz, NAD(P) binding domain of malic enzyme (ME), subgroup 1 | Back alignment and domain information |
|---|
| >gnl|CDD|237414 PRK13529, PRK13529, malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133442 cd00762, NAD_bind_malic_enz, NAD(P) binding domain of malic enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|214912 smart00919, Malic_M, Malic enzyme, NAD binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|214912 smart00919, Malic_M, Malic enzyme, NAD binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|133442 cd00762, NAD_bind_malic_enz, NAD(P) binding domain of malic enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|217809 pfam03949, Malic_M, Malic enzyme, NAD binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|215594 PLN03129, PLN03129, NADP-dependent malic enzyme; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237414 PRK13529, PRK13529, malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240357 PTZ00317, PTZ00317, NADP-dependent malic enzyme; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214912 smart00919, Malic_M, Malic enzyme, NAD binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|240357 PTZ00317, PTZ00317, NADP-dependent malic enzyme; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223358 COG0281, SfcA, Malic enzyme [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|133442 cd00762, NAD_bind_malic_enz, NAD(P) binding domain of malic enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|214912 smart00919, Malic_M, Malic enzyme, NAD binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|237414 PRK13529, PRK13529, malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240357 PTZ00317, PTZ00317, NADP-dependent malic enzyme; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223358 COG0281, SfcA, Malic enzyme [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|215594 PLN03129, PLN03129, NADP-dependent malic enzyme; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223358 COG0281, SfcA, Malic enzyme [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|237414 PRK13529, PRK13529, malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215894 pfam00390, malic, Malic enzyme, N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|133454 cd05312, NAD_bind_1_malic_enz, NAD(P) binding domain of malic enzyme (ME), subgroup 1 | Back alignment and domain information |
|---|
| >gnl|CDD|217809 pfam03949, Malic_M, Malic enzyme, NAD binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|214912 smart00919, Malic_M, Malic enzyme, NAD binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|133454 cd05312, NAD_bind_1_malic_enz, NAD(P) binding domain of malic enzyme (ME), subgroup 1 | Back alignment and domain information |
|---|
| >gnl|CDD|214912 smart00919, Malic_M, Malic enzyme, NAD binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|215594 PLN03129, PLN03129, NADP-dependent malic enzyme; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217809 pfam03949, Malic_M, Malic enzyme, NAD binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|133442 cd00762, NAD_bind_malic_enz, NAD(P) binding domain of malic enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|133442 cd00762, NAD_bind_malic_enz, NAD(P) binding domain of malic enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|133454 cd05312, NAD_bind_1_malic_enz, NAD(P) binding domain of malic enzyme (ME), subgroup 1 | Back alignment and domain information |
|---|
| >gnl|CDD|133453 cd05311, NAD_bind_2_malic_enz, NAD(P) binding domain of malic enzyme (ME), subgroup 2 | Back alignment and domain information |
|---|
| >gnl|CDD|133454 cd05312, NAD_bind_1_malic_enz, NAD(P) binding domain of malic enzyme (ME), subgroup 1 | Back alignment and domain information |
|---|
| >gnl|CDD|240357 PTZ00317, PTZ00317, NADP-dependent malic enzyme; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223358 COG0281, SfcA, Malic enzyme [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|215594 PLN03129, PLN03129, NADP-dependent malic enzyme; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215594 PLN03129, PLN03129, NADP-dependent malic enzyme; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214912 smart00919, Malic_M, Malic enzyme, NAD binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|237414 PRK13529, PRK13529, malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217809 pfam03949, Malic_M, Malic enzyme, NAD binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|217809 pfam03949, Malic_M, Malic enzyme, NAD binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|133442 cd00762, NAD_bind_malic_enz, NAD(P) binding domain of malic enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|133442 cd00762, NAD_bind_malic_enz, NAD(P) binding domain of malic enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|214912 smart00919, Malic_M, Malic enzyme, NAD binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|133453 cd05311, NAD_bind_2_malic_enz, NAD(P) binding domain of malic enzyme (ME), subgroup 2 | Back alignment and domain information |
|---|
| >gnl|CDD|235976 PRK07232, PRK07232, bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|133449 cd05191, NAD_bind_amino_acid_DH, NAD(P) binding domain of amino acid dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|133449 cd05191, NAD_bind_amino_acid_DH, NAD(P) binding domain of amino acid dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|183799 PRK12862, PRK12862, malic enzyme; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237414 PRK13529, PRK13529, malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223358 COG0281, SfcA, Malic enzyme [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|235976 PRK07232, PRK07232, bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|183799 PRK12862, PRK12862, malic enzyme; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|133453 cd05311, NAD_bind_2_malic_enz, NAD(P) binding domain of malic enzyme (ME), subgroup 2 | Back alignment and domain information |
|---|
| >gnl|CDD|133453 cd05311, NAD_bind_2_malic_enz, NAD(P) binding domain of malic enzyme (ME), subgroup 2 | Back alignment and domain information |
|---|
| >gnl|CDD|183799 PRK12862, PRK12862, malic enzyme; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223358 COG0281, SfcA, Malic enzyme [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|183798 PRK12861, PRK12861, malic enzyme; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223358 COG0281, SfcA, Malic enzyme [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|235976 PRK07232, PRK07232, bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240357 PTZ00317, PTZ00317, NADP-dependent malic enzyme; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223358 COG0281, SfcA, Malic enzyme [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|133449 cd05191, NAD_bind_amino_acid_DH, NAD(P) binding domain of amino acid dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|133453 cd05311, NAD_bind_2_malic_enz, NAD(P) binding domain of malic enzyme (ME), subgroup 2 | Back alignment and domain information |
|---|
| >gnl|CDD|133449 cd05191, NAD_bind_amino_acid_DH, NAD(P) binding domain of amino acid dehydrogenase-like proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 848 | |||
| KOG1257|consensus | 582 | 100.0 | ||
| PRK13529 | 563 | malate dehydrogenase; Provisional | 100.0 | |
| PLN03129 | 581 | NADP-dependent malic enzyme; Provisional | 100.0 | |
| PTZ00317 | 559 | NADP-dependent malic enzyme; Provisional | 100.0 | |
| PTZ00317 | 559 | NADP-dependent malic enzyme; Provisional | 100.0 | |
| PRK13529 | 563 | malate dehydrogenase; Provisional | 100.0 | |
| PLN03129 | 581 | NADP-dependent malic enzyme; Provisional | 100.0 | |
| PF03949 | 255 | Malic_M: Malic enzyme, NAD binding domain; InterPr | 100.0 | |
| PF00390 | 182 | malic: Malic enzyme, N-terminal domain; InterPro: | 100.0 | |
| KOG1257|consensus | 582 | 100.0 | ||
| cd00762 | 254 | NAD_bind_malic_enz NAD(P) binding domain of malic | 100.0 | |
| cd05312 | 279 | NAD_bind_1_malic_enz NAD(P) binding domain of mali | 100.0 | |
| COG0281 | 432 | SfcA Malic enzyme [Energy production and conversio | 100.0 | |
| PRK12861 | 764 | malic enzyme; Reviewed | 100.0 | |
| COG0281 | 432 | SfcA Malic enzyme [Energy production and conversio | 100.0 | |
| PRK12862 | 763 | malic enzyme; Reviewed | 100.0 | |
| PRK07232 | 752 | bifunctional malic enzyme oxidoreductase/phosphotr | 100.0 | |
| PRK12861 | 764 | malic enzyme; Reviewed | 100.0 | |
| PRK07232 | 752 | bifunctional malic enzyme oxidoreductase/phosphotr | 100.0 | |
| PRK12862 | 763 | malic enzyme; Reviewed | 100.0 | |
| cd05312 | 279 | NAD_bind_1_malic_enz NAD(P) binding domain of mali | 100.0 | |
| PF03949 | 255 | Malic_M: Malic enzyme, NAD binding domain; InterPr | 100.0 | |
| cd00762 | 254 | NAD_bind_malic_enz NAD(P) binding domain of malic | 100.0 | |
| cd05311 | 226 | NAD_bind_2_malic_enz NAD(P) binding domain of mali | 100.0 | |
| cd05311 | 226 | NAD_bind_2_malic_enz NAD(P) binding domain of mali | 99.92 | |
| PF00390 | 182 | malic: Malic enzyme, N-terminal domain; InterPro: | 99.36 | |
| cd05191 | 86 | NAD_bind_amino_acid_DH NAD(P) binding domain of am | 97.39 | |
| cd05191 | 86 | NAD_bind_amino_acid_DH NAD(P) binding domain of am | 97.1 | |
| PRK14031 | 444 | glutamate dehydrogenase; Provisional | 95.56 | |
| PRK09754 | 396 | phenylpropionate dioxygenase ferredoxin reductase | 95.36 | |
| PRK05476 | 425 | S-adenosyl-L-homocysteine hydrolase; Provisional | 95.09 | |
| PLN02477 | 410 | glutamate dehydrogenase | 94.63 | |
| PRK09414 | 445 | glutamate dehydrogenase; Provisional | 94.57 | |
| PRK14030 | 445 | glutamate dehydrogenase; Provisional | 94.13 | |
| PTZ00079 | 454 | NADP-specific glutamate dehydrogenase; Provisional | 93.34 | |
| PRK14982 | 340 | acyl-ACP reductase; Provisional | 93.02 | |
| PRK12549 | 284 | shikimate 5-dehydrogenase; Reviewed | 91.68 | |
| PRK12749 | 288 | quinate/shikimate dehydrogenase; Reviewed | 89.88 | |
| TIGR02374 | 785 | nitri_red_nirB nitrite reductase [NAD(P)H], large | 89.44 | |
| cd00401 | 413 | AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado | 89.31 | |
| cd05211 | 217 | NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of | 89.03 | |
| cd01065 | 155 | NAD_bind_Shikimate_DH NAD(P) binding domain of Shi | 88.98 | |
| PF00208 | 244 | ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Val | 88.97 | |
| PLN02494 | 477 | adenosylhomocysteinase | 88.93 | |
| TIGR01809 | 282 | Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO | 88.72 | |
| TIGR01035 | 417 | hemA glutamyl-tRNA reductase. This enzyme, togethe | 88.62 | |
| PF01488 | 135 | Shikimate_DH: Shikimate / quinate 5-dehydrogenase; | 88.51 | |
| PRK14027 | 283 | quinate/shikimate dehydrogenase; Provisional | 88.36 | |
| cd01078 | 194 | NAD_bind_H4MPT_DH NADP binding domain of methylene | 88.3 | |
| COG0373 | 414 | HemA Glutamyl-tRNA reductase [Coenzyme metabolism] | 87.83 | |
| cd05211 | 217 | NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of | 87.67 | |
| PRK12548 | 289 | shikimate 5-dehydrogenase; Provisional | 87.56 | |
| COG0334 | 411 | GdhA Glutamate dehydrogenase/leucine dehydrogenase | 87.54 | |
| PRK14192 | 283 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 87.26 | |
| PRK00258 | 278 | aroE shikimate 5-dehydrogenase; Reviewed | 87.17 | |
| cd05313 | 254 | NAD_bind_2_Glu_DH NAD(P) binding domain of glutama | 86.53 | |
| cd01080 | 168 | NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of | 86.27 | |
| PF01488 | 135 | Shikimate_DH: Shikimate / quinate 5-dehydrogenase; | 85.86 | |
| KOG0685|consensus | 498 | 85.74 | ||
| PLN00106 | 323 | malate dehydrogenase | 85.55 | |
| KOG0029|consensus | 501 | 85.43 | ||
| cd01078 | 194 | NAD_bind_H4MPT_DH NADP binding domain of methylene | 85.19 | |
| cd01065 | 155 | NAD_bind_Shikimate_DH NAD(P) binding domain of Shi | 84.48 | |
| TIGR00936 | 406 | ahcY adenosylhomocysteinase. This enzyme hydrolyze | 84.42 | |
| PF07992 | 201 | Pyr_redox_2: Pyridine nucleotide-disulphide oxidor | 84.36 | |
| PF00670 | 162 | AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase | 84.25 | |
| PF13738 | 203 | Pyr_redox_3: Pyridine nucleotide-disulphide oxidor | 83.68 | |
| PF00899 | 135 | ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a | 83.62 | |
| cd01076 | 227 | NAD_bind_1_Glu_DH NAD(P) binding domain of glutama | 82.49 | |
| cd05213 | 311 | NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain | 82.47 | |
| COG0169 | 283 | AroE Shikimate 5-dehydrogenase [Amino acid transpo | 82.38 | |
| cd05313 | 254 | NAD_bind_2_Glu_DH NAD(P) binding domain of glutama | 82.19 | |
| TIGR00518 | 370 | alaDH alanine dehydrogenase. The family of known L | 82.01 | |
| PF01494 | 356 | FAD_binding_3: FAD binding domain; InterPro: IPR00 | 81.9 | |
| PRK12549 | 284 | shikimate 5-dehydrogenase; Reviewed | 81.7 | |
| PRK12550 | 272 | shikimate 5-dehydrogenase; Reviewed | 81.69 | |
| COG0373 | 414 | HemA Glutamyl-tRNA reductase [Coenzyme metabolism] | 81.35 | |
| cd01076 | 227 | NAD_bind_1_Glu_DH NAD(P) binding domain of glutama | 81.27 | |
| TIGR03169 | 364 | Nterm_to_SelD pyridine nucleotide-disulfide oxidor | 81.22 | |
| PRK08328 | 231 | hypothetical protein; Provisional | 81.0 | |
| TIGR02354 | 200 | thiF_fam2 thiamine biosynthesis protein ThiF, fami | 80.83 | |
| TIGR01292 | 300 | TRX_reduct thioredoxin-disulfide reductase. This m | 80.68 | |
| TIGR02853 | 287 | spore_dpaA dipicolinic acid synthetase, A subunit. | 80.52 |
| >KOG1257|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.8e-106 Score=891.11 Aligned_cols=357 Identities=57% Similarity=0.966 Sum_probs=322.5
Q ss_pred cCCcchhhh-hhhccccccHHHHhhhcccccCcccccchhHHHHHhhccccccCCChhhHHHHHHhhcccceeEEEeccC
Q psy14377 306 HAPVKNLAD-VVKTGMAFSIEERQALGIHGLLPAAVKSQDEQLHLCKLNVDRYEDPLNKYIYLQALAVKTDIRAIVVTDG 384 (848)
Q Consensus 306 ~~~~~~l~~-~~n~g~~~~~~er~~~~~~G~~p~~v~~~~~q~~~~~~~~~~~~~~~~~~~~L~~l~~~~~~~~~~~~d~ 384 (848)
..++..|++ .+|||++||.+|||++++||+|||.|+|+|+|++||+.++++++++++||.||..|+++ |
T Consensus 29 ~~g~~ll~~p~~NKglAFTl~ERq~l~i~GLLPp~v~t~d~Q~~r~~~~l~~~~~~l~ky~~L~~L~~r----------N 98 (582)
T KOG1257|consen 29 KRGYDLLRDPRYNKGLAFTLEERQRLGIHGLLPPVVRTQDEQALRCMNNLRSLTSPLAKYIYLMDLQDR----------N 98 (582)
T ss_pred cCChhhccCCCcccccccCHHHHHhhCccccCCccccCHHHHHHHHHHHHHhccchHHHHHHHHHHHHh----------h
Confidence 357788888 89999999999999999999999999999999999999999999999999999999999 8
Q ss_pred ceecccccCCCCCCCcccccccHHHHHcCCCcCccCceeeEEccccccccCCCCCCCHHHHHHHHhcCCCceEEecCCCC
Q psy14377 385 ERILGLGDLGAYGMGIPVGKLSLYTALAGIKPHQCLPITLDVGTNWRRAAAIPQVFTADILKDMAAFNKRPIIFALSNPT 464 (848)
Q Consensus 385 ~~l~g~~~~g~~~~~~~~g~~~L~~al~g~kP~~~~~~~v~iG~~~~~~S~~~g~FTeevvk~Ma~~~~rPIIFaLSNPt 464 (848)
++|
T Consensus 99 erL----------------------------------------------------------------------------- 101 (582)
T KOG1257|consen 99 ERL----------------------------------------------------------------------------- 101 (582)
T ss_pred hHH-----------------------------------------------------------------------------
Confidence 877
Q ss_pred CccCCCHHHHhccCCCcEEEEeCCCCCCcccCCeEEecccchhhccCCeEecchhhhHHHhhccccccCccceeeccCcc
Q psy14377 465 SKAECTAEQAYVNTDGRGVFASGSPFDPVTYKGKTFTPGQEYVVELMPIVYTPTVGLACQKYGLIFRRPRGLFISIHDKG 544 (848)
Q Consensus 465 ~~~E~tpe~a~~~T~G~ai~AtGsPf~pv~y~g~~~~~~q~nn~e~lPvvYTPGVG~acl~~~~i~r~p~gm~L~~~d~g 544 (848)
||+ ....|..+++|++||||||++|+.||.+||+|+|||++++|+|
T Consensus 102 -----------------------------fY~-----~l~~nie~~~PIvYTPTvG~acq~y~~i~r~p~Glfisi~D~G 147 (582)
T KOG1257|consen 102 -----------------------------FYR-----LLIDNIEELLPIVYTPTVGLACQQYGLIFRRPQGLFISIKDKG 147 (582)
T ss_pred -----------------------------HHH-----HHHhhHHHhCCeeecCcHHHHHHHhhhhhccCceeEEEecccc
Confidence 555 7789999999999999999999999999999999999999999
Q ss_pred cHHHHHhcCCCCCccEEEEecCceeeccCCCCCCCCCccccceeeeeecCCCCCCceeeEEeeccCCcccccCCcccccc
Q psy14377 545 HISEVLRNWPETDIRAIVVTDGERILGLGDLGAYGMGIPVGKLSLYTALAGIKPHQCLPITLDVGTNTQQLLDDPLYIGL 624 (848)
Q Consensus 545 ~i~eiL~Nwp~~d~~viVVTDG~rILGLGDlG~~gmgIpvGKl~Ly~a~aGI~p~~~LPv~LDvGTnn~~ll~Dp~y~g~ 624 (848)
||.++|+|||+++|++||||||||||||||||++|||||||||+|||+||||+|++|||||||||||||+||+||+|+|+
T Consensus 148 hi~~~l~nWp~~~V~~IvVTDGerILGLGDlG~~GmgIpvgKL~Lyta~~GI~P~~cLPV~LDVGTNNe~Ll~DplYiGL 227 (582)
T KOG1257|consen 148 HIKQVLKNWPERNVKAIVVTDGERILGLGDLGVNGMGIPVGKLALYTALGGIRPSRCLPVCLDVGTNNEKLLNDPLYIGL 227 (582)
T ss_pred hHHHHHHhCCccceeEEEEeCCCceecccccccCcccceecHHHHHHHhcCCChhhceeEEEeccCChHHHhcCcccccc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cccCCCCcchhHHHHHHHHHHHHhhCCceeeeeecCCCcchHHHHHHHcccCceeccCCchHHHHHHHHHHHHHhhhCCc
Q psy14377 625 RQRRTTGQAYDDFIEEFMQAVVARYGQHVLIQFEDFANHSAFRFLDTYRNRYCVFNDDIQGTASVAVAGLLASLRITKTR 704 (848)
Q Consensus 625 r~~R~~g~~y~~fvdefv~av~~~fGp~~~IqfEDf~~~naf~lL~ryr~~~~~FnDDiQGTaaV~LAgllaAlr~t~~~ 704 (848)
||+|++|++||+|+||||+|+.++|||+++||||||+++|||++|+|||+++|||||||||||+|+|||||+|+|++|++
T Consensus 228 r~~R~~g~eYd~~~dEFm~Av~~~yG~~~lIqFEDF~~~nAfrlL~kYr~~~c~FNDDIQGTaaValAgllaa~rit~~~ 307 (582)
T KOG1257|consen 228 RQRRVRGKEYDEFLDEFMEAVVQRYGPNTLIQFEDFANHNAFRLLEKYRNKYCMFNDDIQGTAAVALAGLLAALRITGKP 307 (582)
T ss_pred ccccccccHHHHHHHHHHHHHHHHhCcceEEEehhccchhHHHHHHHhccccceecccccchhHHHHHHHHHHHHHhCCc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCceEEecCcchhhHHHHHHHHHHHhcccc----------ccccc-CceecCCCCCCchH-HHhh-hccccchhhcccc
Q psy14377 705 LSDNTILFQGAGEGTASVAVAGLLASLRITK----------TRLSD-NTILFQGAGEGTAS-VAIA-GLLASLRITKTRL 771 (848)
Q Consensus 705 l~d~riv~~GAG~A~~g~giA~ll~~~~~~~----------~~~~d-~g~i~~~r~~~~~~-~~~~-~~~~~~r~~~~~~ 771 (848)
|+|++|||+|||+| |+|||+||+.+|+++ .-+.| +|+|-++|.++-.. ...+ .-..+-+.|+++.
T Consensus 308 lsd~~ilf~GAG~A--~~GIA~l~v~~m~~~Gl~~eeA~kkIwlvD~~GLi~~~r~~~l~~~~~~fAk~~~~~~~L~e~V 385 (582)
T KOG1257|consen 308 LSDHVILFLGAGEA--ALGIANLIVMAMVKEGLSEEEARKKIWLVDSKGLITKGRKASLTEEKKPFAKDHEEIKDLEEAV 385 (582)
T ss_pred cccceEEEecCchH--HhhHHHHHHHHHHHcCCCHHHHhccEEEEecCceeeccccCCCChhhccccccChHHHHHHHHH
Confidence 99999999999999 999999999998664 11444 66666666533221 1111 1111222444443
Q ss_pred C--CCceEEeecCCCc
Q psy14377 772 S--DNTILFQGSGEGT 785 (848)
Q Consensus 772 ~--~~~~~~~~s~~~~ 785 (848)
+ .-++++|.|+-|-
T Consensus 386 ~~vKPtvLiG~S~~~g 401 (582)
T KOG1257|consen 386 KEVKPTVLIGASGVGG 401 (582)
T ss_pred HhcCCcEEEecccCCc
Confidence 3 3578888887654
|
|
| >PRK13529 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN03129 NADP-dependent malic enzyme; Provisional | Back alignment and domain information |
|---|
| >PTZ00317 NADP-dependent malic enzyme; Provisional | Back alignment and domain information |
|---|
| >PTZ00317 NADP-dependent malic enzyme; Provisional | Back alignment and domain information |
|---|
| >PRK13529 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN03129 NADP-dependent malic enzyme; Provisional | Back alignment and domain information |
|---|
| >PF03949 Malic_M: Malic enzyme, NAD binding domain; InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e | Back alignment and domain information |
|---|
| >PF00390 malic: Malic enzyme, N-terminal domain; InterPro: IPR012301 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e | Back alignment and domain information |
|---|
| >KOG1257|consensus | Back alignment and domain information |
|---|
| >cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme | Back alignment and domain information |
|---|
| >cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 | Back alignment and domain information |
|---|
| >COG0281 SfcA Malic enzyme [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK12861 malic enzyme; Reviewed | Back alignment and domain information |
|---|
| >COG0281 SfcA Malic enzyme [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK12862 malic enzyme; Reviewed | Back alignment and domain information |
|---|
| >PRK07232 bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed | Back alignment and domain information |
|---|
| >PRK12861 malic enzyme; Reviewed | Back alignment and domain information |
|---|
| >PRK07232 bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed | Back alignment and domain information |
|---|
| >PRK12862 malic enzyme; Reviewed | Back alignment and domain information |
|---|
| >cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 | Back alignment and domain information |
|---|
| >PF03949 Malic_M: Malic enzyme, NAD binding domain; InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e | Back alignment and domain information |
|---|
| >cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme | Back alignment and domain information |
|---|
| >cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 | Back alignment and domain information |
|---|
| >cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 | Back alignment and domain information |
|---|
| >PF00390 malic: Malic enzyme, N-terminal domain; InterPro: IPR012301 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e | Back alignment and domain information |
|---|
| >cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >PRK14031 glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional | Back alignment and domain information |
|---|
| >PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN02477 glutamate dehydrogenase | Back alignment and domain information |
|---|
| >PRK09414 glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14030 glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PTZ00079 NADP-specific glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14982 acyl-ACP reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12549 shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK12749 quinate/shikimate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit | Back alignment and domain information |
|---|
| >cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) | Back alignment and domain information |
|---|
| >cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase | Back alignment and domain information |
|---|
| >PF00208 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Valine dehydrogenase; InterPro: IPR006096 Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related | Back alignment and domain information |
|---|
| >PLN02494 adenosylhomocysteinase | Back alignment and domain information |
|---|
| >TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type | Back alignment and domain information |
|---|
| >TIGR01035 hemA glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases | Back alignment and domain information |
|---|
| >PRK14027 quinate/shikimate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase | Back alignment and domain information |
|---|
| >COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >PRK12548 shikimate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK00258 aroE shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 | Back alignment and domain information |
|---|
| >cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases | Back alignment and domain information |
|---|
| >KOG0685|consensus | Back alignment and domain information |
|---|
| >PLN00106 malate dehydrogenase | Back alignment and domain information |
|---|
| >KOG0029|consensus | Back alignment and domain information |
|---|
| >cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase | Back alignment and domain information |
|---|
| >cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase | Back alignment and domain information |
|---|
| >TIGR00936 ahcY adenosylhomocysteinase | Back alignment and domain information |
|---|
| >PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 | Back alignment and domain information |
|---|
| >PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A | Back alignment and domain information |
|---|
| >PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP | Back alignment and domain information |
|---|
| >cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 | Back alignment and domain information |
|---|
| >cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 | Back alignment and domain information |
|---|
| >TIGR00518 alaDH alanine dehydrogenase | Back alignment and domain information |
|---|
| >PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways | Back alignment and domain information |
|---|
| >PRK12549 shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK12550 shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 | Back alignment and domain information |
|---|
| >TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein | Back alignment and domain information |
|---|
| >PRK08328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 | Back alignment and domain information |
|---|
| >TIGR01292 TRX_reduct thioredoxin-disulfide reductase | Back alignment and domain information |
|---|
| >TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 848 | ||||
| 1gq2_A | 555 | Malic Enzyme From Pigeon Liver Length = 555 | 3e-87 | ||
| 1gq2_A | 555 | Malic Enzyme From Pigeon Liver Length = 555 | 1e-08 | ||
| 1gq2_A | 555 | Malic Enzyme From Pigeon Liver Length = 555 | 1e-06 | ||
| 2aw5_A | 575 | Crystal Structure Of A Human Malic Enzyme Length = | 2e-86 | ||
| 2aw5_A | 575 | Crystal Structure Of A Human Malic Enzyme Length = | 2e-08 | ||
| 2aw5_A | 575 | Crystal Structure Of A Human Malic Enzyme Length = | 6e-08 | ||
| 1gz3_A | 554 | Molecular Mechanism For The Regulation Of Human Mit | 3e-79 | ||
| 1gz3_A | 554 | Molecular Mechanism For The Regulation Of Human Mit | 4e-07 | ||
| 1efk_A | 584 | Structure Of Human Malic Enzyme In Complex With Ket | 4e-76 | ||
| 1efk_A | 584 | Structure Of Human Malic Enzyme In Complex With Ket | 2e-06 | ||
| 1qr6_A | 584 | Human Mitochondrial Nad(P)-Dependent Malic Enzyme L | 4e-76 | ||
| 1qr6_A | 584 | Human Mitochondrial Nad(P)-Dependent Malic Enzyme L | 2e-06 | ||
| 1do8_A | 564 | Crystal Structure Of A Closed Form Of Human Mitocho | 4e-76 | ||
| 1do8_A | 564 | Crystal Structure Of A Closed Form Of Human Mitocho | 2e-06 | ||
| 1gz4_A | 551 | Molecular Mechanism Of The Regulation Of Human Mito | 6e-76 | ||
| 1gz4_A | 551 | Molecular Mechanism Of The Regulation Of Human Mito | 2e-06 | ||
| 1llq_A | 605 | Crystal Structure Of Malic Enzyme From Ascaris Suum | 1e-73 | ||
| 1llq_A | 605 | Crystal Structure Of Malic Enzyme From Ascaris Suum | 3e-09 | ||
| 2dvm_A | 439 | Nad Complex Structure Of Ph1275 Protein From Pyroco | 3e-06 | ||
| 1ww8_A | 439 | Crystal Structure Of Malic Enzyme From Pyrococcus H | 3e-06 | ||
| 3nv9_A | 487 | Crystal Structure Of Entamoeba Histolytica Malic En | 1e-05 | ||
| 1vl6_A | 388 | Crystal Structure Of Nad-Dependent Malic Enzyme (Tm | 2e-04 | ||
| 2hae_A | 386 | Crystal Structure Of A Putative Malic Enzyme (Malat | 3e-04 | ||
| 2a9f_A | 398 | Crystal Structure Of A Putative Malic Enzyme ((S)- | 7e-04 |
| >pdb|1GQ2|A Chain A, Malic Enzyme From Pigeon Liver Length = 555 | Back alignment and structure |
|
| >pdb|1GQ2|A Chain A, Malic Enzyme From Pigeon Liver Length = 555 | Back alignment and structure |
| >pdb|1GQ2|A Chain A, Malic Enzyme From Pigeon Liver Length = 555 | Back alignment and structure |
| >pdb|2AW5|A Chain A, Crystal Structure Of A Human Malic Enzyme Length = 575 | Back alignment and structure |
| >pdb|2AW5|A Chain A, Crystal Structure Of A Human Malic Enzyme Length = 575 | Back alignment and structure |
| >pdb|2AW5|A Chain A, Crystal Structure Of A Human Malic Enzyme Length = 575 | Back alignment and structure |
| >pdb|1GZ3|A Chain A, Molecular Mechanism For The Regulation Of Human Mitochondrial Nad(P)+-Dependent Malic Enzyme By Atp And Fumarate Length = 554 | Back alignment and structure |
| >pdb|1GZ3|A Chain A, Molecular Mechanism For The Regulation Of Human Mitochondrial Nad(P)+-Dependent Malic Enzyme By Atp And Fumarate Length = 554 | Back alignment and structure |
| >pdb|1EFK|A Chain A, Structure Of Human Malic Enzyme In Complex With Ketomalonate Length = 584 | Back alignment and structure |
| >pdb|1EFK|A Chain A, Structure Of Human Malic Enzyme In Complex With Ketomalonate Length = 584 | Back alignment and structure |
| >pdb|1QR6|A Chain A, Human Mitochondrial Nad(P)-Dependent Malic Enzyme Length = 584 | Back alignment and structure |
| >pdb|1QR6|A Chain A, Human Mitochondrial Nad(P)-Dependent Malic Enzyme Length = 584 | Back alignment and structure |
| >pdb|1DO8|A Chain A, Crystal Structure Of A Closed Form Of Human Mitochondrial Nad(P)+-Dependent Malic Enzyme Length = 564 | Back alignment and structure |
| >pdb|1DO8|A Chain A, Crystal Structure Of A Closed Form Of Human Mitochondrial Nad(P)+-Dependent Malic Enzyme Length = 564 | Back alignment and structure |
| >pdb|1GZ4|A Chain A, Molecular Mechanism Of The Regulation Of Human Mitochondrial Nad(P)+-Dependent Malic Enzyme By Atp And Fumarate Length = 551 | Back alignment and structure |
| >pdb|1GZ4|A Chain A, Molecular Mechanism Of The Regulation Of Human Mitochondrial Nad(P)+-Dependent Malic Enzyme By Atp And Fumarate Length = 551 | Back alignment and structure |
| >pdb|1LLQ|A Chain A, Crystal Structure Of Malic Enzyme From Ascaris Suum Complexed With Nicotinamide Adenine Dinucleotide Length = 605 | Back alignment and structure |
| >pdb|1LLQ|A Chain A, Crystal Structure Of Malic Enzyme From Ascaris Suum Complexed With Nicotinamide Adenine Dinucleotide Length = 605 | Back alignment and structure |
| >pdb|2DVM|A Chain A, Nad Complex Structure Of Ph1275 Protein From Pyrococcus Horikoshii Length = 439 | Back alignment and structure |
| >pdb|1WW8|A Chain A, Crystal Structure Of Malic Enzyme From Pyrococcus Horikoshii Ot3 Length = 439 | Back alignment and structure |
| >pdb|3NV9|A Chain A, Crystal Structure Of Entamoeba Histolytica Malic Enzyme Length = 487 | Back alignment and structure |
| >pdb|1VL6|A Chain A, Crystal Structure Of Nad-Dependent Malic Enzyme (Tm0542) From Thermotoga Maritima At 2.61 A Resolution Length = 388 | Back alignment and structure |
| >pdb|2HAE|A Chain A, Crystal Structure Of A Putative Malic Enzyme (Malate Oxidoreductase) Length = 386 | Back alignment and structure |
| >pdb|2A9F|A Chain A, Crystal Structure Of A Putative Malic Enzyme ((S)- Malate:nad+ Oxidoreductase (Decarboxylating)) Length = 398 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 848 | |||
| 1pj3_A | 564 | NAD-dependent malic enzyme, mitochondrial; oxidati | 1e-128 | |
| 1pj3_A | 564 | NAD-dependent malic enzyme, mitochondrial; oxidati | 1e-30 | |
| 1pj3_A | 564 | NAD-dependent malic enzyme, mitochondrial; oxidati | 2e-29 | |
| 1pj3_A | 564 | NAD-dependent malic enzyme, mitochondrial; oxidati | 2e-28 | |
| 1pj3_A | 564 | NAD-dependent malic enzyme, mitochondrial; oxidati | 2e-27 | |
| 1pj3_A | 564 | NAD-dependent malic enzyme, mitochondrial; oxidati | 4e-22 | |
| 1pj3_A | 564 | NAD-dependent malic enzyme, mitochondrial; oxidati | 2e-15 | |
| 1pj3_A | 564 | NAD-dependent malic enzyme, mitochondrial; oxidati | 7e-13 | |
| 1pj3_A | 564 | NAD-dependent malic enzyme, mitochondrial; oxidati | 1e-05 | |
| 1pj3_A | 564 | NAD-dependent malic enzyme, mitochondrial; oxidati | 1e-05 | |
| 1gq2_A | 555 | Malic enzyme; oxidoreductase, pigeon liver, NADP-d | 1e-127 | |
| 1gq2_A | 555 | Malic enzyme; oxidoreductase, pigeon liver, NADP-d | 5e-33 | |
| 1gq2_A | 555 | Malic enzyme; oxidoreductase, pigeon liver, NADP-d | 6e-30 | |
| 1gq2_A | 555 | Malic enzyme; oxidoreductase, pigeon liver, NADP-d | 1e-29 | |
| 1gq2_A | 555 | Malic enzyme; oxidoreductase, pigeon liver, NADP-d | 2e-29 | |
| 1gq2_A | 555 | Malic enzyme; oxidoreductase, pigeon liver, NADP-d | 1e-24 | |
| 1gq2_A | 555 | Malic enzyme; oxidoreductase, pigeon liver, NADP-d | 7e-16 | |
| 1gq2_A | 555 | Malic enzyme; oxidoreductase, pigeon liver, NADP-d | 1e-12 | |
| 1gq2_A | 555 | Malic enzyme; oxidoreductase, pigeon liver, NADP-d | 8e-06 | |
| 1gq2_A | 555 | Malic enzyme; oxidoreductase, pigeon liver, NADP-d | 1e-05 | |
| 1o0s_A | 605 | NAD-ME, NAD-dependent malic enzyme; oxidoreductase | 1e-123 | |
| 1o0s_A | 605 | NAD-ME, NAD-dependent malic enzyme; oxidoreductase | 1e-34 | |
| 1o0s_A | 605 | NAD-ME, NAD-dependent malic enzyme; oxidoreductase | 4e-31 | |
| 1o0s_A | 605 | NAD-ME, NAD-dependent malic enzyme; oxidoreductase | 6e-30 | |
| 1o0s_A | 605 | NAD-ME, NAD-dependent malic enzyme; oxidoreductase | 3e-27 | |
| 1o0s_A | 605 | NAD-ME, NAD-dependent malic enzyme; oxidoreductase | 3e-22 | |
| 1o0s_A | 605 | NAD-ME, NAD-dependent malic enzyme; oxidoreductase | 4e-11 | |
| 1o0s_A | 605 | NAD-ME, NAD-dependent malic enzyme; oxidoreductase | 3e-05 | |
| 1o0s_A | 605 | NAD-ME, NAD-dependent malic enzyme; oxidoreductase | 5e-05 | |
| 3nv9_A | 487 | Malic enzyme; rossmann fold, oxidoreductase; 2.25A | 1e-13 | |
| 3nv9_A | 487 | Malic enzyme; rossmann fold, oxidoreductase; 2.25A | 9e-07 | |
| 3nv9_A | 487 | Malic enzyme; rossmann fold, oxidoreductase; 2.25A | 2e-05 | |
| 3nv9_A | 487 | Malic enzyme; rossmann fold, oxidoreductase; 2.25A | 8e-04 | |
| 2a9f_A | 398 | Putative malic enzyme ((S)-malate:NAD+ oxidoreduct | 1e-10 | |
| 2a9f_A | 398 | Putative malic enzyme ((S)-malate:NAD+ oxidoreduct | 3e-07 | |
| 2a9f_A | 398 | Putative malic enzyme ((S)-malate:NAD+ oxidoreduct | 6e-06 | |
| 2a9f_A | 398 | Putative malic enzyme ((S)-malate:NAD+ oxidoreduct | 7e-04 | |
| 2dvm_A | 439 | Malic enzyme, 439AA long hypothetical malate oxido | 1e-10 | |
| 2dvm_A | 439 | Malic enzyme, 439AA long hypothetical malate oxido | 7e-05 | |
| 1vl6_A | 388 | Malate oxidoreductase; TM0542, NAD-dependent malic | 4e-10 | |
| 1vl6_A | 388 | Malate oxidoreductase; TM0542, NAD-dependent malic | 6e-09 | |
| 1vl6_A | 388 | Malate oxidoreductase; TM0542, NAD-dependent malic | 1e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-05 |
| >1pj3_A NAD-dependent malic enzyme, mitochondrial; oxidative decarboxylase, oxidoreductase; HET: NAD; 2.10A {Homo sapiens} SCOP: c.2.1.7 c.58.1.3 PDB: 1pj2_A* 1do8_A* 1pj4_A* 1qr6_A* 1efl_A* 1pjl_A* 1efk_A* 1gz4_A* 1gz3_A* Length = 564 | Back alignment and structure |
|---|
Score = 394 bits (1015), Expect = e-128
Identities = 141/227 (62%), Positives = 178/227 (78%), Gaps = 2/227 (0%)
Query: 504 QEYVVELMPIVYTPTVGLACQKYGLIFRRPRGLFISIHDKGHISEVLRNWPETDIRAIVV 563
Q+ + LMPIVYTPTVGLAC +YG IFRRP+GLFISI D+GH+ ++ NWPE ++A+VV
Sbjct: 81 QDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVV 140
Query: 564 TDGERILGLGDLGAYGMGIPVGKLSLYTALAGIKPHQCLPITLDVGTNTQQLLDDPLYIG 623
TDGERILGLGDLG YGMGIPVGKL LYTA AGI+P +CLP+ +DVGT+ LL DP Y+G
Sbjct: 141 TDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMG 200
Query: 624 LRQRRTTGQAYDDFIEEFMQAVVARYGQHVLIQFEDFANHSAFRFLDTYRNRYCVFNDDI 683
L Q+R Q YDD I+EFM+A+ RYG++ LIQFEDF NH+AFRFL YR +YC FNDDI
Sbjct: 201 LYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDI 260
Query: 684 QGTASVAVAGLLASLRITKTRLSDNTILFQGAGEGTASVAVAGLLAS 730
QGTA+VA+AGLLA+ ++ +S++ ILF GA G A++ +A L+
Sbjct: 261 QGTAAVALAGLLAAQKVISKPISEHKILFLGA--GEAALGIANLIVM 305
|
| >1pj3_A NAD-dependent malic enzyme, mitochondrial; oxidative decarboxylase, oxidoreductase; HET: NAD; 2.10A {Homo sapiens} SCOP: c.2.1.7 c.58.1.3 PDB: 1pj2_A* 1do8_A* 1pj4_A* 1qr6_A* 1efl_A* 1pjl_A* 1efk_A* 1gz4_A* 1gz3_A* Length = 564 | Back alignment and structure |
|---|
| >1pj3_A NAD-dependent malic enzyme, mitochondrial; oxidative decarboxylase, oxidoreductase; HET: NAD; 2.10A {Homo sapiens} SCOP: c.2.1.7 c.58.1.3 PDB: 1pj2_A* 1do8_A* 1pj4_A* 1qr6_A* 1efl_A* 1pjl_A* 1efk_A* 1gz4_A* 1gz3_A* Length = 564 | Back alignment and structure |
|---|
| >1pj3_A NAD-dependent malic enzyme, mitochondrial; oxidative decarboxylase, oxidoreductase; HET: NAD; 2.10A {Homo sapiens} SCOP: c.2.1.7 c.58.1.3 PDB: 1pj2_A* 1do8_A* 1pj4_A* 1qr6_A* 1efl_A* 1pjl_A* 1efk_A* 1gz4_A* 1gz3_A* Length = 564 | Back alignment and structure |
|---|
| >1pj3_A NAD-dependent malic enzyme, mitochondrial; oxidative decarboxylase, oxidoreductase; HET: NAD; 2.10A {Homo sapiens} SCOP: c.2.1.7 c.58.1.3 PDB: 1pj2_A* 1do8_A* 1pj4_A* 1qr6_A* 1efl_A* 1pjl_A* 1efk_A* 1gz4_A* 1gz3_A* Length = 564 | Back alignment and structure |
|---|
| >1pj3_A NAD-dependent malic enzyme, mitochondrial; oxidative decarboxylase, oxidoreductase; HET: NAD; 2.10A {Homo sapiens} SCOP: c.2.1.7 c.58.1.3 PDB: 1pj2_A* 1do8_A* 1pj4_A* 1qr6_A* 1efl_A* 1pjl_A* 1efk_A* 1gz4_A* 1gz3_A* Length = 564 | Back alignment and structure |
|---|
| >1pj3_A NAD-dependent malic enzyme, mitochondrial; oxidative decarboxylase, oxidoreductase; HET: NAD; 2.10A {Homo sapiens} SCOP: c.2.1.7 c.58.1.3 PDB: 1pj2_A* 1do8_A* 1pj4_A* 1qr6_A* 1efl_A* 1pjl_A* 1efk_A* 1gz4_A* 1gz3_A* Length = 564 | Back alignment and structure |
|---|
| >1pj3_A NAD-dependent malic enzyme, mitochondrial; oxidative decarboxylase, oxidoreductase; HET: NAD; 2.10A {Homo sapiens} SCOP: c.2.1.7 c.58.1.3 PDB: 1pj2_A* 1do8_A* 1pj4_A* 1qr6_A* 1efl_A* 1pjl_A* 1efk_A* 1gz4_A* 1gz3_A* Length = 564 | Back alignment and structure |
|---|
| >1pj3_A NAD-dependent malic enzyme, mitochondrial; oxidative decarboxylase, oxidoreductase; HET: NAD; 2.10A {Homo sapiens} SCOP: c.2.1.7 c.58.1.3 PDB: 1pj2_A* 1do8_A* 1pj4_A* 1qr6_A* 1efl_A* 1pjl_A* 1efk_A* 1gz4_A* 1gz3_A* Length = 564 | Back alignment and structure |
|---|
| >1pj3_A NAD-dependent malic enzyme, mitochondrial; oxidative decarboxylase, oxidoreductase; HET: NAD; 2.10A {Homo sapiens} SCOP: c.2.1.7 c.58.1.3 PDB: 1pj2_A* 1do8_A* 1pj4_A* 1qr6_A* 1efl_A* 1pjl_A* 1efk_A* 1gz4_A* 1gz3_A* Length = 564 | Back alignment and structure |
|---|
| >1gq2_A Malic enzyme; oxidoreductase, pigeon liver, NADP-dependent, NAD-NADP selectivity, decarboxylase, malate, Mn2+; HET: NAP; 2.5A {Columba livia} SCOP: c.2.1.7 c.58.1.3 PDB: 2aw5_A Length = 555 | Back alignment and structure |
|---|
| >1gq2_A Malic enzyme; oxidoreductase, pigeon liver, NADP-dependent, NAD-NADP selectivity, decarboxylase, malate, Mn2+; HET: NAP; 2.5A {Columba livia} SCOP: c.2.1.7 c.58.1.3 PDB: 2aw5_A Length = 555 | Back alignment and structure |
|---|
| >1gq2_A Malic enzyme; oxidoreductase, pigeon liver, NADP-dependent, NAD-NADP selectivity, decarboxylase, malate, Mn2+; HET: NAP; 2.5A {Columba livia} SCOP: c.2.1.7 c.58.1.3 PDB: 2aw5_A Length = 555 | Back alignment and structure |
|---|
| >1gq2_A Malic enzyme; oxidoreductase, pigeon liver, NADP-dependent, NAD-NADP selectivity, decarboxylase, malate, Mn2+; HET: NAP; 2.5A {Columba livia} SCOP: c.2.1.7 c.58.1.3 PDB: 2aw5_A Length = 555 | Back alignment and structure |
|---|
| >1gq2_A Malic enzyme; oxidoreductase, pigeon liver, NADP-dependent, NAD-NADP selectivity, decarboxylase, malate, Mn2+; HET: NAP; 2.5A {Columba livia} SCOP: c.2.1.7 c.58.1.3 PDB: 2aw5_A Length = 555 | Back alignment and structure |
|---|
| >1gq2_A Malic enzyme; oxidoreductase, pigeon liver, NADP-dependent, NAD-NADP selectivity, decarboxylase, malate, Mn2+; HET: NAP; 2.5A {Columba livia} SCOP: c.2.1.7 c.58.1.3 PDB: 2aw5_A Length = 555 | Back alignment and structure |
|---|
| >1gq2_A Malic enzyme; oxidoreductase, pigeon liver, NADP-dependent, NAD-NADP selectivity, decarboxylase, malate, Mn2+; HET: NAP; 2.5A {Columba livia} SCOP: c.2.1.7 c.58.1.3 PDB: 2aw5_A Length = 555 | Back alignment and structure |
|---|
| >1gq2_A Malic enzyme; oxidoreductase, pigeon liver, NADP-dependent, NAD-NADP selectivity, decarboxylase, malate, Mn2+; HET: NAP; 2.5A {Columba livia} SCOP: c.2.1.7 c.58.1.3 PDB: 2aw5_A Length = 555 | Back alignment and structure |
|---|
| >1gq2_A Malic enzyme; oxidoreductase, pigeon liver, NADP-dependent, NAD-NADP selectivity, decarboxylase, malate, Mn2+; HET: NAP; 2.5A {Columba livia} SCOP: c.2.1.7 c.58.1.3 PDB: 2aw5_A Length = 555 | Back alignment and structure |
|---|
| >1gq2_A Malic enzyme; oxidoreductase, pigeon liver, NADP-dependent, NAD-NADP selectivity, decarboxylase, malate, Mn2+; HET: NAP; 2.5A {Columba livia} SCOP: c.2.1.7 c.58.1.3 PDB: 2aw5_A Length = 555 | Back alignment and structure |
|---|
| >1o0s_A NAD-ME, NAD-dependent malic enzyme; oxidoreductase, oxidative decarboxylase, rossmann fold, MAla dehydrogenase; HET: NAI; 2.00A {Ascaris suum} SCOP: c.2.1.7 c.58.1.3 PDB: 1llq_A* Length = 605 | Back alignment and structure |
|---|
| >1o0s_A NAD-ME, NAD-dependent malic enzyme; oxidoreductase, oxidative decarboxylase, rossmann fold, MAla dehydrogenase; HET: NAI; 2.00A {Ascaris suum} SCOP: c.2.1.7 c.58.1.3 PDB: 1llq_A* Length = 605 | Back alignment and structure |
|---|
| >1o0s_A NAD-ME, NAD-dependent malic enzyme; oxidoreductase, oxidative decarboxylase, rossmann fold, MAla dehydrogenase; HET: NAI; 2.00A {Ascaris suum} SCOP: c.2.1.7 c.58.1.3 PDB: 1llq_A* Length = 605 | Back alignment and structure |
|---|
| >1o0s_A NAD-ME, NAD-dependent malic enzyme; oxidoreductase, oxidative decarboxylase, rossmann fold, MAla dehydrogenase; HET: NAI; 2.00A {Ascaris suum} SCOP: c.2.1.7 c.58.1.3 PDB: 1llq_A* Length = 605 | Back alignment and structure |
|---|
| >1o0s_A NAD-ME, NAD-dependent malic enzyme; oxidoreductase, oxidative decarboxylase, rossmann fold, MAla dehydrogenase; HET: NAI; 2.00A {Ascaris suum} SCOP: c.2.1.7 c.58.1.3 PDB: 1llq_A* Length = 605 | Back alignment and structure |
|---|
| >1o0s_A NAD-ME, NAD-dependent malic enzyme; oxidoreductase, oxidative decarboxylase, rossmann fold, MAla dehydrogenase; HET: NAI; 2.00A {Ascaris suum} SCOP: c.2.1.7 c.58.1.3 PDB: 1llq_A* Length = 605 | Back alignment and structure |
|---|
| >1o0s_A NAD-ME, NAD-dependent malic enzyme; oxidoreductase, oxidative decarboxylase, rossmann fold, MAla dehydrogenase; HET: NAI; 2.00A {Ascaris suum} SCOP: c.2.1.7 c.58.1.3 PDB: 1llq_A* Length = 605 | Back alignment and structure |
|---|
| >1o0s_A NAD-ME, NAD-dependent malic enzyme; oxidoreductase, oxidative decarboxylase, rossmann fold, MAla dehydrogenase; HET: NAI; 2.00A {Ascaris suum} SCOP: c.2.1.7 c.58.1.3 PDB: 1llq_A* Length = 605 | Back alignment and structure |
|---|
| >1o0s_A NAD-ME, NAD-dependent malic enzyme; oxidoreductase, oxidative decarboxylase, rossmann fold, MAla dehydrogenase; HET: NAI; 2.00A {Ascaris suum} SCOP: c.2.1.7 c.58.1.3 PDB: 1llq_A* Length = 605 | Back alignment and structure |
|---|
| >3nv9_A Malic enzyme; rossmann fold, oxidoreductase; 2.25A {Entamoeba histolytica} Length = 487 | Back alignment and structure |
|---|
| >3nv9_A Malic enzyme; rossmann fold, oxidoreductase; 2.25A {Entamoeba histolytica} Length = 487 | Back alignment and structure |
|---|
| >3nv9_A Malic enzyme; rossmann fold, oxidoreductase; 2.25A {Entamoeba histolytica} Length = 487 | Back alignment and structure |
|---|
| >3nv9_A Malic enzyme; rossmann fold, oxidoreductase; 2.25A {Entamoeba histolytica} Length = 487 | Back alignment and structure |
|---|
| >2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Length = 398 | Back alignment and structure |
|---|
| >2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Length = 398 | Back alignment and structure |
|---|
| >2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Length = 398 | Back alignment and structure |
|---|
| >2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Length = 398 | Back alignment and structure |
|---|
| >2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Length = 439 | Back alignment and structure |
|---|
| >2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Length = 439 | Back alignment and structure |
|---|
| >1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Length = 388 | Back alignment and structure |
|---|
| >1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Length = 388 | Back alignment and structure |
|---|
| >1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Length = 388 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 848 | |||
| 1pj3_A | 564 | NAD-dependent malic enzyme, mitochondrial; oxidati | 100.0 | |
| 1gq2_A | 555 | Malic enzyme; oxidoreductase, pigeon liver, NADP-d | 100.0 | |
| 1o0s_A | 605 | NAD-ME, NAD-dependent malic enzyme; oxidoreductase | 100.0 | |
| 1o0s_A | 605 | NAD-ME, NAD-dependent malic enzyme; oxidoreductase | 100.0 | |
| 1gq2_A | 555 | Malic enzyme; oxidoreductase, pigeon liver, NADP-d | 100.0 | |
| 1pj3_A | 564 | NAD-dependent malic enzyme, mitochondrial; oxidati | 100.0 | |
| 3nv9_A | 487 | Malic enzyme; rossmann fold, oxidoreductase; 2.25A | 100.0 | |
| 3nv9_A | 487 | Malic enzyme; rossmann fold, oxidoreductase; 2.25A | 100.0 | |
| 2a9f_A | 398 | Putative malic enzyme ((S)-malate:NAD+ oxidoreduct | 100.0 | |
| 1vl6_A | 388 | Malate oxidoreductase; TM0542, NAD-dependent malic | 100.0 | |
| 2a9f_A | 398 | Putative malic enzyme ((S)-malate:NAD+ oxidoreduct | 100.0 | |
| 1vl6_A | 388 | Malate oxidoreductase; TM0542, NAD-dependent malic | 100.0 | |
| 2dvm_A | 439 | Malic enzyme, 439AA long hypothetical malate oxido | 100.0 | |
| 2dvm_A | 439 | Malic enzyme, 439AA long hypothetical malate oxido | 99.98 | |
| 3gvp_A | 435 | Adenosylhomocysteinase 3; protein CO-factor comple | 97.27 | |
| 3h9u_A | 436 | Adenosylhomocysteinase; NAD CO-factor complex, str | 97.14 | |
| 3gvp_A | 435 | Adenosylhomocysteinase 3; protein CO-factor comple | 97.12 | |
| 3h9u_A | 436 | Adenosylhomocysteinase; NAD CO-factor complex, str | 96.76 | |
| 4dio_A | 405 | NAD(P) transhydrogenase subunit alpha PART 1; stru | 96.33 | |
| 4fcc_A | 450 | Glutamate dehydrogenase; protein complex, rossmann | 95.96 | |
| 1x13_A | 401 | NAD(P) transhydrogenase subunit alpha; NAD(H)-bind | 95.85 | |
| 3k92_A | 424 | NAD-GDH, NAD-specific glutamate dehydrogenase; ROC | 95.8 | |
| 3ond_A | 488 | Adenosylhomocysteinase; plant protein, enzyme-subs | 95.41 | |
| 3aoe_E | 419 | Glutamate dehydrogenase; rossmann fold, NADH, oxid | 95.38 | |
| 3ef6_A | 410 | Toluene 1,2-dioxygenase system ferredoxin--NAD(+) | 95.27 | |
| 2bma_A | 470 | Glutamate dehydrogenase (NADP+); malaria, drug des | 95.09 | |
| 3klj_A | 385 | NAD(FAD)-dependent dehydrogenase, NIRB-family (N- | 94.99 | |
| 3p2y_A | 381 | Alanine dehydrogenase/pyridine nucleotide transhy; | 94.92 | |
| 3kd9_A | 449 | Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o | 94.57 | |
| 3n58_A | 464 | Adenosylhomocysteinase; ssgcid, hydrolase, structu | 93.97 | |
| 2yfq_A | 421 | Padgh, NAD-GDH, NAD-specific glutamate dehydrogena | 93.87 | |
| 4dio_A | 405 | NAD(P) transhydrogenase subunit alpha PART 1; stru | 93.75 | |
| 3r3j_A | 456 | Glutamate dehydrogenase; rossman fold, oxidoreduct | 93.74 | |
| 1v9l_A | 421 | Glutamate dehydrogenase; protein-NAD complex, oxid | 93.32 | |
| 3aog_A | 440 | Glutamate dehydrogenase; NAD(H), oxidoreducta; HET | 92.98 | |
| 2tmg_A | 415 | Protein (glutamate dehydrogenase); metabolic role, | 92.86 | |
| 3kkj_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 92.7 | |
| 3jyo_A | 283 | Quinate/shikimate dehydrogenase; enzyme-cofactor c | 91.56 | |
| 3mw9_A | 501 | GDH 1, glutamate dehydrogenase 1; allostery, inhib | 91.39 | |
| 3t4e_A | 312 | Quinate/shikimate dehydrogenase; structural genomi | 90.98 | |
| 3tnl_A | 315 | Shikimate dehydrogenase; structural genomics, cent | 90.88 | |
| 3pwz_A | 272 | Shikimate dehydrogenase 3; alpha-beta, oxidoreduct | 90.88 | |
| 3o8q_A | 281 | Shikimate 5-dehydrogenase I alpha; structural geno | 90.85 | |
| 3fbt_A | 282 | Chorismate mutase and shikimate 5-dehydrogenase fu | 90.77 | |
| 3don_A | 277 | Shikimate dehydrogenase; alpha-beta structure, ros | 90.6 | |
| 3n58_A | 464 | Adenosylhomocysteinase; ssgcid, hydrolase, structu | 90.47 | |
| 1bgv_A | 449 | Glutamate dehydrogenase; oxidoreductase; HET: GLU; | 90.28 | |
| 3tum_A | 269 | Shikimate dehydrogenase family protein; rossmann-f | 89.78 | |
| 3ond_A | 488 | Adenosylhomocysteinase; plant protein, enzyme-subs | 89.62 | |
| 3don_A | 277 | Shikimate dehydrogenase; alpha-beta structure, ros | 89.0 | |
| 2egg_A | 297 | AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff | 88.7 | |
| 2hk9_A | 275 | Shikimate dehydrogenase; shikimate pathway, drug d | 88.17 | |
| 3k92_A | 424 | NAD-GDH, NAD-specific glutamate dehydrogenase; ROC | 87.3 | |
| 1nyt_A | 271 | Shikimate 5-dehydrogenase; alpha/beta domains, WID | 87.01 | |
| 2jae_A | 489 | L-amino acid oxidase; oxidoreductase, dimerisation | 86.08 | |
| 1p77_A | 272 | Shikimate 5-dehydrogenase; NADPH, oxidoreductase; | 86.04 | |
| 2d5c_A | 263 | AROE, shikimate 5-dehydrogenase; substrate, dimer, | 85.94 | |
| 3d4o_A | 293 | Dipicolinate synthase subunit A; NP_243269.1, stru | 85.81 | |
| 3p2o_A | 285 | Bifunctional protein fold; structural genomics, ce | 85.29 | |
| 1nvt_A | 287 | Shikimate 5'-dehydrogenase; structural genomics, P | 84.81 | |
| 3l07_A | 285 | Bifunctional protein fold; structural genomics, ID | 84.35 | |
| 3vrd_B | 401 | FCCB subunit, flavocytochrome C flavin subunit; su | 83.97 | |
| 3kkj_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 83.81 | |
| 4a9w_A | 357 | Monooxygenase; baeyer-villiger, FAD, oxidoreductas | 83.46 | |
| 3u62_A | 253 | Shikimate dehydrogenase; shikimate pathway, oxidor | 83.43 | |
| 1a4i_A | 301 | Methylenetetrahydrofolate dehydrogenase / methenyl | 83.38 | |
| 4hb9_A | 412 | Similarities with probable monooxygenase; flavin, | 83.21 | |
| 3fbt_A | 282 | Chorismate mutase and shikimate 5-dehydrogenase fu | 82.8 | |
| 2hk9_A | 275 | Shikimate dehydrogenase; shikimate pathway, drug d | 82.77 | |
| 3d1c_A | 369 | Flavin-containing putative monooxygenase; NP_37310 | 82.48 | |
| 3pwz_A | 272 | Shikimate dehydrogenase 3; alpha-beta, oxidoreduct | 81.85 | |
| 1npy_A | 271 | Hypothetical shikimate 5-dehydrogenase-like protei | 81.72 | |
| 4a26_A | 300 | Putative C-1-tetrahydrofolate synthase, cytoplasm; | 81.6 | |
| 3o8q_A | 281 | Shikimate 5-dehydrogenase I alpha; structural geno | 81.53 | |
| 3f8d_A | 323 | Thioredoxin reductase (TRXB-3); redox protein, nuc | 81.41 | |
| 3h8v_A | 292 | Ubiquitin-like modifier-activating enzyme 5; rossm | 81.4 | |
| 1gtm_A | 419 | Glutamate dehydrogenase; oxidoreductase, NAD, NADP | 81.37 | |
| 3t4e_A | 312 | Quinate/shikimate dehydrogenase; structural genomi | 81.06 | |
| 3tnl_A | 315 | Shikimate dehydrogenase; structural genomics, cent | 81.01 | |
| 3jyo_A | 283 | Quinate/shikimate dehydrogenase; enzyme-cofactor c | 80.85 | |
| 3fbs_A | 297 | Oxidoreductase; structural genomics, PSI2, MCSG, p | 80.43 | |
| 1lu9_A | 287 | Methylene tetrahydromethanopterin dehydrogenase; a | 80.39 | |
| 1edz_A | 320 | 5,10-methylenetetrahydrofolate dehydrogenase; nucl | 80.29 | |
| 1l7d_A | 384 | Nicotinamide nucleotide transhydrogenase, subunit | 80.11 |
| >1pj3_A NAD-dependent malic enzyme, mitochondrial; oxidative decarboxylase, oxidoreductase; HET: NAD; 2.10A {Homo sapiens} SCOP: c.2.1.7 c.58.1.3 PDB: 1pj2_A* 1do8_A* 1pj4_A* 1qr6_A* 1efl_A* 1pjl_A* 1efk_A* 1gz4_A* 1gz3_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1.5e-103 Score=886.02 Aligned_cols=358 Identities=48% Similarity=0.860 Sum_probs=335.3
Q ss_pred Ccchhhh-hhhccccccHHHHhhhcccccCcccccchhHHHHHhhccccccCCChhhHHHHHHhhcccceeEEEeccCce
Q psy14377 308 PVKNLAD-VVKTGMAFSIEERQALGIHGLLPAAVKSQDEQLHLCKLNVDRYEDPLNKYIYLQALAVKTDIRAIVVTDGER 386 (848)
Q Consensus 308 ~~~~l~~-~~n~g~~~~~~er~~~~~~G~~p~~v~~~~~q~~~~~~~~~~~~~~~~~~~~L~~l~~~~~~~~~~~~d~~~ 386 (848)
+...|++ .+|||++||.+||+++|++|||||.|+|+|+|++||+.++++++++++||+||.+++++ |++
T Consensus 5 G~~lL~~p~~NKGtAFt~~ER~~l~l~GLLPp~v~t~e~Q~~r~~~~~~~~~~~l~k~~~L~~L~~~----------Ne~ 74 (564)
T 1pj3_A 5 GKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQER----------NEK 74 (564)
T ss_dssp STHHHHSTTTCCGGGSCHHHHHHTTCTTTSCSCCCCHHHHHHHHHHHHHHCCSHHHHHHHHHHHHTT----------CHH
T ss_pred hHHHhCCCcccCCCCCCHHHHHhCCCCcCCCCCcCCHHHHHHHHHHHHhcCCCcHHHHHHHHHhhcc----------cce
Confidence 4566777 88999999999999999999999999999999999999999999999999999999998 776
Q ss_pred ecccccCCCCCCCcccccccHHHHHcCCCcCccCceeeEEccccccccCCCCCCCHHHHHHHHhcCCCceEEecCCCCCc
Q psy14377 387 ILGLGDLGAYGMGIPVGKLSLYTALAGIKPHQCLPITLDVGTNWRRAAAIPQVFTADILKDMAAFNKRPIIFALSNPTSK 466 (848)
Q Consensus 387 l~g~~~~g~~~~~~~~g~~~L~~al~g~kP~~~~~~~v~iG~~~~~~S~~~g~FTeevvk~Ma~~~~rPIIFaLSNPt~~ 466 (848)
|
T Consensus 75 L------------------------------------------------------------------------------- 75 (564)
T 1pj3_A 75 L------------------------------------------------------------------------------- 75 (564)
T ss_dssp H-------------------------------------------------------------------------------
T ss_pred e-------------------------------------------------------------------------------
Confidence 6
Q ss_pred cCCCHHHHhccCCCcEEEEeCCCCCCcccCCeEEecccchhhccCCeEecchhhhHHHhhccccccCccceeeccCcccH
Q psy14377 467 AECTAEQAYVNTDGRGVFASGSPFDPVTYKGKTFTPGQEYVVELMPIVYTPTVGLACQKYGLIFRRPRGLFISIHDKGHI 546 (848)
Q Consensus 467 ~E~tpe~a~~~T~G~ai~AtGsPf~pv~y~g~~~~~~q~nn~e~lPvvYTPGVG~acl~~~~i~r~p~gm~L~~~d~g~i 546 (848)
||+ +.+.|..++||++||||||++|+.++.+|++|+|||+|++|++++
T Consensus 76 ---------------------------fy~-----ll~~~~~e~lpivYTP~Vg~ac~~~s~i~~~p~g~ylsi~d~~~i 123 (564)
T 1pj3_A 76 ---------------------------FYR-----ILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHV 123 (564)
T ss_dssp ---------------------------HHH-----HHHHCHHHHHHHHSTTHHHHHHHTHHHHCSSCCSEEEEGGGTTCH
T ss_pred ---------------------------ehh-----hhhhCHHHhCCeeeCccHHHHHHHHHHHhcCcccccccccCHHHH
Confidence 555 778999999999999999999999999999999999999999999
Q ss_pred HHHHhcCCCCCccEEEEecCceeeccCCCCCCCCCccccceeeeeecCCCCCCceeeEEeeccCCcccccCCcccccccc
Q psy14377 547 SEVLRNWPETDIRAIVVTDGERILGLGDLGAYGMGIPVGKLSLYTALAGIKPHQCLPITLDVGTNTQQLLDDPLYIGLRQ 626 (848)
Q Consensus 547 ~eiL~Nwp~~d~~viVVTDG~rILGLGDlG~~gmgIpvGKl~Ly~a~aGI~p~~~LPv~LDvGTnn~~ll~Dp~y~g~r~ 626 (848)
+++|+||+.+++++||||||||||||||+|++||+|||||++|||+||||||++|||||||+|||||+||+||+|+|+||
T Consensus 124 ~~~l~n~~~~~v~v~VVTDG~~ILGLGD~G~~gm~ipvGKl~Ly~~~aGIdP~~~lPI~lDvgTnn~~LL~DPlYlG~r~ 203 (564)
T 1pj3_A 124 RSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQ 203 (564)
T ss_dssp HHHHTTCSCSCCCEEEEECSSSCTTSCCCGGGGGHHHHHHHHHHHHHHCCCGGGEEEEEEESCCCCTTGGGCTTCCSCSS
T ss_pred HHHHHhCCCCCceEEEEEcccccccCCCCCCCcccceehHHHHHHhccCCChhheeeeEeecCcCchhhccCCcccCcCC
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cCCCCcchhHHHHHHHHHHHHhhCCceeeeeecCCCcchHHHHHHHcccCceeccCCchHHHHHHHHHHHHHhhhCCcCC
Q psy14377 627 RRTTGQAYDDFIEEFMQAVVARYGQHVLIQFEDFANHSAFRFLDTYRNRYCVFNDDIQGTASVAVAGLLASLRITKTRLS 706 (848)
Q Consensus 627 ~R~~g~~y~~fvdefv~av~~~fGp~~~IqfEDf~~~naf~lL~ryr~~~~~FnDDiQGTaaV~LAgllaAlr~t~~~l~ 706 (848)
+|++|++|++|+||||++++++|||+++||||||++||||++|+|||++||||||||||||+|+||||+||+|++|++|+
T Consensus 204 ~Rv~g~eYd~fvdefv~av~~~fG~~~~I~~EDf~~~~af~il~ryr~~ipvFnDDiqGTa~V~lAgllnAlki~gk~l~ 283 (564)
T 1pj3_A 204 KRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPIS 283 (564)
T ss_dssp CCCCSHHHHHHHHHHHHHHHHHHCTTCEEEECSCCHHHHHHHHHHHTTTSSEEEHHHHHHHHHHHHHHHHHHHHHCCCGG
T ss_pred CCCchhhHHHHHHHHHHHHHHHcCCCcEEeehhcCCccHHHHHHHhccCCCEeCCCCchHHHHHHHHHHHHHHHhCCcHh
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CceEEecCcchhhHHHHHHHHHHHhcc----------ccccccc-CceecCCCCCCchH-HHhhhccccc---hhhcccc
Q psy14377 707 DNTILFQGAGEGTASVAVAGLLASLRI----------TKTRLSD-NTILFQGAGEGTAS-VAIAGLLASL---RITKTRL 771 (848)
Q Consensus 707 d~riv~~GAG~A~~g~giA~ll~~~~~----------~~~~~~d-~g~i~~~r~~~~~~-~~~~~~~~~~---r~~~~~~ 771 (848)
||||||+|||+| |+|||+||+++|+ ++..++| +|+|+++|+++++. +...+..++. ++|++++
T Consensus 284 d~riv~~GAGaA--gigia~ll~~~m~~~Gl~~eeA~~~i~~~D~~Gli~~~r~~~l~~~k~~~A~~~~~~~~~~L~eav 361 (564)
T 1pj3_A 284 EHKILFLGAGEA--ALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAV 361 (564)
T ss_dssp GCCEEEECCSHH--HHHHHHHHHHHHHHTTCCHHHHHHTEEEEETTEECBTTCSSCCCTTTGGGCBCCCSSCCSSHHHHH
T ss_pred HcEEEEeCCCHH--HHHHHHHHHHHHHHcCCChHHhhCcEEEEeCCCeEECCCcccchHHHHHHHHhcCccccCCHHHHH
Confidence 999999999999 9999999998433 3456889 99999999556665 5555666654 7899999
Q ss_pred C--CCceEEeecC-CCcchh
Q psy14377 772 S--DNTILFQGSG-EGTASV 788 (848)
Q Consensus 772 ~--~~~~~~~~s~-~~~~~~ 788 (848)
+ ++|+|+|+|+ .|+-+-
T Consensus 362 ~~vkp~vlIG~S~~~g~ft~ 381 (564)
T 1pj3_A 362 NILKPSTIIGVAGAGRLFTP 381 (564)
T ss_dssp HHHCCSEEEECCCSSCCSCH
T ss_pred hhcCCCEEEEeCCCCCCCCH
Confidence 9 6999999997 566543
|
| >1gq2_A Malic enzyme; oxidoreductase, pigeon liver, NADP-dependent, NAD-NADP selectivity, decarboxylase, malate, Mn2+; HET: NAP; 2.5A {Columba livia} SCOP: c.2.1.7 c.58.1.3 PDB: 2aw5_A | Back alignment and structure |
|---|
| >1o0s_A NAD-ME, NAD-dependent malic enzyme; oxidoreductase, oxidative decarboxylase, rossmann fold, MAla dehydrogenase; HET: NAI; 2.00A {Ascaris suum} SCOP: c.2.1.7 c.58.1.3 PDB: 1llq_A* | Back alignment and structure |
|---|
| >1o0s_A NAD-ME, NAD-dependent malic enzyme; oxidoreductase, oxidative decarboxylase, rossmann fold, MAla dehydrogenase; HET: NAI; 2.00A {Ascaris suum} SCOP: c.2.1.7 c.58.1.3 PDB: 1llq_A* | Back alignment and structure |
|---|
| >1gq2_A Malic enzyme; oxidoreductase, pigeon liver, NADP-dependent, NAD-NADP selectivity, decarboxylase, malate, Mn2+; HET: NAP; 2.5A {Columba livia} SCOP: c.2.1.7 c.58.1.3 PDB: 2aw5_A | Back alignment and structure |
|---|
| >1pj3_A NAD-dependent malic enzyme, mitochondrial; oxidative decarboxylase, oxidoreductase; HET: NAD; 2.10A {Homo sapiens} SCOP: c.2.1.7 c.58.1.3 PDB: 1pj2_A* 1do8_A* 1pj4_A* 1qr6_A* 1efl_A* 1pjl_A* 1efk_A* 1gz4_A* 1gz3_A* | Back alignment and structure |
|---|
| >3nv9_A Malic enzyme; rossmann fold, oxidoreductase; 2.25A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >3nv9_A Malic enzyme; rossmann fold, oxidoreductase; 2.25A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* | Back alignment and structure |
|---|
| >2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* | Back alignment and structure |
|---|
| >2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* | Back alignment and structure |
|---|
| >2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* | Back alignment and structure |
|---|
| >3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* | Back alignment and structure |
|---|
| >3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* | Back alignment and structure |
|---|
| >3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* | Back alignment and structure |
|---|
| >3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* | Back alignment and structure |
|---|
| >4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4fcc_A Glutamate dehydrogenase; protein complex, rossmann fold, metabolic role, NAD, NADP, oxidoreductase; 2.00A {Escherichia coli O157} PDB: 4fhn_X 2yfg_A 3sbo_A 2yfg_E | Back alignment and structure |
|---|
| >1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* | Back alignment and structure |
|---|
| >3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A | Back alignment and structure |
|---|
| >3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* | Back alignment and structure |
|---|
| >3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* | Back alignment and structure |
|---|
| >2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} | Back alignment and structure |
|---|
| >3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >2yfq_A Padgh, NAD-GDH, NAD-specific glutamate dehydrogenase; oxidoreductase; 2.94A {Peptoniphilus asaccharolyticus} | Back alignment and structure |
|---|
| >4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3r3j_A Glutamate dehydrogenase; rossman fold, oxidoreductase, apicoplast; 3.10A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 | Back alignment and structure |
|---|
| >3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A | Back alignment and structure |
|---|
| >2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A | Back alignment and structure |
|---|
| >3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A | Back alignment and structure |
|---|
| >3mw9_A GDH 1, glutamate dehydrogenase 1; allostery, inhibition, oxidoreducta; HET: GLU GTP NAD; 2.40A {Bos taurus} SCOP: c.2.1.7 c.58.1.1 PDB: 3mvo_A* 3mvq_A* 3qmu_A* 3etd_A* 3ete_A* 3etg_A* 1l1f_A 1nr1_A 1nr7_A 1nqt_A 1hwx_A* 1hwy_A* 1hwz_A* | Back alignment and structure |
|---|
| >3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* | Back alignment and structure |
|---|
| >3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* | Back alignment and structure |
|---|
| >3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* | Back alignment and structure |
|---|
| >3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* | Back alignment and structure |
|---|
| >3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >1bgv_A Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1.90A {Clostridium symbiosum} SCOP: c.2.1.7 c.58.1.1 PDB: 1hrd_A 1k89_A 1aup_A 2yfh_A | Back alignment and structure |
|---|
| >3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* | Back alignment and structure |
|---|
| >3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* | Back alignment and structure |
|---|
| >2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A | Back alignment and structure |
|---|
| >3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A | Back alignment and structure |
|---|
| >1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* | Back alignment and structure |
|---|
| >1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* | Back alignment and structure |
|---|
| >2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* | Back alignment and structure |
|---|
| >3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} | Back alignment and structure |
|---|
| >3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* | Back alignment and structure |
|---|
| >3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* | Back alignment and structure |
|---|
| >4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} | Back alignment and structure |
|---|
| >3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A | Back alignment and structure |
|---|
| >3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} | Back alignment and structure |
|---|
| >1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} | Back alignment and structure |
|---|
| >3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* | Back alignment and structure |
|---|
| >3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* | Back alignment and structure |
|---|
| >3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* | Back alignment and structure |
|---|
| >1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A | Back alignment and structure |
|---|
| >3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* | Back alignment and structure |
|---|
| >3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* | Back alignment and structure |
|---|
| >3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A | Back alignment and structure |
|---|
| >3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* | Back alignment and structure |
|---|
| >1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* | Back alignment and structure |
|---|
| >1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 848 | ||||
| d1gq2a2 | 257 | c.58.1.3 (A:23-279) Mitochondrial NAD(P)-dependent | 3e-96 | |
| d1gq2a2 | 257 | c.58.1.3 (A:23-279) Mitochondrial NAD(P)-dependent | 2e-27 | |
| d1gq2a2 | 257 | c.58.1.3 (A:23-279) Mitochondrial NAD(P)-dependent | 2e-10 | |
| d1o0sa2 | 294 | c.58.1.3 (A:2-295) Mitochondrial NAD(P)-dependent | 6e-95 | |
| d1o0sa2 | 294 | c.58.1.3 (A:2-295) Mitochondrial NAD(P)-dependent | 9e-29 | |
| d1o0sa2 | 294 | c.58.1.3 (A:2-295) Mitochondrial NAD(P)-dependent | 2e-10 | |
| d1pj3a2 | 259 | c.58.1.3 (A:21-279) Mitochondrial NAD(P)-dependent | 5e-94 | |
| d1pj3a2 | 259 | c.58.1.3 (A:21-279) Mitochondrial NAD(P)-dependent | 3e-20 | |
| d1pj3a2 | 259 | c.58.1.3 (A:21-279) Mitochondrial NAD(P)-dependent | 1e-17 | |
| d1pj3a2 | 259 | c.58.1.3 (A:21-279) Mitochondrial NAD(P)-dependent | 1e-10 | |
| d1o0sa1 | 308 | c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent | 3e-22 | |
| d1o0sa1 | 308 | c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent | 1e-20 | |
| d1o0sa1 | 308 | c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent | 8e-16 | |
| d1o0sa1 | 308 | c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent | 2e-12 | |
| d1o0sa1 | 308 | c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent | 6e-11 | |
| d1o0sa1 | 308 | c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent | 2e-09 | |
| d1o0sa1 | 308 | c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent | 2e-07 | |
| d1o0sa1 | 308 | c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent | 2e-06 | |
| d1gq2a1 | 298 | c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent | 1e-20 | |
| d1gq2a1 | 298 | c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent | 3e-20 | |
| d1gq2a1 | 298 | c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent | 1e-13 | |
| d1gq2a1 | 298 | c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent | 3e-12 | |
| d1gq2a1 | 298 | c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent | 9e-11 | |
| d1gq2a1 | 298 | c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent | 2e-09 | |
| d1gq2a1 | 298 | c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent | 3e-07 | |
| d1gq2a1 | 298 | c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent | 2e-06 | |
| d1pj3a1 | 294 | c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent | 9e-20 | |
| d1pj3a1 | 294 | c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent | 2e-19 | |
| d1pj3a1 | 294 | c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent | 2e-13 | |
| d1pj3a1 | 294 | c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent | 5e-11 | |
| d1pj3a1 | 294 | c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent | 1e-10 | |
| d1pj3a1 | 294 | c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent | 2e-09 | |
| d1pj3a1 | 294 | c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent | 2e-07 | |
| d1pj3a1 | 294 | c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent | 2e-06 | |
| d1vl6a1 | 222 | c.2.1.7 (A:155-376) Malate oxidoreductase (malic e | 2e-13 | |
| d1vl6a1 | 222 | c.2.1.7 (A:155-376) Malate oxidoreductase (malic e | 2e-12 | |
| d1vl6a1 | 222 | c.2.1.7 (A:155-376) Malate oxidoreductase (malic e | 4e-11 | |
| d1vl6a1 | 222 | c.2.1.7 (A:155-376) Malate oxidoreductase (malic e | 5e-09 | |
| d1vl6a1 | 222 | c.2.1.7 (A:155-376) Malate oxidoreductase (malic e | 3e-07 | |
| d1vl6a1 | 222 | c.2.1.7 (A:155-376) Malate oxidoreductase (malic e | 4e-07 | |
| d1vl6a1 | 222 | c.2.1.7 (A:155-376) Malate oxidoreductase (malic e | 3e-04 | |
| d1vl6a2 | 154 | c.58.1.3 (A:1-154) Malate oxidoreductase (malic en | 2e-04 |
| >d1gq2a2 c.58.1.3 (A:23-279) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} Length = 257 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Aminoacid dehydrogenase-like, N-terminal domain superfamily: Aminoacid dehydrogenase-like, N-terminal domain family: Malic enzyme N-domain domain: Mitochondrial NAD(P)-dependent malic enzyme species: Domestic pigeon (Columba livia) [TaxId: 8932]
Score = 299 bits (767), Expect = 3e-96
Identities = 128/179 (71%), Positives = 150/179 (83%)
Query: 504 QEYVVELMPIVYTPTVGLACQKYGLIFRRPRGLFISIHDKGHISEVLRNWPETDIRAIVV 563
+ MPIVYTPTVGLACQ YGL FRRPRGLFI+IHD+GHI+ +L++WPE+ I+AIVV
Sbjct: 79 TSDIERFMPIVYTPTVGLACQHYGLAFRRPRGLFITIHDRGHIATMLQSWPESVIKAIVV 138
Query: 564 TDGERILGLGDLGAYGMGIPVGKLSLYTALAGIKPHQCLPITLDVGTNTQQLLDDPLYIG 623
TDGERILGLGDLG YGMGIPVGKL+LYTA G+KPHQCLP+ LDVGT+ + LL DPLYIG
Sbjct: 139 TDGERILGLGDLGCYGMGIPVGKLALYTACGGVKPHQCLPVMLDVGTDNETLLKDPLYIG 198
Query: 624 LRQRRTTGQAYDDFIEEFMQAVVARYGQHVLIQFEDFANHSAFRFLDTYRNRYCVFNDD 682
LR +R GQAYDD ++EFM+AV +RYG + LIQFEDFAN +AFR L YRN+YC FNDD
Sbjct: 199 LRHKRIRGQAYDDLLDEFMEAVTSRYGMNCLIQFEDFANANAFRLLHKYRNKYCTFNDD 257
|
| >d1gq2a2 c.58.1.3 (A:23-279) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} Length = 257 | Back information, alignment and structure |
|---|
| >d1gq2a2 c.58.1.3 (A:23-279) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} Length = 257 | Back information, alignment and structure |
|---|
| >d1o0sa2 c.58.1.3 (A:2-295) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} Length = 294 | Back information, alignment and structure |
|---|
| >d1o0sa2 c.58.1.3 (A:2-295) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} Length = 294 | Back information, alignment and structure |
|---|
| >d1o0sa2 c.58.1.3 (A:2-295) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} Length = 294 | Back information, alignment and structure |
|---|
| >d1pj3a2 c.58.1.3 (A:21-279) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Length = 259 | Back information, alignment and structure |
|---|
| >d1pj3a2 c.58.1.3 (A:21-279) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Length = 259 | Back information, alignment and structure |
|---|
| >d1pj3a2 c.58.1.3 (A:21-279) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Length = 259 | Back information, alignment and structure |
|---|
| >d1pj3a2 c.58.1.3 (A:21-279) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Length = 259 | Back information, alignment and structure |
|---|
| >d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} Length = 308 | Back information, alignment and structure |
|---|
| >d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} Length = 308 | Back information, alignment and structure |
|---|
| >d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} Length = 308 | Back information, alignment and structure |
|---|
| >d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} Length = 308 | Back information, alignment and structure |
|---|
| >d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} Length = 308 | Back information, alignment and structure |
|---|
| >d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} Length = 308 | Back information, alignment and structure |
|---|
| >d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} Length = 308 | Back information, alignment and structure |
|---|
| >d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} Length = 308 | Back information, alignment and structure |
|---|
| >d1gq2a1 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} Length = 298 | Back information, alignment and structure |
|---|
| >d1gq2a1 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} Length = 298 | Back information, alignment and structure |
|---|
| >d1gq2a1 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} Length = 298 | Back information, alignment and structure |
|---|
| >d1gq2a1 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} Length = 298 | Back information, alignment and structure |
|---|
| >d1gq2a1 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} Length = 298 | Back information, alignment and structure |
|---|
| >d1gq2a1 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} Length = 298 | Back information, alignment and structure |
|---|
| >d1gq2a1 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} Length = 298 | Back information, alignment and structure |
|---|
| >d1gq2a1 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} Length = 298 | Back information, alignment and structure |
|---|
| >d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Length = 294 | Back information, alignment and structure |
|---|
| >d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Length = 294 | Back information, alignment and structure |
|---|
| >d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Length = 294 | Back information, alignment and structure |
|---|
| >d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Length = 294 | Back information, alignment and structure |
|---|
| >d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Length = 294 | Back information, alignment and structure |
|---|
| >d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Length = 294 | Back information, alignment and structure |
|---|
| >d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Length = 294 | Back information, alignment and structure |
|---|
| >d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Length = 294 | Back information, alignment and structure |
|---|
| >d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Length = 222 | Back information, alignment and structure |
|---|
| >d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Length = 222 | Back information, alignment and structure |
|---|
| >d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Length = 222 | Back information, alignment and structure |
|---|
| >d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Length = 222 | Back information, alignment and structure |
|---|
| >d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Length = 222 | Back information, alignment and structure |
|---|
| >d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Length = 222 | Back information, alignment and structure |
|---|
| >d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Length = 222 | Back information, alignment and structure |
|---|
| >d1vl6a2 c.58.1.3 (A:1-154) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Length = 154 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 848 | |||
| d1gq2a2 | 257 | Mitochondrial NAD(P)-dependent malic enzyme {Domes | 100.0 | |
| d1pj3a2 | 259 | Mitochondrial NAD(P)-dependent malic enzyme {Human | 100.0 | |
| d1o0sa2 | 294 | Mitochondrial NAD(P)-dependent malic enzyme {Pig r | 100.0 | |
| d1gq2a1 | 298 | Mitochondrial NAD(P)-dependent malic enzyme {Domes | 100.0 | |
| d1o0sa1 | 308 | Mitochondrial NAD(P)-dependent malic enzyme {Pig r | 100.0 | |
| d1pj3a1 | 294 | Mitochondrial NAD(P)-dependent malic enzyme {Human | 100.0 | |
| d1vl6a1 | 222 | Malate oxidoreductase (malic enzyme) {Thermotoga m | 100.0 | |
| d1gq2a1 | 298 | Mitochondrial NAD(P)-dependent malic enzyme {Domes | 100.0 | |
| d1o0sa1 | 308 | Mitochondrial NAD(P)-dependent malic enzyme {Pig r | 100.0 | |
| d1pj3a1 | 294 | Mitochondrial NAD(P)-dependent malic enzyme {Human | 100.0 | |
| d1vl6a1 | 222 | Malate oxidoreductase (malic enzyme) {Thermotoga m | 100.0 | |
| d1vl6a2 | 154 | Malate oxidoreductase (malic enzyme) {Thermotoga m | 99.95 | |
| d1gq2a2 | 257 | Mitochondrial NAD(P)-dependent malic enzyme {Domes | 99.45 | |
| d1pj3a2 | 259 | Mitochondrial NAD(P)-dependent malic enzyme {Human | 99.4 | |
| d1o0sa2 | 294 | Mitochondrial NAD(P)-dependent malic enzyme {Pig r | 99.4 | |
| d1vl6a2 | 154 | Malate oxidoreductase (malic enzyme) {Thermotoga m | 99.2 | |
| d1gpja2 | 159 | Glutamyl tRNA-reductase middle domain {Archaeon Me | 96.12 | |
| d1vi2a1 | 182 | Putative shikimate dehydrogenase YdiB {Escherichia | 95.01 | |
| d1gpja2 | 159 | Glutamyl tRNA-reductase middle domain {Archaeon Me | 94.77 | |
| d1pjca1 | 168 | L-alanine dehydrogenase {Phormidium lapideum [TaxI | 94.21 | |
| d1b5qa1 | 347 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 93.6 | |
| d1seza1 | 373 | Protoporphyrinogen oxidase {Tobacco (Nicotiana tab | 92.9 | |
| d1b26a1 | 234 | Glutamate dehydrogenase {Thermotoga maritima [TaxI | 92.57 | |
| d1nyta1 | 170 | Shikimate 5-dehydrogenase AroE {Escherichia coli [ | 92.43 | |
| d1gtea4 | 196 | Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su | 91.93 | |
| d2dw4a2 | 449 | Lysine-specific histone demethylase 1, LSD1 {Human | 91.74 | |
| d1cjca2 | 230 | Adrenodoxin reductase of mitochondrial p450 system | 91.61 | |
| d1npya1 | 167 | Shikimate 5-dehydrogenase-like protein HI0607 {Hae | 91.35 | |
| d1p77a1 | 171 | Shikimate 5-dehydrogenase AroE {Haemophilus influe | 90.9 | |
| d2iida1 | 370 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 90.64 | |
| d2voua1 | 265 | Dihydroxypyridine hydroxylase DhpH {Arthrobacter n | 90.52 | |
| d1vi2a1 | 182 | Putative shikimate dehydrogenase YdiB {Escherichia | 90.47 | |
| d1c0pa1 | 268 | D-aminoacid oxidase, N-terminal domain {Rhodotorul | 90.32 | |
| d2ivda1 | 347 | Protoporphyrinogen oxidase {Myxococcus xanthus [Ta | 90.26 | |
| d2jfga1 | 93 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 90.22 | |
| d1l7da1 | 183 | Nicotinamide nucleotide transhydrogenase dI compon | 89.85 | |
| d2gv8a1 | 335 | Flavin-dependent monoxygenase SPBP16F5.08c {Schizo | 89.58 | |
| d1fcda1 | 186 | Flavocytochrome c sulfide dehydrogenase, FCSD, fla | 89.34 | |
| d1nvta1 | 177 | Shikimate 5-dehydrogenase AroE {Archaeon Methanoco | 88.8 | |
| d2bcgg1 | 297 | Guanine nucleotide dissociation inhibitor, GDI {Ba | 88.77 | |
| d2jfga1 | 93 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 88.75 | |
| d1b5qa1 | 347 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 88.35 | |
| d1lqta2 | 239 | Ferredoxin:NADP reductase FprA {Mycobacterium tube | 88.35 | |
| d1w4xa1 | 298 | Phenylacetone monooxygenase {Thermobifida fusca [T | 88.32 | |
| d3c96a1 | 288 | Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: | 88.01 | |
| d2bi7a1 | 314 | UDP-galactopyranose mutase, N-terminal domain {Kle | 87.89 | |
| d1v9la1 | 242 | Glutamate dehydrogenase {Pyrobaculum islandicum [T | 87.54 | |
| d1c0pa1 | 268 | D-aminoacid oxidase, N-terminal domain {Rhodotorul | 86.7 | |
| d1djqa3 | 233 | Trimethylamine dehydrogenase, middle domain {Methy | 86.66 | |
| d1luaa1 | 191 | Methylene-tetrahydromethanopterin dehydrogenase {M | 85.92 | |
| d1d5ta1 | 336 | Guanine nucleotide dissociation inhibitor, GDI {Co | 85.83 | |
| d1bgva1 | 255 | Glutamate dehydrogenase {Clostridium symbiosum [Ta | 85.67 | |
| d1nyta1 | 170 | Shikimate 5-dehydrogenase AroE {Escherichia coli [ | 85.56 | |
| d1bgva1 | 255 | Glutamate dehydrogenase {Clostridium symbiosum [Ta | 85.3 | |
| d1jw9b_ | 247 | Molybdenum cofactor biosynthesis protein MoeB {Esc | 84.77 | |
| d1nhpa1 | 198 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 84.63 | |
| d1i8ta1 | 298 | UDP-galactopyranose mutase, N-terminal domain {Esc | 84.54 | |
| d1gtea4 | 196 | Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su | 84.16 | |
| d1bg6a2 | 184 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A | 83.88 | |
| d2v5za1 | 383 | Monoamine oxidase B {Human (Homo sapiens) [TaxId: | 83.87 | |
| d1fcda1 | 186 | Flavocytochrome c sulfide dehydrogenase, FCSD, fla | 83.43 | |
| d1seza1 | 373 | Protoporphyrinogen oxidase {Tobacco (Nicotiana tab | 83.3 | |
| d1v9la1 | 242 | Glutamate dehydrogenase {Pyrobaculum islandicum [T | 83.03 | |
| d1npya1 | 167 | Shikimate 5-dehydrogenase-like protein HI0607 {Hae | 82.55 | |
| d2naca1 | 188 | Formate dehydrogenase {Pseudomonas sp., strain 101 | 82.38 | |
| d2iida1 | 370 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 81.79 | |
| d1c1da1 | 201 | Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ | 81.72 | |
| d1dxla1 | 221 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 81.59 | |
| d1feca2 | 117 | Trypanothione reductase {Crithidia fasciculata [Ta | 80.84 | |
| d1hwxa1 | 293 | Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: | 80.73 | |
| d1ps9a3 | 179 | 2,4-dienoyl-CoA reductase, middle domain {Escheric | 80.67 | |
| d1kifa1 | 246 | D-aminoacid oxidase, N-terminal domain {Pig (Sus s | 80.47 | |
| d1pjca1 | 168 | L-alanine dehydrogenase {Phormidium lapideum [TaxI | 80.36 | |
| d1pj5a2 | 305 | N,N-dimethylglycine oxidase {Arthrobacter globifor | 80.06 | |
| d1jw9b_ | 247 | Molybdenum cofactor biosynthesis protein MoeB {Esc | 80.06 |
| >d1gq2a2 c.58.1.3 (A:23-279) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Aminoacid dehydrogenase-like, N-terminal domain superfamily: Aminoacid dehydrogenase-like, N-terminal domain family: Malic enzyme N-domain domain: Mitochondrial NAD(P)-dependent malic enzyme species: Domestic pigeon (Columba livia) [TaxId: 8932]
Probab=100.00 E-value=4.8e-88 Score=695.37 Aligned_cols=254 Identities=62% Similarity=1.093 Sum_probs=246.7
Q ss_pred Ccchhhh-hhhccccccHHHHhhhcccccCcccccchhHHHHHhhccccccCCChhhHHHHHHhhcccceeEEEeccCce
Q psy14377 308 PVKNLAD-VVKTGMAFSIEERQALGIHGLLPAAVKSQDEQLHLCKLNVDRYEDPLNKYIYLQALAVKTDIRAIVVTDGER 386 (848)
Q Consensus 308 ~~~~l~~-~~n~g~~~~~~er~~~~~~G~~p~~v~~~~~q~~~~~~~~~~~~~~~~~~~~L~~l~~~~~~~~~~~~d~~~ 386 (848)
+.+.|++ .+|||++||.+||+++|++|+||++|+|+|+|++||+.++++++++++||+||.+|+++ |++
T Consensus 3 G~~lL~~p~~NKGtAFt~~ER~~l~l~GLLP~~v~tle~Qv~r~~~~~~~~~~~l~Ky~yL~~L~~~----------Ne~ 72 (257)
T d1gq2a2 3 GYEVLRDPHLNKGMAFTLEERQQLNIHGLLPPCFLGQDAQVYSILKNFERLTSDLDRYILLMSLQDR----------NEK 72 (257)
T ss_dssp TTHHHHCTTTCCGGGSCHHHHHHTTCTTSSCSCBCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHH----------CHH
T ss_pred hHHHhcCCCccCccCCCHHHHHHcCCccCCCCCccCHHHHHHHHHHHHHhcCCcHHHHHHHHHHHHh----------ChH
Confidence 4556666 78999999999999999999999999999999999999999999999999999999998 776
Q ss_pred ecccccCCCCCCCcccccccHHHHHcCCCcCccCceeeEEccccccccCCCCCCCHHHHHHHHhcCCCceEEecCCCCCc
Q psy14377 387 ILGLGDLGAYGMGIPVGKLSLYTALAGIKPHQCLPITLDVGTNWRRAAAIPQVFTADILKDMAAFNKRPIIFALSNPTSK 466 (848)
Q Consensus 387 l~g~~~~g~~~~~~~~g~~~L~~al~g~kP~~~~~~~v~iG~~~~~~S~~~g~FTeevvk~Ma~~~~rPIIFaLSNPt~~ 466 (848)
|
T Consensus 73 L------------------------------------------------------------------------------- 73 (257)
T d1gq2a2 73 L------------------------------------------------------------------------------- 73 (257)
T ss_dssp H-------------------------------------------------------------------------------
T ss_pred H-------------------------------------------------------------------------------
Confidence 6
Q ss_pred cCCCHHHHhccCCCcEEEEeCCCCCCcccCCeEEecccchhhccCCeEecchhhhHHHhhccccccCccceeeccCcccH
Q psy14377 467 AECTAEQAYVNTDGRGVFASGSPFDPVTYKGKTFTPGQEYVVELMPIVYTPTVGLACQKYGLIFRRPRGLFISIHDKGHI 546 (848)
Q Consensus 467 ~E~tpe~a~~~T~G~ai~AtGsPf~pv~y~g~~~~~~q~nn~e~lPvvYTPGVG~acl~~~~i~r~p~gm~L~~~d~g~i 546 (848)
||+ ..+.|..++||++||||||++|+.|+++|+.|+|||+|++|+|+|
T Consensus 74 ---------------------------FY~-----ll~~~~~e~~PivYTPTVG~Ac~~ys~~yr~prGlyis~~d~g~i 121 (257)
T d1gq2a2 74 ---------------------------FYK-----VLTSDIERFMPIVYTPTVGLACQHYGLAFRRPRGLFITIHDRGHI 121 (257)
T ss_dssp ---------------------------HHH-----HHHHTHHHHHHHHSTTHHHHHHHTHHHHCSSCCSEEEEGGGTTCH
T ss_pred ---------------------------HHH-----HHHHHHHHhcCcccCccHHHHHHHHhhhhccccceeeccCChHHH
Confidence 666 888999999999999999999999999999999999999999999
Q ss_pred HHHHhcCCCCCccEEEEecCceeeccCCCCCCCCCccccceeeeeecCCCCCCceeeEEeeccCCcccccCCcccccccc
Q psy14377 547 SEVLRNWPETDIRAIVVTDGERILGLGDLGAYGMGIPVGKLSLYTALAGIKPHQCLPITLDVGTNTQQLLDDPLYIGLRQ 626 (848)
Q Consensus 547 ~eiL~Nwp~~d~~viVVTDG~rILGLGDlG~~gmgIpvGKl~Ly~a~aGI~p~~~LPv~LDvGTnn~~ll~Dp~y~g~r~ 626 (848)
+++|+|||.++|++||||||+|||||||+|+|||+||+||++|||+||||||++|||||||||||||+||+||+|+|+||
T Consensus 122 ~~il~nwp~~~V~~iVVTDG~rILGlGD~G~~Gm~I~~gKl~lyta~~Gi~P~~~LPv~LDvGTnNe~LL~DP~YlG~R~ 201 (257)
T d1gq2a2 122 ATMLQSWPESVIKAIVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVKPHQCLPVMLDVGTDNETLLKDPLYIGLRH 201 (257)
T ss_dssp HHHHHTSSCSCCCEEEEECSSSCGGGCCCGGGGGHHHHHHHHHHHHTTCCCGGGEEEEEEESCCCCHHHHHCTTCCSCSS
T ss_pred HHHHHhCCCCCeeEEEEecCceeeecCCcCcCccchhhhHHHHHHHhcCCCHhhcCCeeecCCCChHHHhcCcccccccC
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cCCCCcchhHHHHHHHHHHHHhhCCceeeeeecCCCcchHHHHHHHcccCceeccC
Q psy14377 627 RRTTGQAYDDFIEEFMQAVVARYGQHVLIQFEDFANHSAFRFLDTYRNRYCVFNDD 682 (848)
Q Consensus 627 ~R~~g~~y~~fvdefv~av~~~fGp~~~IqfEDf~~~naf~lL~ryr~~~~~FnDD 682 (848)
+|++|++|++||||||+|++++|||+++||||||+++|||++|+|||+++||||||
T Consensus 202 ~R~~g~eY~~fvdefv~av~~~~p~~~~i~~EDf~~~na~~~L~~yr~~~~~FNDD 257 (257)
T d1gq2a2 202 KRIRGQAYDDLLDEFMEAVTSRYGMNCLIQFEDFANANAFRLLHKYRNKYCTFNDD 257 (257)
T ss_dssp CCCCTHHHHHHHHHHHHHHHHHHCTTCEEEECSCCHHHHHHHHHHHTTTSEEEETT
T ss_pred CCCcchHHHHHHHHHHHHHHHhCCCCCEEehhhcCCchHHHHHHHHccCCCccCCC
Confidence 99999999999999999999999889999999999999999999999999999999
|
| >d1pj3a2 c.58.1.3 (A:21-279) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o0sa2 c.58.1.3 (A:2-295) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} | Back information, alignment and structure |
|---|
| >d1gq2a1 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} | Back information, alignment and structure |
|---|
| >d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} | Back information, alignment and structure |
|---|
| >d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1gq2a1 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} | Back information, alignment and structure |
|---|
| >d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} | Back information, alignment and structure |
|---|
| >d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vl6a2 c.58.1.3 (A:1-154) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1gq2a2 c.58.1.3 (A:23-279) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} | Back information, alignment and structure |
|---|
| >d1pj3a2 c.58.1.3 (A:21-279) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o0sa2 c.58.1.3 (A:2-295) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} | Back information, alignment and structure |
|---|
| >d1vl6a2 c.58.1.3 (A:1-154) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} | Back information, alignment and structure |
|---|
| >d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} | Back information, alignment and structure |
|---|
| >d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} | Back information, alignment and structure |
|---|
| >d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} | Back information, alignment and structure |
|---|
| >d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} | Back information, alignment and structure |
|---|
| >d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} | Back information, alignment and structure |
|---|
| >d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} | Back information, alignment and structure |
|---|
| >d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} | Back information, alignment and structure |
|---|
| >d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} | Back information, alignment and structure |
|---|
| >d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} | Back information, alignment and structure |
|---|
| >d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|