Psyllid ID: psy14403

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
FSDSDRLVTQQGLSGLRTGSALRGPGFRQVQDKRYYEGLLQLKIRDLTNEITRLKRQIELSAKEHATFLLYDKRVKEMATELTELQGKLSDYNLTMDKVNTQTNIADIEEEYLELRAANDIETRHLEEQFTERSKKQHQLHELEAEIEKLDMIDISMWIDISTIDSLV
ccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc
cccccccccccccccccccccccccccEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHccc
fsdsdrlvtqqglsglrtgsalrgpgfrqvqdKRYYEGLLQLKIRDLTNEITRLKRQIELSAKEHATFLLYDKRVKEMATELTELQGKLSDYNLTMDKVNTQTNIADIEEEYLELRAANDIETRHLEEQFTERSKKQHQLHELEAEIEKLDMIDISMWIDISTIDSLV
fsdsdrlvtqqglsglrtgsalrgpgfrqvqdkRYYEGLLQLKIRDLTNEITRLKRQIELSAKEHATFLLYDKRVKEMATELTELqgklsdynltMDKVNTQTNIADIEEEYLELRAANDIETRHLEEQfterskkqhqLHELEAEIekldmidisMWIDISTIDSLV
FSDSDRLVTQQGLSGLRTGSALRGPGFRQVQDKRYYEGLLQLKIRDLTNEITRLKRQIELSAKEHATFLLYDKRVKEMATELTELQGKLSDYNLTMDKVNTQTNIADIEEEYLELRAANDIETRHLEEQFTERSKKQHQLHELEAEIEKLdmidismwidistidsLV
*************************GFRQVQDKRYYEGLLQLKIRDLTNEITRLKRQIELSAKEHATFLLYDKRVKEMATELTELQGKLSDYNLTMDKVNTQTNIADIEEEYLELRAAND***********************EAEIEKLDMIDISMWIDISTI****
*S*SDRLVTQ*********************DKRYYEGLLQLKIRDLTNEI*************************EMATELTELQGKLSDYNLTMDK******************************QFT*****************************IST*****
***********GLSGLRTGSALRGPGFRQVQDKRYYEGLLQLKIRDLTNEITRLKRQIELSAKEHATFLLYDKRVKEMATELTELQGKLSDYNLTMDKVNTQTNIADIEEEYLELRAANDIETRHLE************LHELEAEIEKLDMIDISMWIDISTIDSLV
*************************GFRQVQDKRYYEGLLQLKIRDLTNEITRLKRQIELSAKEHATFLLYDKRVKEMATELTELQGKLSDYNLTMDKVNTQTNIADIEEEYLELRAANDIETRHLEEQFTERSKKQHQLHELEAEIEKLDMIDISMWIDISTID***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
FSDSDRLVTQQGLSGLRTGSALRGPGFRQVQDKRYYxxxxxxxxxxxxxxxxxxxxxxxxxxxxHATFLLYDKRVKEMATExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNDIETRHxxxxxxxxxxxxxxxxxxxxxxxxxxxxDISMWIDISTIDSLV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query168 2.2.26 [Sep-21-2011]
Q96LB3 600 Intraflagellar transport no N/A 0.839 0.235 0.465 8e-30
Q8BKE9 600 Intraflagellar transport yes N/A 0.797 0.223 0.459 7e-29
>sp|Q96LB3|IFT74_HUMAN Intraflagellar transport protein 74 homolog OS=Homo sapiens GN=IFT74 PE=2 SV=1 Back     alignment and function desciption
 Score =  129 bits (324), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 67/144 (46%), Positives = 104/144 (72%), Gaps = 3/144 (2%)

Query: 6   RLVTQQGLSGLRTGSALRGPGFRQVQDKRYYEGLLQLKIRDLTNEITRLKRQIELSAKEH 65
           R VTQQGL+G++TG+  +GP  RQ+ DK YY GLL+ KI +LT E+ +L++ IE+  +E+
Sbjct: 70  RPVTQQGLTGMKTGT--KGPQ-RQILDKSYYLGLLRSKISELTTEVNKLQKGIEMYNQEN 126

Query: 66  ATFLLYDKRVKEMATELTELQGKLSDYNLTMDKVNTQTNIADIEEEYLELRAANDIETRH 125
           + +L Y+KR + +A E+ ELQG+L+DYN+ +DK+NT T + ++  +Y  L+A ND ET+ 
Sbjct: 127 SVYLSYEKRAETLAVEIKELQGQLADYNMLVDKLNTNTEMEEVMNDYNMLKAQNDRETQS 186

Query: 126 LEEQFTERSKKQHQLHELEAEIEK 149
           L+  FTER  K+ Q+  +E EIE+
Sbjct: 187 LDVIFTERQAKEKQIRSVEEEIEQ 210

Homo sapiens (taxid: 9606)
>sp|Q8BKE9|IFT74_MOUSE Intraflagellar transport protein 74 homolog OS=Mus musculus GN=Ift74 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query168
242008186 577 conserved hypothetical protein [Pediculu 0.857 0.249 0.486 5e-32
307168864 651 Intraflagellar transport protein 74-like 0.851 0.219 0.493 4e-30
296190056 600 PREDICTED: intraflagellar transport prot 0.851 0.238 0.465 6e-30
432091871 1683 Angiopoietin-1 receptor [Myotis davidii] 0.851 0.084 0.465 1e-29
311245683 600 PREDICTED: intraflagellar transport prot 0.851 0.238 0.465 2e-29
307200507 657 Intraflagellar transport protein 74-like 0.857 0.219 0.479 2e-29
403297855 600 PREDICTED: intraflagellar transport prot 0.851 0.238 0.458 2e-29
444729831 704 Intraflagellar transport protein 74 like 0.851 0.203 0.465 2e-29
291383125 600 PREDICTED: coiled-coil domain containing 0.851 0.238 0.465 2e-29
395818998 600 PREDICTED: intraflagellar transport prot 0.851 0.238 0.465 2e-29
>gi|242008186|ref|XP_002424892.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212508465|gb|EEB12154.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  142 bits (357), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 70/144 (48%), Positives = 106/144 (73%)

Query: 5   DRLVTQQGLSGLRTGSALRGPGFRQVQDKRYYEGLLQLKIRDLTNEITRLKRQIELSAKE 64
           DR +TQQG++GLR  ++ RGP  RQV+DKRYYEGLL++K++D+  E+ RL  +IEL  ++
Sbjct: 45  DRPITQQGVAGLRMSTSSRGPQIRQVKDKRYYEGLLRMKMKDIQMEMNRLNEEIELETQQ 104

Query: 65  HATFLLYDKRVKEMATELTELQGKLSDYNLTMDKVNTQTNIADIEEEYLELRAANDIETR 124
            AT  +Y+KRV+E+A+ELT LQG+L+DYNL +DKVNT T+ A I+ E  EL+  N+  T 
Sbjct: 105 QATSQVYEKRVREIASELTGLQGQLADYNLVIDKVNTNTDKAQIDAETEELKNENERLTE 164

Query: 125 HLEEQFTERSKKQHQLHELEAEIE 148
           +L E F +   K++ + +LE +++
Sbjct: 165 NLNELFEQNRMKENLIQQLEDDVQ 188

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307168864|gb|EFN61788.1| Intraflagellar transport protein 74-like protein [Camponotus floridanus] Back     alignment and taxonomy information
>gi|296190056|ref|XP_002743037.1| PREDICTED: intraflagellar transport protein 74 homolog [Callithrix jacchus] Back     alignment and taxonomy information
>gi|432091871|gb|ELK24727.1| Angiopoietin-1 receptor [Myotis davidii] Back     alignment and taxonomy information
>gi|311245683|ref|XP_001926178.2| PREDICTED: intraflagellar transport protein 74 homolog [Sus scrofa] Back     alignment and taxonomy information
>gi|307200507|gb|EFN80669.1| Intraflagellar transport protein 74-like protein [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|403297855|ref|XP_003939764.1| PREDICTED: intraflagellar transport protein 74 homolog isoform 1 [Saimiri boliviensis boliviensis] gi|403297857|ref|XP_003939765.1| PREDICTED: intraflagellar transport protein 74 homolog isoform 2 [Saimiri boliviensis boliviensis] Back     alignment and taxonomy information
>gi|444729831|gb|ELW70234.1| Intraflagellar transport protein 74 like protein [Tupaia chinensis] Back     alignment and taxonomy information
>gi|291383125|ref|XP_002708090.1| PREDICTED: coiled-coil domain containing 2 [Oryctolagus cuniculus] Back     alignment and taxonomy information
>gi|395818998|ref|XP_003782891.1| PREDICTED: intraflagellar transport protein 74 homolog isoform 1 [Otolemur garnettii] gi|395819000|ref|XP_003782892.1| PREDICTED: intraflagellar transport protein 74 homolog isoform 2 [Otolemur garnettii] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query168
UNIPROTKB|F1SP83 603 IFT74 "Uncharacterized protein 0.851 0.237 0.465 1.8e-31
UNIPROTKB|F1N626 600 IFT74 "Uncharacterized protein 0.851 0.238 0.465 3.8e-31
UNIPROTKB|E2RG29 600 IFT74 "Uncharacterized protein 0.851 0.238 0.458 4.8e-31
MGI|MGI:1914944 600 Ift74 "intraflagellar transpor 0.851 0.238 0.452 4.8e-31
RGD|1359704 600 Ift74 "intraflagellar transpor 0.851 0.238 0.452 4.8e-31
UNIPROTKB|Q96LB3 600 IFT74 "Intraflagellar transpor 0.839 0.235 0.465 2.2e-30
UNIPROTKB|F1NGP3 586 IFT74 "Uncharacterized protein 0.839 0.240 0.423 1.1e-27
UNIPROTKB|E5RH29175 IFT74 "Intraflagellar transpor 0.619 0.594 0.467 7.8e-23
WB|WBGene00016005 674 ift-74 [Caenorhabditis elegans 0.833 0.207 0.390 5.2e-17
UNIPROTKB|Q6RCE1 641 IFT-71 "Intraflagellar transpo 0.851 0.223 0.294 3.2e-15
UNIPROTKB|F1SP83 IFT74 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
 Score = 351 (128.6 bits), Expect = 1.8e-31, P = 1.8e-31
 Identities = 68/146 (46%), Positives = 106/146 (72%)

Query:     4 SDRLVTQQGLSGLRTGSALRGPGFRQVQDKRYYEGLLQLKIRDLTNEITRLKRQIELSAK 63
             +DR VTQQGLSG++TG  ++GP  RQ+ DK YY GLL+ KI +LT EI +L+++IE+  +
Sbjct:    68 ADRPVTQQGLSGMKTG--MKGPQ-RQILDKSYYLGLLRSKISELTTEINKLQKEIEMYNQ 124

Query:    64 EHATFLLYDKRVKEMATELTELQGKLSDYNLTMDKVNTQTNIADIEEEYLELRAANDIET 123
             E++ +L Y+KR + +A E+ E QG+L+DYN+ +DK+NT T + ++  +Y  L+A ND ET
Sbjct:   125 ENSVYLSYEKRAETLAVEIKEFQGQLADYNMLVDKLNTNTEMEEVMNDYNMLKAQNDRET 184

Query:   124 RHLEEQFTERSKKQHQLHELEAEIEK 149
             + ++  FTER  K+ Q+  +E EIE+
Sbjct:   185 QSMDVIFTERQAKEKQIRSVEEEIEQ 210
GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IEA
GO:0033630 "positive regulation of cell adhesion mediated by integrin" evidence=IEA
GO:0005813 "centrosome" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0003682 "chromatin binding" evidence=IEA
UNIPROTKB|F1N626 IFT74 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RG29 IFT74 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1914944 Ift74 "intraflagellar transport 74" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1359704 Ift74 "intraflagellar transport 74 homolog (Chlamydomonas)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q96LB3 IFT74 "Intraflagellar transport protein 74 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NGP3 IFT74 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E5RH29 IFT74 "Intraflagellar transport protein 74 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
WB|WBGene00016005 ift-74 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q6RCE1 IFT-71 "Intraflagellar transport protein IFT-71" [Chlamydomonas reinhardtii (taxid:3055)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query168
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-04
PRK11448 1123 PRK11448, hsdR, type I restriction enzyme EcoKI su 5e-04
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 5e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.001
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information 
 Score = 40.5 bits (95), Expect = 2e-04
 Identities = 31/132 (23%), Positives = 61/132 (46%), Gaps = 9/132 (6%)

Query: 28  RQVQDKRYYEGLLQLKIRDLTNEITRLKRQIELSAKEHATFL----LYDKRVKEMATELT 83
           RQ+++       L+ ++  L  E+ +L+ ++E   +E            +R++E+  EL 
Sbjct: 709 RQLEELERQLEELKRELAALEEELEQLQSRLEELEEELEELEEELEELQERLEELEEELE 768

Query: 84  ELQGKLSDYNLTMDKVNT-----QTNIADIEEEYLELRAANDIETRHLEEQFTERSKKQH 138
            L+  L+     ++++       Q  + ++EEE  E     D   R LE     R + + 
Sbjct: 769 SLEEALAKLKEEIEELEEKRQALQEELEELEEELEEAERRLDALERELESLEQRRERLEQ 828

Query: 139 QLHELEAEIEKL 150
           ++ ELE EIE+L
Sbjct: 829 EIEELEEEIEEL 840

Length = 1163
>gnl|CDD|236912 PRK11448, hsdR, type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 168
PF10146 230 zf-C4H2: Zinc finger-containing protein ; InterPro 96.17
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 95.62
KOG0933|consensus 1174 95.59
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 95.56
PF14662193 CCDC155: Coiled-coil region of CCDC155 95.42
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 95.4
PRK03918 880 chromosome segregation protein; Provisional 95.36
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 95.34
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 95.31
PHA02562 562 46 endonuclease subunit; Provisional 95.21
PRK09039 343 hypothetical protein; Validated 95.17
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 95.09
PHA02562 562 46 endonuclease subunit; Provisional 95.08
PF00038 312 Filament: Intermediate filament protein; InterPro: 95.03
PRK03918 880 chromosome segregation protein; Provisional 94.97
PF03962188 Mnd1: Mnd1 family; InterPro: IPR005647 This family 94.8
PRK02224 880 chromosome segregation protein; Provisional 94.74
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 94.66
PF13851201 GAS: Growth-arrest specific micro-tubule binding 94.59
PF06810155 Phage_GP20: Phage minor structural protein GP20; I 94.58
PRK02224 880 chromosome segregation protein; Provisional 94.58
PRK10884206 SH3 domain-containing protein; Provisional 94.47
PF04111 314 APG6: Autophagy protein Apg6; InterPro: IPR007243 94.46
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 94.38
PRK11637 428 AmiB activator; Provisional 94.32
PRK10884206 SH3 domain-containing protein; Provisional 94.31
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 94.24
KOG0250|consensus 1074 94.19
KOG0977|consensus 546 94.16
PF07200150 Mod_r: Modifier of rudimentary (Mod(r)) protein; I 93.7
PF06785 401 UPF0242: Uncharacterised protein family (UPF0242); 93.65
PF06160 560 EzrA: Septation ring formation regulator, EzrA ; I 93.48
PRK04778 569 septation ring formation regulator EzrA; Provision 93.23
PRK11281 1113 hypothetical protein; Provisional 92.96
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 92.94
KOG1029|consensus 1118 92.89
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 92.8
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 92.74
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 92.25
PF10186 302 Atg14: UV radiation resistance protein and autopha 92.25
PF09726 697 Macoilin: Transmembrane protein; InterPro: IPR0191 91.96
PF13514 1111 AAA_27: AAA domain 91.79
PRK01156 895 chromosome segregation protein; Provisional 91.69
PF07798177 DUF1640: Protein of unknown function (DUF1640); In 91.67
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 91.66
KOG0996|consensus 1293 91.57
PF0553175 NPV_P10: Nucleopolyhedrovirus P10 protein; InterPr 91.47
KOG0996|consensus 1293 91.28
cd00632105 Prefoldin_beta Prefoldin beta; Prefoldin is a hexa 91.27
PRK11637 428 AmiB activator; Provisional 90.9
PF00261 237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 90.86
KOG0995|consensus 581 90.78
KOG4674|consensus 1822 90.77
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 90.74
KOG0250|consensus 1074 90.66
PRK01156 895 chromosome segregation protein; Provisional 90.65
TIGR03185 650 DNA_S_dndD DNA sulfur modification protein DndD. T 90.63
PF12795240 MscS_porin: Mechanosensitive ion channel porin dom 90.39
cd00890129 Prefoldin Prefoldin is a hexameric molecular chape 90.2
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 90.08
PRK04863 1486 mukB cell division protein MukB; Provisional 89.96
COG1340294 Uncharacterized archaeal coiled-coil protein [Func 89.67
KOG0995|consensus 581 89.66
PRK03947140 prefoldin subunit alpha; Reviewed 89.41
KOG2751|consensus 447 89.36
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 89.01
PRK04863 1486 mukB cell division protein MukB; Provisional 89.01
PF14282106 FlxA: FlxA-like protein 88.94
TIGR01000 457 bacteriocin_acc bacteriocin secretion accessory pr 88.58
PF09755310 DUF2046: Uncharacterized conserved protein H4 (DUF 88.56
PF15294278 Leu_zip: Leucine zipper 88.47
KOG0243|consensus 1041 88.28
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 88.26
PF05529192 Bap31: B-cell receptor-associated protein 31-like 88.23
KOG0161|consensus 1930 88.13
KOG0161|consensus 1930 87.9
PF06810155 Phage_GP20: Phage minor structural protein GP20; I 87.85
PF13870177 DUF4201: Domain of unknown function (DUF4201) 87.78
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 87.66
TIGR02338110 gimC_beta prefoldin, beta subunit, archaeal. Chape 87.59
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 87.57
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 87.57
PF14988206 DUF4515: Domain of unknown function (DUF4515) 87.5
PF08657259 DASH_Spc34: DASH complex subunit Spc34 ; InterPro: 87.26
COG4717 984 Uncharacterized conserved protein [Function unknow 87.01
PF09728309 Taxilin: Myosin-like coiled-coil protein; InterPro 87.01
KOG0804|consensus493 86.69
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 86.69
KOG0994|consensus1758 86.67
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 86.59
PF02403108 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom 86.44
KOG1962|consensus216 86.15
PF06008264 Laminin_I: Laminin Domain I; InterPro: IPR009254 L 86.13
PRK1542279 septal ring assembly protein ZapB; Provisional 86.08
KOG0612|consensus 1317 85.99
cd00584129 Prefoldin_alpha Prefoldin alpha subunit; Prefoldin 85.68
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 85.56
PF09403126 FadA: Adhesion protein FadA; InterPro: IPR018543 F 84.91
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 84.34
TIGR03185 650 DNA_S_dndD DNA sulfur modification protein DndD. T 84.24
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 84.17
PF08738103 Gon7: Gon7 family; InterPro: IPR014849 In Saccharo 84.03
PF00038312 Filament: Intermediate filament protein; InterPro: 84.01
PF13851201 GAS: Growth-arrest specific micro-tubule binding 83.96
PRK05431 425 seryl-tRNA synthetase; Provisional 83.72
PRK09039 343 hypothetical protein; Validated 83.47
PRK04778 569 septation ring formation regulator EzrA; Provision 82.78
PF02388406 FemAB: FemAB family; InterPro: IPR003447 The femAB 82.73
PF07439112 DUF1515: Protein of unknown function (DUF1515); In 82.71
TIGR02680 1353 conserved hypothetical protein TIGR02680. Members 82.45
PF04799171 Fzo_mitofusin: fzo-like conserved region; InterPro 82.33
KOG0018|consensus 1141 82.31
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 81.83
PF02388406 FemAB: FemAB family; InterPro: IPR003447 The femAB 81.69
KOG4674|consensus 1822 81.41
TIGR02231 525 conserved hypothetical protein. This family consis 81.37
PF01920106 Prefoldin_2: Prefoldin subunit; InterPro: IPR00277 81.25
KOG0964|consensus 1200 81.21
PF04420161 CHD5: CHD5-like protein; InterPro: IPR007514 Membe 80.48
PF13514 1111 AAA_27: AAA domain 80.15
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 80.15
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 80.14
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information 
Probab=96.17  E-value=0.36  Score=41.23  Aligned_cols=101  Identities=16%  Similarity=0.225  Sum_probs=86.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHhHhHHHHHHHHHHhhcCCCHHHHHHHHHHHH
Q psy14403         37 EGLLQLKIRDLTNEITRLKRQIELSAKEHATFLLYDKRVKEMATELTELQGKLSDYNLTMDKVNTQTNIADIEEEYLELR  116 (168)
Q Consensus        37 ~glLR~Ki~El~~EI~kL~~e~e~~~~e~s~~~~yekrae~La~EI~~LQG~LADyNl~~Dk~~t~~d~~~i~~e~~~Lk  116 (168)
                      ++-||.|+.++..=-++|..+++..+.+.--...|.+..+.|..|=...-.+|.++|         .|+..|++.+..++
T Consensus         3 i~~ir~K~~~lek~k~~i~~e~~~~e~ee~~L~e~~kE~~~L~~Er~~h~eeLrqI~---------~DIn~lE~iIkqa~   73 (230)
T PF10146_consen    3 IKEIRNKTLELEKLKNEILQEVESLENEEKCLEEYRKEMEELLQERMAHVEELRQIN---------QDINTLENIIKQAE   73 (230)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---------HHHHHHHHHHHHHH
Confidence            567999999999999999999999999999999999999999999999999997776         35555778888888


Q ss_pred             HhcHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy14403        117 AANDIETRHLEEQFTERSKKQHQLHELEAE  146 (168)
Q Consensus       117 ~~N~~~~~~ld~iF~eR~~~E~~i~~lE~e  146 (168)
                      ....+..+.+..++.+=..+-.++..+-.+
T Consensus        74 ~er~~~~~~i~r~~eey~~Lk~~in~~R~e  103 (230)
T PF10146_consen   74 SERNKRQEKIQRLYEEYKPLKDEINELRKE  103 (230)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            888888888888887777777777777666

Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target. This entry represents a family of proteins which appears to have a highly conserved zinc finger domain at the C-terminal end, described as -C-X2-CH-X3-H-X5-C-X2-C-. The structure is predicted to contain a coiled coil. Members of this family are annotated as being tumour-associated antigen HCA127 in humans, but this could not be confirmed.
>TIGR00606 rad50 rad50 Back     alignment and domain information
>KOG0933|consensus Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PF06810 Phage_GP20: Phage minor structural protein GP20; InterPro: IPR009636 This family consists of several phage minor structural protein Gp20 sequences and prophage sequences of around 180 residues in length Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>KOG0250|consensus Back     alignment and domain information
>KOG0977|consensus Back     alignment and domain information
>PF07200 Mod_r: Modifier of rudimentary (Mod(r)) protein; InterPro: IPR009851 This entry represents a conserved region approximately 150 residues long within a number of eukaryotic proteins that show homology with Drosophila melanogaster Modifier of rudimentary (Mod(r)) proteins Back     alignment and domain information
>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>PRK11281 hypothetical protein; Provisional Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF13514 AAA_27: AAA domain Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>KOG0996|consensus Back     alignment and domain information
>PF05531 NPV_P10: Nucleopolyhedrovirus P10 protein; InterPro: IPR008702 This family consists of several nucleopolyhedrovirus P10 proteins which are thought to be involved in the morphogenesis of the polyhedra [] Back     alignment and domain information
>KOG0996|consensus Back     alignment and domain information
>cd00632 Prefoldin_beta Prefoldin beta; Prefoldin is a hexameric molecular chaperone complex, composed of two evolutionarily related subunits (alpha and beta), which are found in both eukaryotes and archaea Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>KOG0995|consensus Back     alignment and domain information
>KOG4674|consensus Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>KOG0250|consensus Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>PF12795 MscS_porin: Mechanosensitive ion channel porin domain Back     alignment and domain information
>cd00890 Prefoldin Prefoldin is a hexameric molecular chaperone complex, found in both eukaryotes and archaea, that binds and stabilizes newly synthesized polypeptides allowing them to fold correctly Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG0995|consensus Back     alignment and domain information
>PRK03947 prefoldin subunit alpha; Reviewed Back     alignment and domain information
>KOG2751|consensus Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>PF14282 FlxA: FlxA-like protein Back     alignment and domain information
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>PF15294 Leu_zip: Leucine zipper Back     alignment and domain information
>KOG0243|consensus Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF05529 Bap31: B-cell receptor-associated protein 31-like ; InterPro: IPR008417 Bap31 is a polytopic integral protein of the endoplasmic reticulum membrane and a substrate of caspase-8 Back     alignment and domain information
>KOG0161|consensus Back     alignment and domain information
>KOG0161|consensus Back     alignment and domain information
>PF06810 Phage_GP20: Phage minor structural protein GP20; InterPro: IPR009636 This family consists of several phage minor structural protein Gp20 sequences and prophage sequences of around 180 residues in length Back     alignment and domain information
>PF13870 DUF4201: Domain of unknown function (DUF4201) Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>TIGR02338 gimC_beta prefoldin, beta subunit, archaeal Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>PF14988 DUF4515: Domain of unknown function (DUF4515) Back     alignment and domain information
>PF08657 DASH_Spc34: DASH complex subunit Spc34 ; InterPro: IPR013966 The DASH complex is a ~10 subunit microtubule-binding complex that is transferred to the kinetochore prior to mitosis [] Back     alignment and domain information
>COG4717 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG1962|consensus Back     alignment and domain information
>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>cd00584 Prefoldin_alpha Prefoldin alpha subunit; Prefoldin is a hexameric molecular chaperone complex, found in both eukaryotes and archaea, that binds and stabilizes newly synthesized polypeptides allowing them to fold correctly Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>PF09403 FadA: Adhesion protein FadA; InterPro: IPR018543 FadA (Fusobacterium adhesin A) is an adhesin which forms two alpha helices Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PF08738 Gon7: Gon7 family; InterPro: IPR014849 In Saccharomyces cerevisiae Gon7 is a member of the KEOPS protein complex Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PRK05431 seryl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>PF02388 FemAB: FemAB family; InterPro: IPR003447 The femAB operon codes for two nearly identical approximately 50kDa proteins involved in the formation of the Staphylococcal pentaglycine interpeptide bridge in peptidoglycan [] Back     alignment and domain information
>PF07439 DUF1515: Protein of unknown function (DUF1515); InterPro: IPR010889 This family consists of several hypothetical bacterial proteins of around 130 residues in length Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>PF04799 Fzo_mitofusin: fzo-like conserved region; InterPro: IPR006884 This entry represents the heptad repeat domain which is conserved at the C terminus of Fzo/mitofusion family of GTPases Back     alignment and domain information
>KOG0018|consensus Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>PF02388 FemAB: FemAB family; InterPro: IPR003447 The femAB operon codes for two nearly identical approximately 50kDa proteins involved in the formation of the Staphylococcal pentaglycine interpeptide bridge in peptidoglycan [] Back     alignment and domain information
>KOG4674|consensus Back     alignment and domain information
>TIGR02231 conserved hypothetical protein Back     alignment and domain information
>PF01920 Prefoldin_2: Prefoldin subunit; InterPro: IPR002777 Prefoldin (PFD) is a chaperone that interacts exclusively with type II chaperonins, hetero-oligomers lacking an obligate co-chaperonin that are found only in eukaryotes (chaperonin-containing T-complex polypeptide-1 (CCT)) and archaea Back     alignment and domain information
>KOG0964|consensus Back     alignment and domain information
>PF04420 CHD5: CHD5-like protein; InterPro: IPR007514 Members of this family are probably coiled-coil proteins that are similar to the CHD5 (Congenital heart disease 5) protein Back     alignment and domain information
>PF13514 AAA_27: AAA domain Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query168
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 4e-04
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 8e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 39.8 bits (92), Expect = 2e-04
 Identities = 17/118 (14%), Positives = 40/118 (33%), Gaps = 21/118 (17%)

Query: 28  RQVQDKRYYEGLLQLKIRDLTNEITRLKRQIELSAKEHATFLLYDKRVKEMATELTELQG 87
           + +  K   + ++  K     + ++   R          T L   + + +   E   L+ 
Sbjct: 43  KSILSKEEIDHIIMSK-----DAVSGTLRLFW-------TLLSKQEEMVQKFVE-EVLR- 88

Query: 88  KLSDYNLTMDKVNTQTNI-ADIEEEYLELRAA--NDIETRHLEEQFTERSKKQHQLHE 142
              +Y   M  + T+    + +   Y+E R    ND +     +    R +   +L +
Sbjct: 89  --INYKFLMSPIKTEQRQPSMMTRMYIEQRDRLYNDNQV--FAKYNVSRLQPYLKLRQ 142
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query168
3na7_A 256 HP0958; flagellar biogenesis, flagellum export, C4 97.01
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 96.37
1c1g_A 284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 95.63
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 95.3
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 95.27
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 94.39
3mq9_A471 Bone marrow stromal antigen 2 fused to maltose-BI 94.37
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 94.33
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 94.32
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 93.74
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 93.2
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 92.94
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 92.89
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 92.59
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 92.34
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 91.95
2zqm_A117 Prefoldin beta subunit 1; chaperone; HET: CIT; 1.9 91.49
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 91.18
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 90.54
3i00_A120 HIP-I, huntingtin-interacting protein 1; transcrip 90.08
1t3j_A96 Mitofusin 1; coiled coil antiparallel, dimer, memb 89.47
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 88.33
3qh9_A81 Liprin-beta-2; coiled-coil, dimerization, structur 88.12
3bas_A89 Myosin heavy chain, striated muscle/general contro 87.95
2ke4_A98 CDC42-interacting protein 4; CIP4, TC10, coiled-co 87.65
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 87.21
1l8d_A112 DNA double-strand break repair RAD50 ATPase; zinc 87.14
1fxk_A107 Prefoldin; archaeal protein, chaperone; 2.30A {Met 86.29
4aj5_1101 SKA3, spindle and kinetochore-associated protein 3 86.22
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 85.96
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 85.87
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 84.89
2eqb_B97 RAB guanine nucleotide exchange factor SEC2; coile 84.41
3q8t_A96 Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 84.13
1l8d_A112 DNA double-strand break repair RAD50 ATPase; zinc 83.33
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 83.23
1deq_A 390 Fibrinogen (alpha chain); coiled-coil, blood clott 83.14
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
Probab=97.01  E-value=0.073  Score=43.79  Aligned_cols=113  Identities=16%  Similarity=0.239  Sum_probs=78.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH----hhhHHHHHHHHHHHHHHHHHHHhHhHHHHHHHHHHhhcCCCHHHHHHHHHHH
Q psy14403         40 LQLKIRDLTNEITRLKRQIELSAK----EHATFLLYDKRVKEMATELTELQGKLSDYNLTMDKVNTQTNIADIEEEYLEL  115 (168)
Q Consensus        40 LR~Ki~El~~EI~kL~~e~e~~~~----e~s~~~~yekrae~La~EI~~LQG~LADyNl~~Dk~~t~~d~~~i~~e~~~L  115 (168)
                      |+....++-.|+..|..++..+..    -...+..+++....+-.+|.+++..+..|..-++..+++=++..+..+...+
T Consensus        23 l~~~~~~lp~el~~le~~~~~l~~~~~~~~~~l~d~~~~~~~~e~~i~~~~~ri~~~~~~l~~v~~~kE~~aL~kEie~~  102 (256)
T 3na7_A           23 LEPLIREKRKDLDKALNDKEAKNKAILNLEEEKLALKLQVSKNEQTLQDTNAKIASIQKKMSEIKSERELRSLNIEEDIA  102 (256)
T ss_dssp             THHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCSSSSHHHHHHHHHHHH
T ss_pred             HHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccCCHHHHHHHHHHHHHH
Confidence            444444444555554444443332    2334455666666677777777777777777777777888899999999999


Q ss_pred             HHhcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhh
Q psy14403        116 RAANDIETRHLEEQFTERSKKQHQLHELEAEIEKLDM  152 (168)
Q Consensus       116 k~~N~~~~~~ld~iF~eR~~~E~~i~~lE~eie~~~~  152 (168)
                      +.+.....+.+-++......++..+..++.++.....
T Consensus       103 ~~~i~~lE~eile~~e~ie~~~~~l~~~~~~l~~~~~  139 (256)
T 3na7_A          103 KERSNQANREIENLQNEIKRKSEKQEDLKKEMLELEK  139 (256)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            9999999998888888888777777777666665554
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>2zqm_A Prefoldin beta subunit 1; chaperone; HET: CIT; 1.90A {Thermococcus SP} PDB: 2zdi_A Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Back     alignment and structure
>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A Back     alignment and structure
>1t3j_A Mitofusin 1; coiled coil antiparallel, dimer, membrane protein; 2.50A {Mus musculus} SCOP: h.4.16.1 Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3qh9_A Liprin-beta-2; coiled-coil, dimerization, structural protein; 2.01A {Homo sapiens} Back     alignment and structure
>3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A Back     alignment and structure
>2ke4_A CDC42-interacting protein 4; CIP4, TC10, coiled-coil, alternative splicing, cell membrane, coiled coil, cytoplasm, cytoskeleton, endocytosis; NMR {Homo sapiens} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 Back     alignment and structure
>1fxk_A Prefoldin; archaeal protein, chaperone; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.2.5.1 PDB: 1fxk_B Back     alignment and structure
>4aj5_1 SKA3, spindle and kinetochore-associated protein 3; cell cycle, SKA complex, mitosis, cell division, kinetochore microtubule attachment; 3.32A {Homo sapiens} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} Back     alignment and structure
>1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query168
d1fxkc_133 Prefoldin alpha subunit {Archaeon Methanobacterium 92.62
d1fxka_107 Prefoldin beta subunit {Archaeon Methanobacterium 90.54
d1seta1110 Seryl-tRNA synthetase (SerRS) {Thermus thermophilu 84.3
>d1fxkc_ a.2.5.1 (C:) Prefoldin alpha subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Prefoldin
family: Prefoldin
domain: Prefoldin alpha subunit
species: Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]

Probab=92.62  E-value=1  Score=31.16  Aligned_cols=88  Identities=10%  Similarity=0.190  Sum_probs=65.4

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHhHhHHHHHHHHHHhhcC---CC---------------------------------HHHH
Q psy14403         65 HATFLLYDKRVKEMATELTELQGKLSDYNLTMDKVNTQ---TN---------------------------------IADI  108 (168)
Q Consensus        65 ~s~~~~yekrae~La~EI~~LQG~LADyNl~~Dk~~t~---~d---------------------------------~~~i  108 (168)
                      .+.+..|+++.+.|..++..|+..+++|..+.+.+.+-   .+                                 --++
T Consensus         7 ~~~~~~l~~~l~~l~~~i~~l~~~~~e~~~~~~~L~~l~~~~~~e~lvplg~~~~v~~~i~~~~~vlV~lG~g~~vE~~~   86 (133)
T d1fxkc_           7 VAQLNIYQSQVELIQQQMEAVRATISELEILEKTLSDIQGKDGSETLVPVGAGSFIKAELKDTSEVIMSVGAGVAIKKNF   86 (133)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCTTCEEEEEEETTEEEEEECCSTTEEEEEEETTEEEEEEH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCCCeEEEEcCCceEEEEEecCCCceEEEecCCeeeeecH
Confidence            34566777778888888888888888888777776431   11                                 0123


Q ss_pred             HHHHHHHHHhcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhh
Q psy14403        109 EEEYLELRAANDIETRHLEEQFTERSKKQHQLHELEAEIEKLDM  152 (168)
Q Consensus       109 ~~e~~~Lk~~N~~~~~~ld~iF~eR~~~E~~i~~lE~eie~~~~  152 (168)
                      .+-..-+..+.+...+.++.+-.+.......+..++.+++++..
T Consensus        87 ~eA~~~l~~ri~~l~~~~~~l~~~~~~~~~~i~~l~~~~~~l~~  130 (133)
T d1fxkc_          87 EDAMESIKSQKNELESTLQKMGENLRAITDIMMKLSPQAEELLA  130 (133)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            34445677788888899999999999999999999999998764
>d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} Back     information, alignment and structure