Psyllid ID: psy14410

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-----
MSIAVTASGMSVPMGQEEEDAAEFDYFPTNSEADAEKVEEFKREAEKVRKLKRLFEGLKVFLNREVPREPLTLALRSFGAQVSWDKTLFVGATFPEDDESITHQIVDRPSIGKQYISRVFDSINAKQLAPVEKYFIGVTLPPHLSSYYVQPQWVFDSINAKQLAPVEKYFIGVTLPPHMSSYYVQPQWVFDSINAKQLAPVEKYFIGVTLPPHLSPFIDTTKTEHYVPPEAEDPENERLRDPKNIQTLCKYYVQPQWVFDSINAKQLAPVEKYFIGVTLPPHLYYVQPQWVFDSINAKQLAPVEKYFIGVTLPPHLFPTSLNFPC
ccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccEEEEccccccHHHHHHHHHcccEEEccccccccccccccccccEEEEEccccccccccccccccHHHHccccccccccccccccccccEEEccccccccHHHHHHccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccEEEcccEEEEEccccccccccccccccccccccccccccccc
ccHHHHHHHHcccccccHHHHHHHccccccccccHHHHHHHccHHHHHHHHHHHHcccEEEEcccccHHHHHHHHHHccccEcccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccccccccccEEEccEEEEEcccccccccHHcccccccccccccccEcccccccccHHHHHcccHHHccccccccccccccccccccccccccHHHHHHHHHcccccccEEEEEEEEccEEEEEcccccccccHHHccccccccccEEEEcccEEEccccHHccccHcccccccccccccccccccccc
msiavtasgmsvpmgqeeedaaefdyfptnseadAEKVEEFKREAEKVRKLKRLFEGLKVFlnrevprepLTLALRSFgaqvswdktlfvgatfpeddesithqivdrpsigkQYISRVFDSinakqlapvekyfigvtlpphlssyyvqpqwvfdsinakqlapvekyfigvtlpphmssyyvqpqwvfdsinakqlapvekyfigvtlpphlspfidttktehyvppeaedpenerlrdpknIQTLCKYYvqpqwvfdsinakqlapvekyfigvtlpphlyyvqpqwvfdsinakqlapvekyfigvtlpphlfptslnfpc
msiavtasgmsvpmgqeEEDAAEFDYFPTNSEADAEKVEEFKREAEKVRKLKRlfeglkvflnrevprePLTLALRSFGAQVSWDKTLFVGATFPEDDESITHQIVDRPSIGKQYISRVFDSINAKQLAPVEKYFIGVTLPPHLSSYYVQPQWVFDSINAKQLAPVEKYFIGVTLPPHMSSYYVQPQWVFDSINAKQLAPVEKYFIGVTLPPHLSPFIDTTKTEHYVPpeaedpenerlrdPKNIQTLCKYYVQPQWVFDSINAKQLAPVEKYFIGVTLPPHLYYVQPQWVFDSINAKQLAPVEKYFIGVTLPPhlfptslnfpc
MSIAVTASGMSVPMGQEEEDAAEFDYFPTNSEADAEKVEEFKREAEKVRKLKRLFEGLKVFLNREVPREPLTLALRSFGAQVSWDKTLFVGATFPEDDESITHQIVDRPSIGKQYISRVFDSINAKQLAPVEKYFIGVTLPPHLSSYYVQPQWVFDSINAKQLAPVEKYFIGVTLPPHMSSYYVQPQWVFDSINAKQLAPVEKYFIGVTLPPHLSPFIDTTKTEHYVPPEAEDPENERLRDPKNIQTLCKYYVQPQWVFDSINAKQLAPVEKYFIGVTLPPHLYYVQPQWVFDSINAKQLAPVEKYFIGVTLPPHLFPTSLNFPC
************************************************RKLKRLFEGLKVFLNREVPREPLTLALRSFGAQVSWDKTLFVGATFPEDDESITHQIVDRPSIGKQYISRVFDSINAKQLAPVEKYFIGVTLPPHLSSYYVQPQWVFDSINAKQLAPVEKYFIGVTLPPHMSSYYVQPQWVFDSINAKQLAPVEKYFIGVTLPPHLSPFIDTTK*********************NIQTLCKYYVQPQWVFDSINAKQLAPVEKYFIGVTLPPHLYYVQPQWVFDSINAKQLAPVEKYFIGVTLPPHLFPT******
******************************************************FEGLKVFLNREVPREPLTLALRSFGAQVSWDKTLFVGATFPEDDESITHQIVDRPSIGKQYISRVFDSINAKQLAPVEKYFIGVTLPPHLSSYYVQPQWVFDSINAKQLAPVEKYFIGVTLPPHMSSYYVQPQWVFDSINAKQLAPVEKYFIGVTL******************************************VQPQWVFDSINAKQLAPVEKY***VTLPPHLYYVQPQWVFDSINAKQLAPVEKYFIGVTLPPHLFPTSLNFPC
MSIAVTASGMSVPMGQEEEDAAEFDYFPTNSEADAEKVEEFKREAEKVRKLKRLFEGLKVFLNREVPREPLTLALRSFGAQVSWDKTLFVGATFPEDDESITHQIVDRPSIGKQYISRVFDSINAKQLAPVEKYFIGVTLPPHLSSYYVQPQWVFDSINAKQLAPVEKYFIGVTLPPHMSSYYVQPQWVFDSINAKQLAPVEKYFIGVTLPPHLSPFIDTTKTEHYV**********RLRDPKNIQTLCKYYVQPQWVFDSINAKQLAPVEKYFIGVTLPPHLYYVQPQWVFDSINAKQLAPVEKYFIGVTLPPHLFPTSLNFPC
**********S*************DYFPTNSEADAEKVEEFKREAEKVRKLKRLFEGLKVFLNREVPREPLTLALRSFGAQVSWDKTLFVGATFPEDDESITHQIVDRPSIGKQYI*************************PHLSSYYVQPQWVFDSINAKQLAPVEKYFIGVTLPPHMSSYYVQPQWVFDSINAKQLAPVEKYFIGVTLPPHLSPFIDTTKTEHYVPPEAEDPENERLRDPKNIQTLCKYYVQPQWVFDSINAKQLAPVEKYFIGVTLPPHLYYVQPQWVFDSINAKQLAPVEKYFIGVTLPPHLFPTSLNFPC
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSIAVTASGMSVPMGQEEEDAAEFDYFPTNSEADAEKVEEFKREAEKVRKLKRLFEGLKVFLNREVPREPLTLALRSFGAQVSWDKTLFVGATFPEDDESITHQIVDRPSIGKQYISRVFDSINAKQLAPVEKYFIGVTLPPHLSSYYVQPQWVFDSINAKQLAPVEKYFIGVTLPPHMSSYYVQPQWVFDSINAKQLAPVEKYFIGVTLPPHLSPFIDTTKTEHYVPPEAEDPENERLRDPKNIQTLCKYYVQPQWVFDSINAKQLAPVEKYFIGVTLPPHLYYVQPQWVFDSINAKQLAPVEKYFIGVTLPPHLFPTSLNFPC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query325 2.2.26 [Sep-21-2011]
Q0IE95609 Pescadillo homolog OS=Aed N/A N/A 0.421 0.224 0.518 8e-41
B3N8H0 629 Pescadillo homolog OS=Dro N/A N/A 0.501 0.259 0.396 2e-39
Q9VL96627 Pescadillo homolog OS=Dro yes N/A 0.501 0.259 0.396 2e-39
Q7QIX1643 Pescadillo homolog OS=Ano yes N/A 0.424 0.214 0.482 6e-39
B4NE56 634 Pescadillo homolog OS=Dro N/A N/A 0.498 0.255 0.398 7e-39
B3MUX9627 Pescadillo homolog OS=Dro N/A N/A 0.501 0.259 0.387 3e-38
B4Q865627 Pescadillo homolog OS=Dro N/A N/A 0.4 0.207 0.540 4e-38
P79741583 Pescadillo OS=Danio rerio yes N/A 0.393 0.219 0.503 4e-38
B4HW93627 Pescadillo homolog OS=Dro N/A N/A 0.4 0.207 0.540 4e-38
B4NY70628 Pescadillo homolog OS=Dro N/A N/A 0.4 0.207 0.540 6e-38
>sp|Q0IE95|PESC_AEDAE Pescadillo homolog OS=Aedes aegypti GN=AAEL012980 PE=3 SV=1 Back     alignment and function desciption
 Score =  167 bits (424), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 86/166 (51%), Positives = 104/166 (62%), Gaps = 29/166 (17%)

Query: 15  GQEEEDAAEFDYFPTNSEADAEKVEEFKREAEKVRKLKRLFEGLKVFLNREVPREPLTLA 74
           G EEED  E D    +++ D+E+V +   EA  + KLK LF+GLK F+NREVPREPL   
Sbjct: 286 GTEEEDE-EIDLKLLDNDKDSEQVRKMHEEALSLSKLKNLFKGLKFFINREVPREPLVFI 344

Query: 75  LRSFGAQVSWDKTLFVGATFPEDDESITHQIVDRPSIGKQYISRVFDSINAKQLAPVEKY 134
           +R FG +VSWDK LFVG+TF E DESITHQIVDRPS+ KQYISR                
Sbjct: 345 IRCFGGKVSWDKHLFVGSTFDETDESITHQIVDRPSLTKQYISRD--------------- 389

Query: 135 FIGVTLPPHLSSYYVQPQWVFDSINAKQLAPVEKYFIGVTLPPHMS 180
                        YVQPQW+FDS+N ++L P  KYFIG  LPPH+S
Sbjct: 390 -------------YVQPQWIFDSVNQRKLLPTNKYFIGAVLPPHLS 422
Required for maturation of ribosomal RNAs and formation of the large ribosomal subunit.
Aedes aegypti (taxid: 7159)
>sp|B3N8H0|PESC_DROER Pescadillo homolog OS=Drosophila erecta GN=GG24014 PE=3 SV=1 Back     alignment and function description
>sp|Q9VL96|PESC_DROME Pescadillo homolog OS=Drosophila melanogaster GN=CG4364 PE=1 SV=1 Back     alignment and function description
>sp|Q7QIX1|PESC_ANOGA Pescadillo homolog OS=Anopheles gambiae GN=AGAP007112 PE=3 SV=4 Back     alignment and function description
>sp|B4NE56|PESC_DROWI Pescadillo homolog OS=Drosophila willistoni GN=GK25349 PE=3 SV=1 Back     alignment and function description
>sp|B3MUX9|PESC_DROAN Pescadillo homolog OS=Drosophila ananassae GN=GF21889 PE=3 SV=1 Back     alignment and function description
>sp|B4Q865|PESC_DROSI Pescadillo homolog OS=Drosophila simulans GN=GD22342 PE=3 SV=1 Back     alignment and function description
>sp|P79741|PESC_DANRE Pescadillo OS=Danio rerio GN=pes PE=2 SV=2 Back     alignment and function description
>sp|B4HW93|PESC_DROSE Pescadillo homolog OS=Drosophila sechellia GN=GM12330 PE=3 SV=1 Back     alignment and function description
>sp|B4NY70|PESC_DROYA Pescadillo homolog OS=Drosophila yakuba GN=GE10391 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query325
193664630 592 PREDICTED: pescadillo homolog [Acyrthosi 0.461 0.253 0.532 1e-44
345483656 619 PREDICTED: pescadillo homolog [Nasonia v 0.452 0.237 0.539 3e-44
383865544 600 PREDICTED: pescadillo homolog [Megachile 0.409 0.221 0.564 4e-44
380030335 595 PREDICTED: pescadillo homolog [Apis flor 0.415 0.226 0.563 1e-43
350411819 590 PREDICTED: pescadillo homolog [Bombus im 0.516 0.284 0.436 2e-43
332028265 603 Pescadillo-like protein [Acromyrmex echi 0.409 0.220 0.546 3e-43
340711357 590 PREDICTED: pescadillo homolog [Bombus te 0.501 0.276 0.441 7e-43
328780283 595 PREDICTED: pescadillo homolog [Apis mell 0.409 0.223 0.558 1e-42
307182424 638 Pescadillo [Camponotus floridanus] 0.433 0.221 0.572 2e-41
307211715 607 Pescadillo [Harpegnathos saltator] 0.455 0.243 0.422 3e-39
>gi|193664630|ref|XP_001945072.1| PREDICTED: pescadillo homolog [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  186 bits (471), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 118/184 (64%), Gaps = 34/184 (18%)

Query: 8   SGMSVPMGQEEEDA-----AEFDYFPTNSEADAEKVEEFKREAEKVRKLKRLFEGLKVFL 62
           + +++P+ +  ED      AE D      + D  K EE ++E EKVRKLK+LFEGLKVFL
Sbjct: 274 AALNLPLQKTAEDVEDPADAELDLDTFAVDGDESKAEEARKEYEKVRKLKKLFEGLKVFL 333

Query: 63  NREVPREPLTLALRSFGAQVSWDKTLF-VGATFPEDDESITHQIVDRPSIGKQYISRVFD 121
           NREVPREPL  ALR FGAQVSWD+T F  GATFPE DE+ITHQIVDRP + KQYISR   
Sbjct: 334 NREVPREPLVFALRCFGAQVSWDETTFPEGATFPETDETITHQIVDRPDLEKQYISR--- 390

Query: 122 SINAKQLAPVEKYFIGVTLPPHLSSYYVQPQWVFDSINAKQLAPVEKYFIGVTLPPHMSS 181
                                    YY+QPQWVFD +NA++L PVEKYFIG  LPPH+S 
Sbjct: 391 -------------------------YYIQPQWVFDCVNARELIPVEKYFIGTPLPPHLSP 425

Query: 182 YYVQ 185
           + V+
Sbjct: 426 FTVE 429

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|345483656|ref|XP_001600892.2| PREDICTED: pescadillo homolog [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383865544|ref|XP_003708233.1| PREDICTED: pescadillo homolog [Megachile rotundata] Back     alignment and taxonomy information
>gi|380030335|ref|XP_003698804.1| PREDICTED: pescadillo homolog [Apis florea] Back     alignment and taxonomy information
>gi|350411819|ref|XP_003489463.1| PREDICTED: pescadillo homolog [Bombus impatiens] Back     alignment and taxonomy information
>gi|332028265|gb|EGI68312.1| Pescadillo-like protein [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|340711357|ref|XP_003394243.1| PREDICTED: pescadillo homolog [Bombus terrestris] Back     alignment and taxonomy information
>gi|328780283|ref|XP_001119862.2| PREDICTED: pescadillo homolog [Apis mellifera] Back     alignment and taxonomy information
>gi|307182424|gb|EFN69660.1| Pescadillo [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307211715|gb|EFN87716.1| Pescadillo [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query325
UNIPROTKB|B4Q865627 GD22342 "Pescadillo homolog" [ 0.643 0.333 0.397 1.7e-36
ZFIN|ZDB-GENE-990415-206583 pes "pescadillo" [Danio rerio 0.436 0.243 0.536 1.9e-36
UNIPROTKB|B4HW93627 GM12330 "Pescadillo homolog" [ 0.489 0.253 0.471 2.2e-36
UNIPROTKB|B4NY70628 GE10391 "Pescadillo homolog" [ 0.406 0.210 0.532 4.8e-36
UNIPROTKB|B3N8H0629 GG24014 "Pescadillo homolog" [ 0.646 0.333 0.388 4.8e-36
FB|FBgn0032138627 CG4364 [Drosophila melanogaste 0.406 0.210 0.532 6.1e-36
UNIPROTKB|B3MUX9627 GF21889 "Pescadillo homolog" [ 0.406 0.210 0.517 3.7e-35
UNIPROTKB|B4G7Y6631 GL19215 "Pescadillo homolog" [ 0.406 0.209 0.517 3.8e-35
UNIPROTKB|Q29NB4631 GA18135 "Pescadillo homolog" [ 0.406 0.209 0.517 3.8e-35
UNIPROTKB|B4LQD0633 GJ14807 "Pescadillo homolog" [ 0.406 0.208 0.510 5e-35
UNIPROTKB|B4Q865 GD22342 "Pescadillo homolog" [Drosophila simulans (taxid:7240)] Back     alignment and assigned GO terms
 Score = 397 (144.8 bits), Expect = 1.7e-36, P = 1.7e-36
 Identities = 93/234 (39%), Positives = 135/234 (57%)

Query:    16 QEEEDAAEFDYFPTNSEADAEKVEEFKREAEKVRKLKRLFEGLKVFLNREVPREPLTLAL 75
             QE+E+  + D      + D++++ + K+EA++V +L+ LF+GLK F+NREVPREPL + +
Sbjct:   287 QEDEEELDIDMELLEQDGDSKRIIKMKQEAQEVSRLRTLFKGLKFFINREVPREPLVILI 346

Query:    76 RSFGAQVSWDKTLFVGATFPEDDESITHQIVDRPSIGKQYISR-------VFDSINAKQL 128
             RSFG +VSWD ++F G+T+ E DE+ITHQIVDRPSI  QYISR       VFD +N +QL
Sbjct:   347 RSFGGKVSWDSSIFAGSTYDEGDETITHQIVDRPSISTQYISRDYIQPQWVFDCVNQRQL 406

Query:   129 APVEKYFIGVTLPPHLSSYYVQPQWVFDSINAKQLAPVEKYFIGVTLPPHMSSYYVQPQW 188
              P  KYFIG TLPPHLS +        DS     + P EK      L P +   + Q   
Sbjct:   407 LPTNKYFIGETLPPHLSPFV-------DSKRDSYIPPEEK----ALLDPSLIETHAQSDD 455

Query:   189 VFDSINAKQLAPVEKYFIGVTLPPHLSPFIDTTKTEHYVPPEA-----EDPENE 237
               +    ++   V++  +   L   L+   +T + + Y  P+      EDPE+E
Sbjct:   456 DSEDEAQEEEETVDQELLDAQL--QLAYQQETAEYKKYGGPDGVNEDEEDPEDE 507
GO:0000463 "maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)" evidence=ISS
GO:0005654 "nucleoplasm" evidence=ISS
GO:0005730 "nucleolus" evidence=ISS
ZFIN|ZDB-GENE-990415-206 pes "pescadillo" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|B4HW93 GM12330 "Pescadillo homolog" [Drosophila sechellia (taxid:7238)] Back     alignment and assigned GO terms
UNIPROTKB|B4NY70 GE10391 "Pescadillo homolog" [Drosophila yakuba (taxid:7245)] Back     alignment and assigned GO terms
UNIPROTKB|B3N8H0 GG24014 "Pescadillo homolog" [Drosophila erecta (taxid:7220)] Back     alignment and assigned GO terms
FB|FBgn0032138 CG4364 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|B3MUX9 GF21889 "Pescadillo homolog" [Drosophila ananassae (taxid:7217)] Back     alignment and assigned GO terms
UNIPROTKB|B4G7Y6 GL19215 "Pescadillo homolog" [Drosophila persimilis (taxid:7234)] Back     alignment and assigned GO terms
UNIPROTKB|Q29NB4 GA18135 "Pescadillo homolog" [Drosophila pseudoobscura pseudoobscura (taxid:46245)] Back     alignment and assigned GO terms
UNIPROTKB|B4LQD0 GJ14807 "Pescadillo homolog" [Drosophila virilis (taxid:7244)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query325
COG5163591 COG5163, NOP7, Protein required for biogenesis of 8e-23
COG5163591 COG5163, NOP7, Protein required for biogenesis of 2e-12
COG5163 591 COG5163, NOP7, Protein required for biogenesis of 3e-09
COG5163 591 COG5163, NOP7, Protein required for biogenesis of 1e-08
pfam0053377 pfam00533, BRCT, BRCA1 C Terminus (BRCT) domain 2e-04
>gnl|CDD|227492 COG5163, NOP7, Protein required for biogenesis of the 60S ribosomal subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
 Score = 98.6 bits (245), Expect = 8e-23
 Identities = 51/169 (30%), Positives = 71/169 (42%), Gaps = 32/169 (18%)

Query: 14  MGQEEEDAAEFDYFPTNSEADAEKVEEFKREAEKVRKLKRLFEGLKVFLNREVPREPLTL 73
           M +      + D F  N++         K  +     LK LF G K +++REVP + L  
Sbjct: 314 MVECRLVEEKLDTFEDNNKNKDIMEMVSKPCSS----LKSLFSGFKFYISREVPGDSLEF 369

Query: 74  ALRSFGAQVSWDKTLFVGATFPEDDESITHQIVDRPSIGKQYISRVFDSINAKQLAPVEK 133
            + S G  V             + DE +THQIVDRP +  +   R               
Sbjct: 370 IILSCGGSVVGSPCEADIHVSEKVDEKVTHQIVDRPVMKNKVEGRT-------------- 415

Query: 134 YFIGVTLPPHLSSYYVQPQWVFDSINAKQLAPVEKYFIGVTLPPHMSSY 182
                         Y+QPQW+FDSIN  +LA VE Y +G  LPPH+S +
Sbjct: 416 --------------YIQPQWLFDSINKGKLACVENYCVGKRLPPHLSPF 450

Length = 591
>gnl|CDD|227492 COG5163, NOP7, Protein required for biogenesis of the 60S ribosomal subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|227492 COG5163, NOP7, Protein required for biogenesis of the 60S ribosomal subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|227492 COG5163, NOP7, Protein required for biogenesis of the 60S ribosomal subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|215978 pfam00533, BRCT, BRCA1 C Terminus (BRCT) domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 325
KOG2481|consensus570 100.0
COG5163591 NOP7 Protein required for biogenesis of the 60S ri 100.0
KOG2481|consensus 570 99.71
COG5163 591 NOP7 Protein required for biogenesis of the 60S ri 99.39
PF0053378 BRCT: BRCA1 C Terminus (BRCT) domain; InterPro: IP 98.76
smart0029280 BRCT breast cancer carboxy-terminal domain. 98.42
cd0002772 BRCT Breast Cancer Suppressor Protein (BRCA1), car 98.02
KOG0966|consensus881 97.54
>KOG2481|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.4e-50  Score=401.45  Aligned_cols=159  Identities=53%  Similarity=0.887  Sum_probs=146.7

Q ss_pred             CCCCcccccccCCCCCCcchhHHHHHHHHHHHHHHhhhhCCCCCceEEEecccChhHHHHHHHhcCceeecCccccCCCC
Q psy14410         14 MGQEEEDAAEFDYFPTNSEADAEKVEEFKREAEKVRKLKRLFEGLKVFLNREVPREPLTLALRSFGAQVSWDKTLFVGAT   93 (325)
Q Consensus        14 ~~~~~e~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~LF~g~~FflsREvPre~LefiIrSfGG~V~wd~~~~~ga~   93 (325)
                      ...+|++|.|+|+||++++ ...+.++++++.+..+++++||+||+|||||||||++|+||||||||+|+||+ +|.|||
T Consensus       288 ~~~ee~~e~e~def~~~~~-~~~~~~~~~~e~~~~s~~kslF~glkFfl~reVPresL~fiI~s~GG~V~wd~-~~~g~~  365 (570)
T KOG2481|consen  288 PETEEEEEPELDEFPANGE-LSAQEDKMRQELEEQSSHKSLFSGLKFFLNREVPRESLEFIIRSFGGKVSWDP-LGIGAT  365 (570)
T ss_pred             hhhhhhccccccccccccc-hhhhHHHHHhhhhhhhhHHHHhhcceeeeeccCchHHHHHHHHHcCCceecCc-cCCCCc
Confidence            3344556899999999887 34566888999999999999999999999999999999999999999999999 999999


Q ss_pred             CCCCCCCCcEEEecCCCCCcccccchhhhhhhccccccchhcccccCCCCCCcccccCcchhccccccccCCcccccccc
Q psy14410         94 FPEDDESITHQIVDRPSIGKQYISRVFDSINAKQLAPVEKYFIGVTLPPHLSSYYVQPQWVFDSINAKQLAPVEKYFIGV  173 (325)
Q Consensus        94 ~~e~d~~ITHqIvDRP~~~~~~~~r~~~s~~~~~ldp~~~~~~~~~~~~~~~~~yvqPQWv~Dcin~~~llp~~~y~pG~  173 (325)
                      |+++|++|||||||||.+..++++|                                                       
T Consensus       366 ~~~~d~~ITH~IvDrP~~~~~v~gR-------------------------------------------------------  390 (570)
T KOG2481|consen  366 YDESDERITHQIVDRPGQQTSVIGR-------------------------------------------------------  390 (570)
T ss_pred             ccccccceeeeeecccCccceeeee-------------------------------------------------------
Confidence            9999999999999999999999888                                                       


Q ss_pred             cCCCCCCceEEeccceeecccccccCCCCcccCCCCCCCCcCCceecCCCCCCCCCCCcCccccc
Q psy14410        174 TLPPHMSSYYVQPQWVFDSINAKQLAPVEKYFIGVTLPPHLSPFIDTTKTEHYVPPEAEDPENER  238 (325)
Q Consensus       174 ~lPpHlsp~YVQPQwVfDsiN~~~Llp~~~Y~pG~~LPPHLSPFv~~~~~~~YvP~e~~~e~de~  238 (325)
                              .||||||||||+|++.++|+++|++|++||||||||++...+ +|+|+|++++..++
T Consensus       391 --------~YvQPQWvfDsvNar~llpt~~Y~~G~~LPpHlSPFv~~~~~-~yiP~e~l~~~~~~  446 (570)
T KOG2481|consen  391 --------TYVQPQWVFDSVNARLLLPTEKYFPGKALPPHLSPFVDEKEG-DYIPREELELLEKT  446 (570)
T ss_pred             --------eeecchhhhhhccchhhccHhhhCCCccCCcccCcccccccc-CcCChHHHhhhhhh
Confidence                    899999999999999999999999999999999999999888 99999988865555

>COG5163 NOP7 Protein required for biogenesis of the 60S ribosomal subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2481|consensus Back     alignment and domain information
>COG5163 NOP7 Protein required for biogenesis of the 60S ribosomal subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00533 BRCT: BRCA1 C Terminus (BRCT) domain; InterPro: IPR001357 The BRCT domain (after the C_terminal domain of a breast cancer susceptibility protein) is found predominantly in proteins involved in cell cycle checkpoint functions responsive to DNA damage [], for example as found in the breast cancer DNA-repair protein BRCA1 Back     alignment and domain information
>smart00292 BRCT breast cancer carboxy-terminal domain Back     alignment and domain information
>cd00027 BRCT Breast Cancer Suppressor Protein (BRCA1), carboxy-terminal domain Back     alignment and domain information
>KOG0966|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query325
2ep8_A100 Solution Structure Of The Brct Domain From Human Pe 2e-26
2ep8_A100 Solution Structure Of The Brct Domain From Human Pe 7e-05
2ep8_A100 Solution Structure Of The Brct Domain From Human Pe 9e-05
>pdb|2EP8|A Chain A, Solution Structure Of The Brct Domain From Human Pescadillo Homolog 1 Length = 100 Back     alignment and structure 
Iteration: 1

 Score =  115 bits (289), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 60/121 (49%), Positives = 69/121 (57%), Gaps = 28/121 (23%)
Query: 50  KLKRLFEGLKVFLNREVPREPLTLALRSFGAQVSWDKTLFVGATFPEDDESITHQIVDRP 109
           K K+LFEGLK FLNREVPRE L   +RSFG +VSWDK+L +GAT+   D  ITHQIVDRP
Sbjct: 8   KHKKLFEGLKFFLNREVPREALAFIIRSFGGEVSWDKSLCIGATYDVTDSRITHQIVDRP 67
Query: 110 SIGKQYISRVFDSINAKQLAPVEKYFIGVTLPPHLSSYYVQPQWVFDSINAKQLAPVEKY 169
                 I R                             YVQPQWVFDS+NA+ L PV +Y
Sbjct: 68  GQQTSVIGRC----------------------------YVQPQWVFDSVNARLLLPVAEY 99
Query: 170 F 170
           F
Sbjct: 100 F 100
>pdb|2EP8|A Chain A, Solution Structure Of The Brct Domain From Human Pescadillo Homolog 1 Length = 100 Back     alignment and structure
>pdb|2EP8|A Chain A, Solution Structure Of The Brct Domain From Human Pescadillo Homolog 1 Length = 100 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query325
2ep8_A100 Pescadillo homolog 1; A/B/A 3 layers, nucleolus, r 3e-38
2ep8_A100 Pescadillo homolog 1; A/B/A 3 layers, nucleolus, r 5e-09
2ep8_A100 Pescadillo homolog 1; A/B/A 3 layers, nucleolus, r 1e-08
2ep8_A100 Pescadillo homolog 1; A/B/A 3 layers, nucleolus, r 2e-08
1wf6_A132 Similar to S.pombe -RAD4+/CUT5+product (A40727); B 1e-09
1wf6_A132 Similar to S.pombe -RAD4+/CUT5+product (A40727); B 6e-04
2ebw_A97 DNA repair protein REV1; A/B/A 3 layers, parallel 2e-09
2ebw_A97 DNA repair protein REV1; A/B/A 3 layers, parallel 2e-05
2ebw_A97 DNA repair protein REV1; A/B/A 3 layers, parallel 8e-04
3pc6_A104 DNA repair protein XRCC1; BRCT domain, protein:pro 3e-09
3pc6_A104 DNA repair protein XRCC1; BRCT domain, protein:pro 2e-04
3pc6_A104 DNA repair protein XRCC1; BRCT domain, protein:pro 9e-04
3u3z_A199 Microcephalin; DNA repair, cell cycle regulation, 1e-07
3ii6_X263 DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alter 3e-07
1l0b_A229 BRCA1; TANDEM-BRCT, three-helix bundle, unknown fu 3e-07
1t15_A214 Breast cancer type 1 susceptibility protein; prote 5e-07
1z56_C264 DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
2nte_A210 BARD-1, BRCA1-associated ring domain protein 1; BR 2e-04
>2ep8_A Pescadillo homolog 1; A/B/A 3 layers, nucleolus, ribosome biogenesis, DNA damage, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
 Score =  130 bits (329), Expect = 3e-38
 Identities = 60/122 (49%), Positives = 69/122 (56%), Gaps = 28/122 (22%)

Query: 49  RKLKRLFEGLKVFLNREVPREPLTLALRSFGAQVSWDKTLFVGATFPEDDESITHQIVDR 108
            K K+LFEGLK FLNREVPRE L   +RSFG +VSWDK+L +GAT+   D  ITHQIVDR
Sbjct: 7   GKHKKLFEGLKFFLNREVPREALAFIIRSFGGEVSWDKSLCIGATYDVTDSRITHQIVDR 66

Query: 109 PSIGKQYISRVFDSINAKQLAPVEKYFIGVTLPPHLSSYYVQPQWVFDSINAKQLAPVEK 168
           P      I R                             YVQPQWVFDS+NA+ L PV +
Sbjct: 67  PGQQTSVIGR----------------------------CYVQPQWVFDSVNARLLLPVAE 98

Query: 169 YF 170
           YF
Sbjct: 99  YF 100
>2ep8_A Pescadillo homolog 1; A/B/A 3 layers, nucleolus, ribosome biogenesis, DNA damage, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ep8_A Pescadillo homolog 1; A/B/A 3 layers, nucleolus, ribosome biogenesis, DNA damage, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ep8_A Pescadillo homolog 1; A/B/A 3 layers, nucleolus, ribosome biogenesis, DNA damage, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1wf6_A Similar to S.pombe -RAD4+/CUT5+product (A40727); BRCT, topoisomerase II binding protein, checkpoint; NMR {Homo sapiens} SCOP: c.15.1.5 Length = 132 Back     alignment and structure
>1wf6_A Similar to S.pombe -RAD4+/CUT5+product (A40727); BRCT, topoisomerase II binding protein, checkpoint; NMR {Homo sapiens} SCOP: c.15.1.5 Length = 132 Back     alignment and structure
>2ebw_A DNA repair protein REV1; A/B/A 3 layers, parallel beta-sheet, DNA replication, translession synthesis, TLS, DNA polymerase zeta, PCNA; HET: DNA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2ebw_A DNA repair protein REV1; A/B/A 3 layers, parallel beta-sheet, DNA replication, translession synthesis, TLS, DNA polymerase zeta, PCNA; HET: DNA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2ebw_A DNA repair protein REV1; A/B/A 3 layers, parallel beta-sheet, DNA replication, translession synthesis, TLS, DNA polymerase zeta, PCNA; HET: DNA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>3pc6_A DNA repair protein XRCC1; BRCT domain, protein:protein interactions, DNA L III-alpha BRCT2 domain, DNA binding protein; HET: DNA; 1.90A {Mus musculus} PDB: 3pc8_A* 3qvg_B* 1cdz_A Length = 104 Back     alignment and structure
>3pc6_A DNA repair protein XRCC1; BRCT domain, protein:protein interactions, DNA L III-alpha BRCT2 domain, DNA binding protein; HET: DNA; 1.90A {Mus musculus} PDB: 3pc8_A* 3qvg_B* 1cdz_A Length = 104 Back     alignment and structure
>3pc6_A DNA repair protein XRCC1; BRCT domain, protein:protein interactions, DNA L III-alpha BRCT2 domain, DNA binding protein; HET: DNA; 1.90A {Mus musculus} PDB: 3pc8_A* 3qvg_B* 1cdz_A Length = 104 Back     alignment and structure
>3u3z_A Microcephalin; DNA repair, cell cycle regulation, cell cycle; HET: SEP PTR; 1.50A {Homo sapiens} PDB: 3szm_A* 3t1n_A* 3sht_A 3shv_A* Length = 199 Back     alignment and structure
>3ii6_X DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alternative splicing, coiled coil, DNA damage, DNA recombination, isopeptide bond, nucleus; HET: DNA; 2.40A {Homo sapiens} PDB: 2e2w_A* Length = 263 Back     alignment and structure
>1l0b_A BRCA1; TANDEM-BRCT, three-helix bundle, unknown function; 2.30A {Rattus norvegicus} SCOP: c.15.1.3 c.15.1.3 Length = 229 Back     alignment and structure
>1t15_A Breast cancer type 1 susceptibility protein; protein-peptide complex, antitumor protein; HET: SEP; 1.85A {Homo sapiens} SCOP: c.15.1.3 c.15.1.3 PDB: 1jnx_X* 1t29_A* 1t2v_A* 1y98_A* 3coj_X* 3k0h_A* 3k0k_A* 3pxe_A* 3pxb_A 3pxc_X 1t2u_A 1n5o_X 3pxa_A 3k15_A* 3k16_A* 3pxd_A 2ing_X 1oqa_A Length = 214 Back     alignment and structure
>1z56_C DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA ligase, coiled-coil; HET: DNA; 3.92A {Saccharomyces cerevisiae} Length = 264 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2nte_A BARD-1, BRCA1-associated ring domain protein 1; BRCT, ring finger, zinc-binding protein, ubiquitin LI antitumor protein; 1.90A {Homo sapiens} PDB: 3fa2_A 2r1z_A Length = 210 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query325
2ep8_A100 Pescadillo homolog 1; A/B/A 3 layers, nucleolus, r 99.97
1z56_C264 DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA 99.87
3pc7_A88 DNA ligase 3; DNA repair, BRCT domain, protein:pro 99.69
3pc6_A104 DNA repair protein XRCC1; BRCT domain, protein:pro 99.68
1wf6_A132 Similar to S.pombe -RAD4+/CUT5+product (A40727); B 99.59
2ebw_A97 DNA repair protein REV1; A/B/A 3 layers, parallel 99.54
4id3_A92 DNA repair protein REV1; BRCT domain, protein bind 99.41
3ii6_X263 DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alter 99.39
2nte_A210 BARD-1, BRCA1-associated ring domain protein 1; BR 99.3
3u3z_A199 Microcephalin; DNA repair, cell cycle regulation, 99.27
1z56_C264 DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA 99.22
3u3z_A199 Microcephalin; DNA repair, cell cycle regulation, 99.2
2ep8_A100 Pescadillo homolog 1; A/B/A 3 layers, nucleolus, r 99.2
2nte_A210 BARD-1, BRCA1-associated ring domain protein 1; BR 99.07
3ii6_X263 DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alter 98.97
3l3e_A107 DNA topoisomerase 2-binding protein 1; BRCT domain 98.91
1t15_A214 Breast cancer type 1 susceptibility protein; prote 98.89
2d8m_A129 DNA-repair protein XRCC1; parallel beta-sheet, DNA 98.76
1t15_A214 Breast cancer type 1 susceptibility protein; prote 98.74
2jw5_A106 DNA polymerase lambda; BRCT domain, family X polym 98.66
2cou_A109 ECT2 protein; BRCT domain, RHO GTPase, structural 98.45
3pc7_A88 DNA ligase 3; DNA repair, BRCT domain, protein:pro 98.23
1l0b_A229 BRCA1; TANDEM-BRCT, three-helix bundle, unknown fu 98.23
2vxb_A241 DNA repair protein RHP9; BRCT, nucleus, cell cycle 98.19
3pa6_A107 Microcephalin; BRCT domain, cell cycle; HET: MSE; 98.18
1kzy_C259 Tumor suppressor P53-binding protein 1; tandem-BRC 98.11
3pc6_A104 DNA repair protein XRCC1; BRCT domain, protein:pro 98.05
1wf6_A132 Similar to S.pombe -RAD4+/CUT5+product (A40727); B 97.88
1l0b_A229 BRCA1; TANDEM-BRCT, three-helix bundle, unknown fu 97.83
2ebw_A97 DNA repair protein REV1; A/B/A 3 layers, parallel 97.79
3l46_A112 Protein ECT2; alternative splicing, guanine-nucleo 97.78
2coe_A120 Deoxynucleotidyltransferase, terminal variant; BRC 97.76
3olc_X298 DNA topoisomerase 2-binding protein 1; BRCT domain 97.63
3al2_A235 DNA topoisomerase 2-binding protein 1; BRCT domain 97.52
2etx_A209 Mediator of DNA damage checkpoint protein 1; tande 97.34
4id3_A92 DNA repair protein REV1; BRCT domain, protein bind 97.34
3olc_X298 DNA topoisomerase 2-binding protein 1; BRCT domain 97.3
1kzy_C259 Tumor suppressor P53-binding protein 1; tandem-BRC 97.3
3ef0_A372 RNA polymerase II subunit A C-terminal domain phos 97.15
2etx_A209 Mediator of DNA damage checkpoint protein 1; tande 97.02
3ef1_A442 RNA polymerase II subunit A C-terminal domain phos 96.77
3al2_A235 DNA topoisomerase 2-binding protein 1; BRCT domain 96.64
2vxb_A241 DNA repair protein RHP9; BRCT, nucleus, cell cycle 96.52
3sqd_A219 PAX-interacting protein 1; tandem BRCT domains, ce 96.31
2l42_A106 DNA-binding protein RAP1; BRCT domain, protein bin 95.87
3l41_A220 BRCT-containing protein 1; BRC1, BRCT domain, tand 95.28
2d8m_A129 DNA-repair protein XRCC1; parallel beta-sheet, DNA 94.49
3l41_A220 BRCT-containing protein 1; BRC1, BRCT domain, tand 93.97
3l3e_A107 DNA topoisomerase 2-binding protein 1; BRCT domain 93.66
2dun_A133 POL MU, DNA polymerase MU; layers A/B/A, parallel 92.98
2cou_A109 ECT2 protein; BRCT domain, RHO GTPase, structural 92.35
3sqd_A219 PAX-interacting protein 1; tandem BRCT domains, ce 91.86
2jw5_A106 DNA polymerase lambda; BRCT domain, family X polym 87.73
3pa6_A107 Microcephalin; BRCT domain, cell cycle; HET: MSE; 82.84
>2ep8_A Pescadillo homolog 1; A/B/A 3 layers, nucleolus, ribosome biogenesis, DNA damage, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.97  E-value=1.3e-32  Score=219.80  Aligned_cols=94  Identities=62%  Similarity=1.054  Sum_probs=83.2

Q ss_pred             hhhhCCCCCceEEEecccChhHHHHHHHhcCceeecCccccCCCCCCCCCCCCcEEEecCCCCCcccccchhhhhhhccc
Q psy14410         49 RKLKRLFEGLKVFLNREVPREPLTLALRSFGAQVSWDKTLFVGATFPEDDESITHQIVDRPSIGKQYISRVFDSINAKQL  128 (325)
Q Consensus        49 ~~~~~LF~g~~FflsREvPre~LefiIrSfGG~V~wd~~~~~ga~~~e~d~~ITHqIvDRP~~~~~~~~r~~~s~~~~~l  128 (325)
                      .+.++||+|++|||+||+||+.|+|+||+|||+|+|+..++.|+++.++|++|||+|+|||...++.             
T Consensus         7 ~~~~~LF~g~~F~i~~e~p~~~le~~I~~~GG~v~~~~~~~~g~~~~~~~~~iTh~I~drp~~~~~~-------------   73 (100)
T 2ep8_A            7 GKHKKLFEGLKFFLNREVPREALAFIIRSFGGEVSWDKSLCIGATYDVTDSRITHQIVDRPGQQTSV-------------   73 (100)
T ss_dssp             SCSCCTTSSCEEECCSSSCHHHHHHHHHHTTCEEECCTTTSSCCCSCTTCTTCCEEECSCTTTSCCB-------------
T ss_pred             CchHHHcCCcEEEEecCCCHHHHHHHHHHcCCEEEeccccccCcccccCCCceEEEEecccchhhhc-------------
Confidence            4568999999999999999999999999999999999999999999999999999999999764322             


Q ss_pred             cccchhcccccCCCCCCcccccCcchhccccccccCCccccc
Q psy14410        129 APVEKYFIGVTLPPHLSSYYVQPQWVFDSINAKQLAPVEKYF  170 (325)
Q Consensus       129 dp~~~~~~~~~~~~~~~~~yvqPQWv~Dcin~~~llp~~~y~  170 (325)
                                     ..|.||||||||||+|+++|||.+.|+
T Consensus        74 ---------------~~r~~VqPqWV~Dcin~~~lLp~~~Y~  100 (100)
T 2ep8_A           74 ---------------IGRCYVQPQWVFDSVNARLLLPVAEYF  100 (100)
T ss_dssp             ---------------TTBEEECTHHHHHHHHHTSCCCTTTCC
T ss_pred             ---------------CCCeEEcchHHHHHHhcCCcCChhhcC
Confidence                           235688999999999999988888774
>1z56_C DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA ligase, coiled-coil; HET: DNA; 3.92A {Saccharomyces cerevisiae} Back     alignment and structure
>3pc7_A DNA ligase 3; DNA repair, BRCT domain, protein:protein interactions, XRCC1 domain, DNA binding protein; HET: DNA MSE; 1.65A {Homo sapiens} SCOP: c.15.1.2 PDB: 3pc8_C* 1imo_A* 1in1_A* 3qvg_A* Back     alignment and structure
>3pc6_A DNA repair protein XRCC1; BRCT domain, protein:protein interactions, DNA L III-alpha BRCT2 domain, DNA binding protein; HET: DNA; 1.90A {Mus musculus} SCOP: c.15.1.1 PDB: 3pc8_A* 3qvg_B* 1cdz_A Back     alignment and structure
>1wf6_A Similar to S.pombe -RAD4+/CUT5+product (A40727); BRCT, topoisomerase II binding protein, checkpoint; NMR {Homo sapiens} SCOP: c.15.1.5 Back     alignment and structure
>2ebw_A DNA repair protein REV1; A/B/A 3 layers, parallel beta-sheet, DNA replication, translession synthesis, TLS, DNA polymerase zeta, PCNA; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>4id3_A DNA repair protein REV1; BRCT domain, protein binding; HET: DNA; 1.97A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3ii6_X DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alternative splicing, coiled coil, DNA damage, DNA recombination, isopeptide bond, nucleus; HET: DNA; 2.40A {Homo sapiens} PDB: 2e2w_A* Back     alignment and structure
>2nte_A BARD-1, BRCA1-associated ring domain protein 1; BRCT, ring finger, zinc-binding protein, ubiquitin LI antitumor protein; 1.90A {Homo sapiens} PDB: 3fa2_A 2r1z_A Back     alignment and structure
>3u3z_A Microcephalin; DNA repair, cell cycle regulation, cell cycle; HET: SEP PTR; 1.50A {Homo sapiens} PDB: 3szm_A* 3t1n_A* 3sht_A 3shv_A* Back     alignment and structure
>1z56_C DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA ligase, coiled-coil; HET: DNA; 3.92A {Saccharomyces cerevisiae} Back     alignment and structure
>3u3z_A Microcephalin; DNA repair, cell cycle regulation, cell cycle; HET: SEP PTR; 1.50A {Homo sapiens} PDB: 3szm_A* 3t1n_A* 3sht_A 3shv_A* Back     alignment and structure
>2ep8_A Pescadillo homolog 1; A/B/A 3 layers, nucleolus, ribosome biogenesis, DNA damage, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2nte_A BARD-1, BRCA1-associated ring domain protein 1; BRCT, ring finger, zinc-binding protein, ubiquitin LI antitumor protein; 1.90A {Homo sapiens} PDB: 3fa2_A 2r1z_A Back     alignment and structure
>3ii6_X DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alternative splicing, coiled coil, DNA damage, DNA recombination, isopeptide bond, nucleus; HET: DNA; 2.40A {Homo sapiens} PDB: 2e2w_A* Back     alignment and structure
>1t15_A Breast cancer type 1 susceptibility protein; protein-peptide complex, antitumor protein; HET: SEP; 1.85A {Homo sapiens} SCOP: c.15.1.3 c.15.1.3 PDB: 1jnx_X* 1t29_A* 1t2v_A* 1y98_A* 3coj_X* 3k0h_A* 3k0k_A* 3pxe_A* 3pxb_A 3pxc_X 1t2u_A 1n5o_X 3pxa_A 3k15_A* 3k16_A* 3pxd_A 2ing_X 1oqa_A Back     alignment and structure
>2d8m_A DNA-repair protein XRCC1; parallel beta-sheet, DNA ligase III, poly(ADP-ribose) polymerase-1, DNA polymerase beta, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1t15_A Breast cancer type 1 susceptibility protein; protein-peptide complex, antitumor protein; HET: SEP; 1.85A {Homo sapiens} SCOP: c.15.1.3 c.15.1.3 PDB: 1jnx_X* 1t29_A* 1t2v_A* 1y98_A* 3coj_X* 3k0h_A* 3k0k_A* 3pxe_A* 3pxb_A 3pxc_X 1t2u_A 1n5o_X 3pxa_A 3k15_A* 3k16_A* 3pxd_A 2ing_X 1oqa_A Back     alignment and structure
>2jw5_A DNA polymerase lambda; BRCT domain, family X polymerase, nonhomologous END joining (NHEJ), DNA damage, DNA repair, DNA replication, DNA synthesis; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>2cou_A ECT2 protein; BRCT domain, RHO GTPase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3pc7_A DNA ligase 3; DNA repair, BRCT domain, protein:protein interactions, XRCC1 domain, DNA binding protein; HET: DNA MSE; 1.65A {Homo sapiens} SCOP: c.15.1.2 PDB: 3pc8_C* 1imo_A* 1in1_A* 3qvg_A* Back     alignment and structure
>1l0b_A BRCA1; TANDEM-BRCT, three-helix bundle, unknown function; 2.30A {Rattus norvegicus} SCOP: c.15.1.3 c.15.1.3 Back     alignment and structure
>2vxb_A DNA repair protein RHP9; BRCT, nucleus, cell cycle, DNA damage, DNA replication inhibitor, phosphoprotein, checkpoint signalling; HET: DNA; 2.3A {Schizosaccharomyces pombe} PDB: 2vxc_A* Back     alignment and structure
>3pa6_A Microcephalin; BRCT domain, cell cycle; HET: MSE; 1.50A {Homo sapiens} PDB: 3ktf_A* 2wt8_A* Back     alignment and structure
>1kzy_C Tumor suppressor P53-binding protein 1; tandem-BRCT and linker complexed with non-BRCT protein, three-helix bundle, parallel beta sheet; 2.50A {Homo sapiens} SCOP: c.15.1.4 c.15.1.4 PDB: 1gzh_B Back     alignment and structure
>3pc6_A DNA repair protein XRCC1; BRCT domain, protein:protein interactions, DNA L III-alpha BRCT2 domain, DNA binding protein; HET: DNA; 1.90A {Mus musculus} SCOP: c.15.1.1 PDB: 3pc8_A* 3qvg_B* 1cdz_A Back     alignment and structure
>1wf6_A Similar to S.pombe -RAD4+/CUT5+product (A40727); BRCT, topoisomerase II binding protein, checkpoint; NMR {Homo sapiens} SCOP: c.15.1.5 Back     alignment and structure
>1l0b_A BRCA1; TANDEM-BRCT, three-helix bundle, unknown function; 2.30A {Rattus norvegicus} SCOP: c.15.1.3 c.15.1.3 Back     alignment and structure
>2ebw_A DNA repair protein REV1; A/B/A 3 layers, parallel beta-sheet, DNA replication, translession synthesis, TLS, DNA polymerase zeta, PCNA; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>3l46_A Protein ECT2; alternative splicing, guanine-nucleotide releasing factor, phosphoprotein, polymorphism, proto-oncogene, structural genomics; 1.48A {Homo sapiens} Back     alignment and structure
>2coe_A Deoxynucleotidyltransferase, terminal variant; BRCT domain, DNA polymerase, teminal deoxynucleotidyltransferase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3olc_X DNA topoisomerase 2-binding protein 1; BRCT domain, DNA repair, RAD9, DNA binding protein; HET: DNA; 2.40A {Homo sapiens} PDB: 2xnk_A* 2xnh_A* Back     alignment and structure
>3al2_A DNA topoisomerase 2-binding protein 1; BRCT domain, protein binding, DNA binding protein; HET: DNA MSE; 2.00A {Homo sapiens} PDB: 3al3_A* Back     alignment and structure
>2etx_A Mediator of DNA damage checkpoint protein 1; tandem BRCT domains histone gamma-H2AX, cell cycle; 1.33A {Homo sapiens} PDB: 2azm_A* 3k05_A* 2ado_A Back     alignment and structure
>4id3_A DNA repair protein REV1; BRCT domain, protein binding; HET: DNA; 1.97A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3olc_X DNA topoisomerase 2-binding protein 1; BRCT domain, DNA repair, RAD9, DNA binding protein; HET: DNA; 2.40A {Homo sapiens} PDB: 2xnk_A* 2xnh_A* Back     alignment and structure
>1kzy_C Tumor suppressor P53-binding protein 1; tandem-BRCT and linker complexed with non-BRCT protein, three-helix bundle, parallel beta sheet; 2.50A {Homo sapiens} SCOP: c.15.1.4 c.15.1.4 PDB: 1gzh_B Back     alignment and structure
>3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Back     alignment and structure
>2etx_A Mediator of DNA damage checkpoint protein 1; tandem BRCT domains histone gamma-H2AX, cell cycle; 1.33A {Homo sapiens} PDB: 2azm_A* 3k05_A* 2ado_A Back     alignment and structure
>3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} Back     alignment and structure
>3al2_A DNA topoisomerase 2-binding protein 1; BRCT domain, protein binding, DNA binding protein; HET: DNA MSE; 2.00A {Homo sapiens} PDB: 3al3_A* Back     alignment and structure
>2vxb_A DNA repair protein RHP9; BRCT, nucleus, cell cycle, DNA damage, DNA replication inhibitor, phosphoprotein, checkpoint signalling; HET: DNA; 2.3A {Schizosaccharomyces pombe} PDB: 2vxc_A* Back     alignment and structure
>3sqd_A PAX-interacting protein 1; tandem BRCT domains, cell cycle; HET: SEP; 2.15A {Homo sapiens} Back     alignment and structure
>2l42_A DNA-binding protein RAP1; BRCT domain, protein binding; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3l41_A BRCT-containing protein 1; BRC1, BRCT domain, tandem BRCT repeat, phosphoserine binding domain, DNA repair, cell division, mitosis; HET: SEP; 1.45A {Schizosaccharomyces pombe} PDB: 3l40_A* Back     alignment and structure
>2d8m_A DNA-repair protein XRCC1; parallel beta-sheet, DNA ligase III, poly(ADP-ribose) polymerase-1, DNA polymerase beta, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3l41_A BRCT-containing protein 1; BRC1, BRCT domain, tandem BRCT repeat, phosphoserine binding domain, DNA repair, cell division, mitosis; HET: SEP; 1.45A {Schizosaccharomyces pombe} PDB: 3l40_A* Back     alignment and structure
>2dun_A POL MU, DNA polymerase MU; layers A/B/A, parallel beta-sheet of 4 strands, non- homologous END jonting, somatic hypermutation, V(D)J recombination; HET: DNA; NMR {Homo sapiens} PDB: 2htf_A* Back     alignment and structure
>2cou_A ECT2 protein; BRCT domain, RHO GTPase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3sqd_A PAX-interacting protein 1; tandem BRCT domains, cell cycle; HET: SEP; 2.15A {Homo sapiens} Back     alignment and structure
>2jw5_A DNA polymerase lambda; BRCT domain, family X polymerase, nonhomologous END joining (NHEJ), DNA damage, DNA repair, DNA replication, DNA synthesis; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>3pa6_A Microcephalin; BRCT domain, cell cycle; HET: MSE; 1.50A {Homo sapiens} PDB: 3ktf_A* 2wt8_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 325
d1cdza_96 c.15.1.1 (A:) DNA-repair protein XRCC1 {Human (Hom 9e-11
d1cdza_96 c.15.1.1 (A:) DNA-repair protein XRCC1 {Human (Hom 0.002
d1in1a_88 c.15.1.2 (A:) DNA ligase III alpha {Human (Homo sa 6e-09
d1t15a2102 c.15.1.3 (A:1758-1859) Breast cancer associated pr 9e-09
d1t15a2102 c.15.1.3 (A:1758-1859) Breast cancer associated pr 0.002
d1t15a2102 c.15.1.3 (A:1758-1859) Breast cancer associated pr 0.004
d1wf6a_132 c.15.1.5 (A:) DNA topoisomerase II binding protein 1e-06
d1wf6a_132 c.15.1.5 (A:) DNA topoisomerase II binding protein 0.002
d1wf6a_132 c.15.1.5 (A:) DNA topoisomerase II binding protein 0.004
>d1cdza_ c.15.1.1 (A:) DNA-repair protein XRCC1 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: BRCT domain
superfamily: BRCT domain
family: DNA-repair protein XRCC1
domain: DNA-repair protein XRCC1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 55.9 bits (134), Expect = 9e-11
 Identities = 19/122 (15%), Positives = 38/122 (31%), Gaps = 30/122 (24%)

Query: 50  KLKRLFEGLKVFLNREVPREPLTLALRSFGAQVSWDKTLFVGATFPEDDESITHQIVDRP 109
           +L   F+G   FL  E P +     +R   A        F G       + +   I  + 
Sbjct: 1   ELPDFFQGKHFFLYGEFPGDERRKLIRYVTA--------FNGELEDYMSDRVQFVITAQE 52

Query: 110 SIGKQYISRVFDSINAKQLAPVEKYFIGVTLPPHLSSYYVQPQWVFDSINAKQLAPVEKY 169
                  + +                       + S  +V+P+W++     ++L P + Y
Sbjct: 53  WDPSFEEALMD----------------------NPSLAFVRPRWIYSCNEKQKLLPHQLY 90

Query: 170 FI 171
            +
Sbjct: 91  GV 92
>d1cdza_ c.15.1.1 (A:) DNA-repair protein XRCC1 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1in1a_ c.15.1.2 (A:) DNA ligase III alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1t15a2 c.15.1.3 (A:1758-1859) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1t15a2 c.15.1.3 (A:1758-1859) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1t15a2 c.15.1.3 (A:1758-1859) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1wf6a_ c.15.1.5 (A:) DNA topoisomerase II binding protein 1, TopBP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 132 Back     information, alignment and structure
>d1wf6a_ c.15.1.5 (A:) DNA topoisomerase II binding protein 1, TopBP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 132 Back     information, alignment and structure
>d1wf6a_ c.15.1.5 (A:) DNA topoisomerase II binding protein 1, TopBP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 132 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query325
d1in1a_88 DNA ligase III alpha {Human (Homo sapiens) [TaxId: 99.61
d1t15a2102 Breast cancer associated protein, BRCA1 {Human (Ho 99.44
d1cdza_96 DNA-repair protein XRCC1 {Human (Homo sapiens) [Ta 99.4
d1wf6a_132 DNA topoisomerase II binding protein 1, TopBP1 {Hu 99.0
d1t15a1109 Breast cancer associated protein, BRCA1 {Human (Ho 97.67
d1in1a_88 DNA ligase III alpha {Human (Homo sapiens) [TaxId: 97.57
d1cdza_96 DNA-repair protein XRCC1 {Human (Homo sapiens) [Ta 97.29
d1t15a2102 Breast cancer associated protein, BRCA1 {Human (Ho 97.28
d1kzyc1153 53BP1 {Human (Homo sapiens) [TaxId: 9606]} 97.26
d1wf6a_132 DNA topoisomerase II binding protein 1, TopBP1 {Hu 95.04
d1t15a1109 Breast cancer associated protein, BRCA1 {Human (Ho 89.17
d1l0ba297 Breast cancer associated protein, BRCA1 {Rat (Ratt 86.51
>d1in1a_ c.15.1.2 (A:) DNA ligase III alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: BRCT domain
superfamily: BRCT domain
family: DNA ligase
domain: DNA ligase III alpha
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.61  E-value=7e-17  Score=124.88  Aligned_cols=76  Identities=22%  Similarity=0.422  Sum_probs=63.4

Q ss_pred             HhhhhCCCCCceEEEecccC-hhHHHHHHHhcCceeecCccccCCCCCCCCCCCCcEEEecCCCCCcccccchhhhhhhc
Q psy14410         48 VRKLKRLFEGLKVFLNREVP-REPLTLALRSFGAQVSWDKTLFVGATFPEDDESITHQIVDRPSIGKQYISRVFDSINAK  126 (325)
Q Consensus        48 ~~~~~~LF~g~~FflsREvP-re~LefiIrSfGG~V~wd~~~~~ga~~~e~d~~ITHqIvDRP~~~~~~~~r~~~s~~~~  126 (325)
                      .+.+.+||+|++|||++++| ++.|+.+|.+|||++.++-          +..++||.|.+|+...+             
T Consensus        10 ~k~l~diF~G~~~~i~~~~p~~~~L~r~i~a~GG~~~~~~----------~~~~vTHvI~~~~~~~~-------------   66 (88)
T d1in1a_          10 TKVLLDIFTGVRLYLPPSTPDFSRLRRYFVAFDGDLVQEF----------DMTSATHVLGSRDKNPA-------------   66 (88)
T ss_dssp             TTCCCSSSTTCBCCCCTTSTTHHHHHHHHHHHTCBCCCTT----------CCTTCCCEESCCTTCTT-------------
T ss_pred             ccchhhHhCCeEEEECCCCCCHHHHHHHHHHhCCEEeeec----------cCCCceEEEEcCCCCCC-------------
Confidence            45689999999999999998 9999999999999998752          23569999999864211             


Q ss_pred             cccccchhcccccCCCCCCcccccCcchhccccccccCC
Q psy14410        127 QLAPVEKYFIGVTLPPHLSSYYVQPQWVFDSINAKQLAP  165 (325)
Q Consensus       127 ~ldp~~~~~~~~~~~~~~~~~yvqPQWv~Dcin~~~llp  165 (325)
                                         ..+|+||||+||+|+++|||
T Consensus        67 -------------------~~iV~p~Wi~dci~~~~lLP   86 (88)
T d1in1a_          67 -------------------AQQVSPEWIWACIRKRRLVA   86 (88)
T ss_dssp             -------------------SCEECHHHHHHHHHHTSCCC
T ss_pred             -------------------cEEEehHHHHHHHHcCCcCC
Confidence                               24799999999999999886
>d1t15a2 c.15.1.3 (A:1758-1859) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cdza_ c.15.1.1 (A:) DNA-repair protein XRCC1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf6a_ c.15.1.5 (A:) DNA topoisomerase II binding protein 1, TopBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t15a1 c.15.1.3 (A:1649-1757) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1in1a_ c.15.1.2 (A:) DNA ligase III alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cdza_ c.15.1.1 (A:) DNA-repair protein XRCC1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t15a2 c.15.1.3 (A:1758-1859) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kzyc1 c.15.1.4 (C:1714-1866) 53BP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf6a_ c.15.1.5 (A:) DNA topoisomerase II binding protein 1, TopBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t15a1 c.15.1.3 (A:1649-1757) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0ba2 c.15.1.3 (A:1705-1801) Breast cancer associated protein, BRCA1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure