Psyllid ID: psy14428


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580---
LAIVQGISGSGSLRVGTAFLERFYPGVKTVYFPTPTWNGHVRFCTDSRLNVGAYRYFDNKTNGLDFAGMMEDIKLAIVQGISGSGSLRVGTAFLERFYPGVKTVYFPTPTWNGHVRFCTDSRLNVGAYRYFDNKTNGLDFAGMMEDIKPLKQQLKGFNKDPHPKKMNLGVGAYRGEDGKPYVLPSVKEAERRIYEKNLDHEYANIGGDAKFCKLAAQLAYGEDFPAFKDNRLAIVQGISGSGSLRVGTAFLERFYPGVKTVYFPTPTWNGHVRFCTDSRLNVGAYRYFDNKTNGLDFAGMMEDIKAMPERSILFLQTSSHNPTGVDLSEDQWRQLAVVVKQRHLYPFFDMAYLGLTSGDFDKDAFSLRYFAKEVGQLCLAQSFSKNMGLYGERVGTFSVLTPTSDETERIMSQLKILIRGFYSNPPIHGARIVTEILSDPKLKAQCDETERIMSQLKILIRGFYSNPPIHGARIVTEILSDPKLKAQWFEECKGMSNRISSIREELKSKILDKGSKKNWDHITNQKGMFCYTGLSASQGMSNRISSIREELKSKILDKGSKKNWDHITNQKGMFCYTGLSASQ
cEEEEccccHHHHHHHHHHHHHHcccccEEEEcccccccHHHHHHHccccccccccccccccccccccHHHHHHHHHHcccccccccccHHHHHHccccccccccccHHHHHHHHHHHHHcccccccccEEEcccccccccccccccHHHHHHHHHHccccccccccccccEEEcccccccccHHHHHHHHHHHccccccccccccccHHHHHHHHHHHccccccccccccEEEEEccccHHHHHHHHHHHHHHcccccEEEEcccccccHHHHHHHcccccccccccccccccccHHHHHHHHHccccccEEEEEccccccccccccHHHHHHHHHHHHHccccccEEcccccccccccHHHHHHHHHHHHHcccEEEEEccccccccccccccEEEEEcccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHccEEEccccccHHHHHHHHHHHHHHHHHccccc
ccEEEEEHHHHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHccEEEEEEcEEccccEEcHHHHHHHHcccEEEEEHHHHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHcccEEEEEEcEEccccEEcHHHHHHHHcHHHHHHHHHHcccccccEEccccccccccccccccHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHccccHHHHcccEEEEEEEHHHHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHccEEEEEEcEEccccEEcHHHHHHHHHccccccEEEEEccccccccccccHHHHHHHHHHHHHcccEEEEEEcccccccccHHHHcHHHHHHHHcccccEEEEEcccccccHHHcEEEEEEEcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHccccEEEccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHccccEEEccccHHH
laivqgisgsgslrVGTAFLErfypgvktvyfptptwnghvrfctdsrlnvgayryfdnktngldfaGMMEDIKLAIVQGisgsgslrvGTAFLErfypgvktvyfptptwnghvrfctdsrlnvgayryfdnktngldfagmmeDIKPLKQQlkgfnkdphpkkmnlgvgayrgedgkpyvlpsvkEAERRIYEKNLdheyaniggdAKFCKLAAQLaygedfpafkdNRLAIVQGIsgsgslrvGTAFLErfypgvktvyfptptwnghvrfctdsrlnvgayryfdnktngldfagmMEDIKAMPERSILFLqtsshnptgvdlseDQWRQLAVVVKQRhlypffdmaylgltsgdfdkdaFSLRYFAKEVGQLCLAQSFsknmglygervgtfsvltptsdeTERIMSQLKILIRGfysnppihgaRIVTEilsdpklkaqCDETERIMSQLKILIRGfysnppihgaRIVTEilsdpklkAQWFEECKGMSNRISSIREELKSKIldkgskknwdhitnqkgmfcytglsasqgMSNRISSIREELKSKIldkgskknwdhitnqkgmfcytglsasq
laivqgisgsgslrvGTAFLERFYPGVKTVyfptptwnghVRFCTDSRLNVGAYRYFDNKTNGLDFAGMMEDIKLAIVQGISGSGSLRVGTAFLERFYPGVKTVyfptptwnghVRFCTDSRLNVGAYRYFDNKTNGLDFAGMMEDIKPLKQQLKgfnkdphpKKMNLgvgayrgedgkpyvlPSVKEAERRIYEKNLDHEYANIGGDAKFCKLAAQLAYGEDFPAFKDNRLAIVQGISGSGSLRVGTAFLERFYPGVKTVyfptptwnghVRFCTDSRLNVGAYRYFDNKTNGLDFAGMMEDIKAMPERSILFLQTSSHNPTGVDLSEDQWRQLAVVVKQRHLYPFFDMAYLGLTSGDFDKDAFSLRYFAKEVGQLCLAQSFSKNMGLYGERVGTFSVLTPTSDETERIMSQLKILIRGFYSNPPIHGARIVTEILSDPKLKAQCDETERIMSQLKILIRGFYSNPPIHGARIVTEILSDPKLKAQWFEECKGMSNRISSIREELKSkildkgskknwdhiTNQKGMFCYTGLSASQGMSNRISSIREELKSkildkgskknwdhitnqkgmfcytglsasq
LAIVQGISGSGSLRVGTAFLERFYPGVKTVYFPTPTWNGHVRFCTDSRLNVGAYRYFDNKTNGLDFAGMMEDIKLAIVQGISGSGSLRVGTAFLERFYPGVKTVYFPTPTWNGHVRFCTDSRLNVGAYRYFDNKTNGLDFAGMMEDIKPLKQQLKGFNKDPHPKKMNLGVGAYRGEDGKPYVLPSVKEAERRIYEKNLDHEYANIGGDAKFCKLAAQLAYGEDFPAFKDNRLAIVQGISGSGSLRVGTAFLERFYPGVKTVYFPTPTWNGHVRFCTDSRLNVGAYRYFDNKTNGLDFAGMMEDIKAMPERSILFLQTSSHNPTGVDLSEDQWRQLAVVVKQRHLYPFFDMAYLGLTSGDFDKDAFSLRYFAKEVGQLCLAQSFSKNMGLYGERVGTFSVLTPTSDETERIMSQLKILIRGFYSNPPIHGARIVTEILSDPKLKAQCDETERIMSQLKILIRGFYSNPPIHGARIVTEILSDPKLKAQWFEECKGMSNRISSIREELKSKILDKGSKKNWDHITNQKGMFCYTGLSASQGMSNRISSIREELKSKILDKGSKKNWDHITNQKGMFCYTGLSASQ
**********GSLRVGTAFLERFYPGVKTVYFPTPTWNGHVRFCTDSRLNVGAYRYFDNKTNGLDFAGMMEDIKLAIVQGISGSGSLRVGTAFLERFYPGVKTVYFPTPTWNGHVRFCTDSRLNVGAYRYFDNKTNGLDFAGMMEDI**********************VGAYR****KPYVLPSVKEAERRIYEKNLDHEYANIGGDAKFCKLAAQLAYGEDFPAFKDNRLAIVQGISGSGSLRVGTAFLERFYPGVKTVYFPTPTWNGHVRFCTDSRLNVGAYRYFDNKTNGLDFAGMMEDIKAMPERSILFLQTSS**PTGVDLSEDQWRQLAVVVKQRHLYPFFDMAYLGLTSGDFDKDAFSLRYFAKEVGQLCLAQSFSKNMGLYGERVGTFSVLTPTSDETERIMSQLKILIRGFYSNPPIHGARIVTEILSDPKLKAQCDETERIMSQLKILIRGFYSNPPIHGARIVTEILSDPKLKAQWFEECKGMSN*******************KNWDHITNQKGMFCYTGLS***************************NWDHITNQKGMFCYTG*****
LAIVQGISGSGSLRVGTAFLERFYPGVKTVYFPTPTWNGHVRFCTDSRLNVGAYRYFDNKTNGLDFAGMMEDIKLAIVQGISGSGSLRVGTAFLERFYPGVKTVYFPTPTWNGHVRFCTDSRLNVGAYRYFDNKTNGLDFAGMMEDIKPLKQQLKGFNKDPHPKKMNLGVGAYRGEDGKPYVLPSVKEAERRIYEKNLDHEYANIGGDAKFCKLAAQLAYGEDFPAFKDNRLAIVQGISGSGSLRVGTAFLERFYPGVKTVYFPTPTWNGHVRFCTDSRLNVGAYRYFDNKTNGLDFAGMMEDIKAMPERSILFLQTSSHNPTGVDLSEDQWRQLAVVVKQRHLYPFFDMAYLGLTSGDFDKDAFSLRYFAKEVGQLCLAQSFSKNMGLYGERVGTFSVLTPTSDETERIMSQLKILIRGFYSNPPIHGARIVTEILSDPKLKAQCDETERIMSQLKILIRGFYSNPPIHGARIVTEILSDPKLKAQWFEECKGMSNRISSIREELKSKILDKGSKKNWDHITNQKGMFCYTGLSASQGMSNRISSIREELKSKILDKGSKKNWDHITNQKGMFCYTGLS***
********GSGSLRVGTAFLERFYPGVKTVYFPTPTWNGHVRFCTDSRLNVGAYRYFDNKTNGLDFAGMMEDIKLAIVQGISGSGSLRVGTAFLERFYPGVKTVYFPTPTWNGHVRFCTDSRLNVGAYRYFDNKTNGLDFAGMMEDIKPLKQQLKGFNKDPHPKKMNLGVGAYRGEDGKPYVLPSVKEAERRIYEKNLDHEYANIGGDAKFCKLAAQLAYGEDFPAFKDNRLAIVQGISGSGSLRVGTAFLERFYPGVKTVYFPTPTWNGHVRFCTDSRLNVGAYRYFDNKTNGLDFAGMMEDIKAMPERSILFLQTSSHNPTGVDLSEDQWRQLAVVVKQRHLYPFFDMAYLGLTSGDFDKDAFSLRYFAKEVGQLCLAQSFSKNMGLYGERVGTFSVLTPTSDETERIMSQLKILIRGFYSNPPIHGARIVTEILSDPKLKAQCDETERIMSQLKILIRGFYSNPPIHGARIVTEILSDPKLKAQWFEECKGMSNRISSIREELKSKILDKGSKKNWDHITNQKGMFCYTGLSASQGMSNRISSIREELKSKILDKGSKKNWDHITNQKGMFCYTGLSASQ
LAIVQGISGSGSLRVGTAFLERFYPGVKTVYFPTPTWNGHVRFCTDSRLNVGAYRYFDNKTNGLDFAGMMEDIKLAIVQGISGSGSLRVGTAFLERFYPGVKTVYFPTPTWNGHVRFCTDSRLNVGAYRYFDNKTNGLDFAGMMEDIKPLKQQLKGFNKDPHPKKMNLGVGAYRGEDGKPYVLPSVKEAERRIYEKNLDHEYANIGGDAKFCKLAAQLAYGEDFPAFKDNRLAIVQGISGSGSLRVGTAFLERFYPGVKTVYFPTPTWNGHVRFCTDSRLNVGAYRYFDNKTNGLDFAGMMEDIKAMPERSILFLQTSSHNPTGVDLSEDQWRQLAVVVKQRHLYPFFDMAYLGLTSGDFDKDAFSLRYFAKEVGQLCLAQSFSKNMGLYGERVGTFSVLTPTSDETERIMSQLKILIRGFYSNPPIHGARIVTEILSDPKLKAQCDETERIMSQLKILIRGFYSNPPIHGARIVTEILSDPKLKAQWFEECKGMSNRISSIREELKSKILDKGSKKNWDHITNQKGMFCYTGLSASQGMSNRISSIREELKSKILDKGSKKNWDHITNQKGMFCYTGLSA**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LAIVQGISGSGSLRVGTAFLERFYPGVKTVYFPTPTWNGHVRFCTDSRLNVGAYRYFDNKTNGLDFAGMMEDIKLAIVQGISGSGSLRVGTAFLERFYPGVKTVYFPTPTWNGHVRFCTDSRLNVGAYRYFDNKTNGLDFAGMMEDIKPLKQQLKGFNKDPHPKKMNLGVGAYRGEDGKPYVLPSVKEAERRIYEKNLDHEYANIGGDAKFCKLAAQLAYGEDFPAFKDNRLAIVQGISGSGSLRVGTAFLERFYPGVKTVYFPTPTWNGHVRFCTDSRLNVGAYRYFDNKTNGLDFAGMMEDIKAMPERSILFLQTSSHNPTGVDLSEDQWRQLAVVVKQRHLYPFFDMAYLGLTSGDFDKDAFSLRYFAKEVGQLCLAQSFSKNMGLYGERVGTFSVLTPTSDETERIMSQLKILIRGFYSNPPIHGARIVTEILSDPKLKAQCDETERIMSQLKILIRGFYSNPPIHGARIVTEILSDPKLKAQWFEECKGMSNRISSIREELKSKILDKGSKKNWDHITNQKGMFCYTGLSASQGMSNRISSIREELKSKILDKGSKKNWDHITNQKGMFCYTGLSASQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query583 2.2.26 [Sep-21-2011]
P05202430 Aspartate aminotransferas yes N/A 0.596 0.809 0.466 1e-103
P00507430 Aspartate aminotransferas yes N/A 0.596 0.809 0.466 1e-103
Q4R559430 Aspartate aminotransferas N/A N/A 0.596 0.809 0.464 1e-103
Q5REB0430 Aspartate aminotransferas yes N/A 0.596 0.809 0.464 1e-103
P00505430 Aspartate aminotransferas yes N/A 0.596 0.809 0.464 1e-102
Q28F67427 Aspartate aminotransferas yes N/A 0.596 0.814 0.464 1e-102
P12344430 Aspartate aminotransferas yes N/A 0.596 0.809 0.458 1e-101
P08907401 Aspartate aminotransferas yes N/A 0.596 0.867 0.456 1e-101
P00506430 Aspartate aminotransferas yes N/A 0.596 0.809 0.448 1e-100
P00508423 Aspartate aminotransferas yes N/A 0.596 0.822 0.458 3e-98
>sp|P05202|AATM_MOUSE Aspartate aminotransferase, mitochondrial OS=Mus musculus GN=Got2 PE=1 SV=1 Back     alignment and function desciption
 Score =  377 bits (968), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 182/390 (46%), Positives = 249/390 (63%), Gaps = 42/390 (10%)

Query: 149 PLKQQLKGFNKDPHPKKMNLGVGAYRGEDGKPYVLPSVKEAERRIYEKNLDHEYANIGGD 208
           P+    + F +D + KKMNLGVGAYR ++GKPYVLPSV++AE +I  KNLD EY  IGG 
Sbjct: 43  PILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGL 102

Query: 209 AKFCKLAAQLAYGEDFPAFKDNRLAIVQGISGSGSLRVGTAFLERFYPGVKTVYFPTPTW 268
           A+FCK +A+LA GE+    K  R   VQ ISG+G+LRVG +FL+RF+   + V+ P P+W
Sbjct: 103 AEFCKASAELALGENNEVLKSGRFVTVQTISGTGALRVGASFLQRFFKFSRDVFLPKPSW 162

Query: 269 NGHVRFCTDSRLNVGAYRYFDNKTNGLDFAGMMEDIKAMPERSILFLQTSSHNPTGVDLS 328
             H     D+ + +  YRY+D KT G DF+G +EDI  +PE+S+L L   +HNPTGVD  
Sbjct: 163 GNHTPIFRDAGMQLQGYRYYDPKTCGFDFSGALEDISKIPEQSVLLLHACAHNPTGVDPR 222

Query: 329 EDQWRQLAVVVKQRHLYPFFDMAYLGLTSGDFDKDAFSLRYFAKEVGQLCLAQSFSKNMG 388
            +QW+++A VVK+++L+ FFDMAY G  SGD DKDA+++R+F ++   +CL QS++KNMG
Sbjct: 223 PEQWKEIASVVKKKNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMG 282

Query: 389 LYGERVGTFSVLTPTSDETERIMSQLKILIRGFYSNPPIHGARIVTEILSDPKLKAQCDE 448
           LYGERVG F+V+   ++E +R+ SQLKILIR  YSNPP++GARI   IL+ P L      
Sbjct: 283 LYGERVGAFTVVCKDAEEAKRVESQLKILIRPLYSNPPLNGARIAATILTSPDL------ 336

Query: 449 TERIMSQLKILIRGFYSNPPIHGARIVTEILSDPKLKAQWFEECKGMSNRISSIREELKS 508
                                               + QW +E KGM++RI S+R +L S
Sbjct: 337 ------------------------------------RKQWLQEVKGMADRIISMRTQLVS 360

Query: 509 KILDKGSKKNWDHITNQKGMFCYTGLSASQ 538
            +  +GS  NW HIT+Q GMFC+TGL   Q
Sbjct: 361 NLKKEGSSHNWQHITDQIGMFCFTGLKPEQ 390




Plays a key role in amino acid metabolism. Important for metabolite exchange between mitochondria and cytosol. Facilitates cellular uptake of long-chain free fatty acids.
Mus musculus (taxid: 10090)
EC: 2EC: .EC: 6EC: .EC: 1EC: .EC: 1
>sp|P00507|AATM_RAT Aspartate aminotransferase, mitochondrial OS=Rattus norvegicus GN=Got2 PE=1 SV=2 Back     alignment and function description
>sp|Q4R559|AATM_MACFA Aspartate aminotransferase, mitochondrial OS=Macaca fascicularis GN=GOT2 PE=2 SV=1 Back     alignment and function description
>sp|Q5REB0|AATM_PONAB Aspartate aminotransferase, mitochondrial OS=Pongo abelii GN=GOT2 PE=2 SV=1 Back     alignment and function description
>sp|P00505|AATM_HUMAN Aspartate aminotransferase, mitochondrial OS=Homo sapiens GN=GOT2 PE=1 SV=3 Back     alignment and function description
>sp|Q28F67|AATM_XENTR Aspartate aminotransferase, mitochondrial OS=Xenopus tropicalis GN=got2 PE=2 SV=1 Back     alignment and function description
>sp|P12344|AATM_BOVIN Aspartate aminotransferase, mitochondrial OS=Bos taurus GN=GOT2 PE=1 SV=2 Back     alignment and function description
>sp|P08907|AATM_HORSE Aspartate aminotransferase, mitochondrial OS=Equus caballus GN=GOT2 PE=1 SV=1 Back     alignment and function description
>sp|P00506|AATM_PIG Aspartate aminotransferase, mitochondrial OS=Sus scrofa GN=GOT2 PE=1 SV=2 Back     alignment and function description
>sp|P00508|AATM_CHICK Aspartate aminotransferase, mitochondrial OS=Gallus gallus GN=GOT2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query583
91084123423 PREDICTED: similar to aspartate aminotra 0.586 0.808 0.505 1e-110
452988474423 hypothetical protein MYCFIDRAFT_209746 [ 0.586 0.808 0.513 1e-109
332372484424 unknown [Dendroctonus ponderosae] 0.586 0.806 0.486 1e-108
378733812428 aspartate aminotransferase [Exophiala de 0.586 0.799 0.502 1e-108
452846713427 hypothetical protein DOTSEDRAFT_67626 [D 0.586 0.800 0.507 1e-107
170040614429 aspartate aminotransferase [Culex quinqu 0.586 0.797 0.494 1e-107
453089098429 aspartate aminotransferase [Mycosphaerel 0.586 0.797 0.510 1e-107
330931763425 hypothetical protein PTT_15769 [Pyrenoph 0.586 0.804 0.5 1e-105
396464635426 similar to mitochondrial aspartate amino 0.586 0.802 0.497 1e-105
449300498427 hypothetical protein BAUCODRAFT_33868 [B 0.598 0.817 0.489 1e-105
>gi|91084123|ref|XP_967224.1| PREDICTED: similar to aspartate aminotransferase [Tribolium castaneum] gi|270006661|gb|EFA03109.1| hypothetical protein TcasGA2_TC013019 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  404 bits (1039), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 194/384 (50%), Positives = 252/384 (65%), Gaps = 42/384 (10%)

Query: 155 KGFNKDPHPKKMNLGVGAYRGEDGKPYVLPSVKEAERRIYEKNLDHEYANIGGDAKFCKL 214
           + F +D +P K+NLGVGAYR ++GKPYVLPSV++AE ++  KNLD EYA I G A+FCK 
Sbjct: 42  EAFKRDTNPNKINLGVGAYRDDNGKPYVLPSVRKAEEKLRAKNLDKEYAPISGIAEFCKA 101

Query: 215 AAQLAYGEDFPAFKDNRLAIVQGISGSGSLRVGTAFLERFYPGVKTVYFPTPTWNGHVRF 274
           A +LA G +     +   A VQGISG+GSLRVG AF   FYPG+KTVY P PTW  H   
Sbjct: 102 AIELALGANSEIVSNGLNATVQGISGTGSLRVGAAFFSNFYPGIKTVYLPKPTWGNHTPI 161

Query: 275 CTDSRLNVGAYRYFDNKTNGLDFAGMMEDIKAMPERSILFLQTSSHNPTGVDLSEDQWRQ 334
              + ++V +Y ++D KT GLDF G ++DI  +PERSI+ L   +HNPTGVD + DQW +
Sbjct: 162 FKHAGMDVQSYTFYDPKTCGLDFKGALDDINKIPERSIILLHACAHNPTGVDPNLDQWAE 221

Query: 335 LAVVVKQRHLYPFFDMAYLGLTSGDFDKDAFSLRYFAKEVGQLCLAQSFSKNMGLYGERV 394
           L+ ++KQR+L+PFFDMAY G  SGD D+DA ++R F KE  ++ LAQSF+KNMGLYGER 
Sbjct: 222 LSSLIKQRNLFPFFDMAYQGFASGDIDRDAQAVRLFIKEGHKIVLAQSFAKNMGLYGERA 281

Query: 395 GTFSVLTPTSDETERIMSQLKILIRGFYSNPPIHGARIVTEILSDPKLKAQCDETERIMS 454
           G F+V T + +ET R+MSQLKILIR  YSNPPI+GARIV EIL+DP L            
Sbjct: 282 GAFTVTTESQEETARVMSQLKILIRALYSNPPINGARIVAEILTDPAL------------ 329

Query: 455 QLKILIRGFYSNPPIHGARIVTEILSDPKLKAQWFEECKGMSNRISSIREELKSKILDKG 514
                                         +A W +E KGM++RI S+R +L+  +  +G
Sbjct: 330 ------------------------------RADWLKEVKGMADRIISVRTKLRDNLKKEG 359

Query: 515 SKKNWDHITNQKGMFCYTGLSASQ 538
           S KNW HIT+Q GMFCYTG++  Q
Sbjct: 360 STKNWQHITDQIGMFCYTGMTPDQ 383




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|452988474|gb|EME88229.1| hypothetical protein MYCFIDRAFT_209746 [Pseudocercospora fijiensis CIRAD86] Back     alignment and taxonomy information
>gi|332372484|gb|AEE61384.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|378733812|gb|EHY60271.1| aspartate aminotransferase [Exophiala dermatitidis NIH/UT8656] Back     alignment and taxonomy information
>gi|452846713|gb|EME48645.1| hypothetical protein DOTSEDRAFT_67626 [Dothistroma septosporum NZE10] Back     alignment and taxonomy information
>gi|170040614|ref|XP_001848088.1| aspartate aminotransferase [Culex quinquefasciatus] gi|167864227|gb|EDS27610.1| aspartate aminotransferase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|453089098|gb|EMF17138.1| aspartate aminotransferase [Mycosphaerella populorum SO2202] Back     alignment and taxonomy information
>gi|330931763|ref|XP_003303527.1| hypothetical protein PTT_15769 [Pyrenophora teres f. teres 0-1] gi|311320420|gb|EFQ88373.1| hypothetical protein PTT_15769 [Pyrenophora teres f. teres 0-1] Back     alignment and taxonomy information
>gi|396464635|ref|XP_003836928.1| similar to mitochondrial aspartate aminotransferase [Leptosphaeria maculans JN3] gi|312213481|emb|CBX93563.1| similar to mitochondrial aspartate aminotransferase [Leptosphaeria maculans JN3] Back     alignment and taxonomy information
>gi|449300498|gb|EMC96510.1| hypothetical protein BAUCODRAFT_33868 [Baudoinia compniacensis UAMH 10762] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query583
MGI|MGI:95792430 Got2 "glutamate oxaloacetate t 0.564 0.765 0.485 1.8e-95
RGD|2722430 Got2 "glutamic-oxaloacetic tra 0.564 0.765 0.485 1.8e-95
ASPGD|ASPL0000046209429 AN1993 [Emericella nidulans (t 0.499 0.678 0.536 3e-95
UNIPROTKB|P00505430 GOT2 "Aspartate aminotransfera 0.536 0.727 0.507 3.8e-95
UNIPROTKB|Q4R559430 GOT2 "Aspartate aminotransfera 0.509 0.690 0.521 4.8e-95
UNIPROTKB|Q5REB0430 GOT2 "Aspartate aminotransfera 0.509 0.690 0.521 4.8e-95
WB|WBGene00015778414 got-2.2 [Caenorhabditis elegan 0.524 0.739 0.521 2.1e-94
UNIPROTKB|Q28F67427 got2 "Aspartate aminotransfera 0.564 0.770 0.479 2.6e-94
UNIPROTKB|P08907401 GOT2 "Aspartate aminotransfera 0.509 0.740 0.515 2.3e-93
UNIPROTKB|P12344430 GOT2 "Aspartate aminotransfera 0.509 0.690 0.511 2.3e-93
MGI|MGI:95792 Got2 "glutamate oxaloacetate transaminase 2, mitochondrial" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 836 (299.3 bits), Expect = 1.8e-95, Sum P(2) = 1.8e-95
 Identities = 162/334 (48%), Positives = 226/334 (67%)

Query:   149 PLKQQLKGFNKDPHPKKMNLGVGAYRGEDGKPYVLPSVKEAERRIYEKNLDHEYANIGGD 208
             P+    + F +D + KKMNLGVGAYR ++GKPYVLPSV++AE +I  KNLD EY  IGG 
Sbjct:    43 PILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGL 102

Query:   209 AKFCKLAAQLAYGEDFPAFKDNRLAIVQGISGSGSLRVGTAFLERFYPGVKTVYFPTPTW 268
             A+FCK +A+LA GE+    K  R   VQ ISG+G+LRVG +FL+RF+   + V+ P P+W
Sbjct:   103 AEFCKASAELALGENNEVLKSGRFVTVQTISGTGALRVGASFLQRFFKFSRDVFLPKPSW 162

Query:   269 NGHVRFCTDSRLNVGAYRYFDNKTNGLDFAGMMEDIKAMPERSILFLQTSSHNPTGVDLS 328
               H     D+ + +  YRY+D KT G DF+G +EDI  +PE+S+L L   +HNPTGVD  
Sbjct:   163 GNHTPIFRDAGMQLQGYRYYDPKTCGFDFSGALEDISKIPEQSVLLLHACAHNPTGVDPR 222

Query:   329 EDQWRQLAVVVKQRHLYPFFDMAYLGLTSGDFDKDAFSLRYFAKEVGQLCLAQSFSKNMG 388
              +QW+++A VVK+++L+ FFDMAY G  SGD DKDA+++R+F ++   +CL QS++KNMG
Sbjct:   223 PEQWKEIASVVKKKNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMG 282

Query:   389 LYGERVGTFSVLTPTSDETERIMSQLKILIRGFYSNPPIHGARIVTEILSDPKLKAQ-CD 447
             LYGERVG F+V+   ++E +R+ SQLKILIR  YSNPP++GARI   IL+ P L+ Q   
Sbjct:   283 LYGERVGAFTVVCKDAEEAKRVESQLKILIRPLYSNPPLNGARIAATILTSPDLRKQWLQ 342

Query:   448 ET----ERIMSQLKILIRGFYSNPPIHGARIVTE 477
             E     +RI+S    L+         H  + +T+
Sbjct:   343 EVKGMADRIISMRTQLVSNLKKEGSSHNWQHITD 376


GO:0003824 "catalytic activity" evidence=IEA
GO:0004069 "L-aspartate:2-oxoglutarate aminotransferase activity" evidence=ISO;IDA
GO:0005543 "phospholipid binding" evidence=ISO
GO:0005739 "mitochondrion" evidence=ISO;IDA
GO:0005743 "mitochondrial inner membrane" evidence=ISO;IDA
GO:0005886 "plasma membrane" evidence=ISO
GO:0006107 "oxaloacetate metabolic process" evidence=IDA
GO:0006520 "cellular amino acid metabolic process" evidence=ISO
GO:0006531 "aspartate metabolic process" evidence=ISO
GO:0006532 "aspartate biosynthetic process" evidence=IDA
GO:0006533 "aspartate catabolic process" evidence=ISO
GO:0006810 "transport" evidence=IEA
GO:0006869 "lipid transport" evidence=IEA
GO:0008483 "transaminase activity" evidence=IEA
GO:0009058 "biosynthetic process" evidence=IEA
GO:0009986 "cell surface" evidence=ISO
GO:0016020 "membrane" evidence=IEA
GO:0016212 "kynurenine-oxoglutarate transaminase activity" evidence=IEA
GO:0016597 "amino acid binding" evidence=ISO
GO:0016740 "transferase activity" evidence=IEA
GO:0019550 "glutamate catabolic process to aspartate" evidence=IDA
GO:0019551 "glutamate catabolic process to 2-oxoglutarate" evidence=IDA
GO:0019899 "enzyme binding" evidence=ISO
GO:0030170 "pyridoxal phosphate binding" evidence=ISO
GO:0031406 "carboxylic acid binding" evidence=ISO
GO:0042803 "protein homodimerization activity" evidence=ISO
GO:0043204 "perikaryon" evidence=ISO
GO:0043234 "protein complex" evidence=ISO
GO:0043648 "dicarboxylic acid metabolic process" evidence=ISO
GO:0045471 "response to ethanol" evidence=ISO
GO:0080130 "L-phenylalanine:2-oxoglutarate aminotransferase activity" evidence=IEA
RGD|2722 Got2 "glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ASPGD|ASPL0000046209 AN1993 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|P00505 GOT2 "Aspartate aminotransferase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q4R559 GOT2 "Aspartate aminotransferase, mitochondrial" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms
UNIPROTKB|Q5REB0 GOT2 "Aspartate aminotransferase, mitochondrial" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
WB|WBGene00015778 got-2.2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q28F67 got2 "Aspartate aminotransferase, mitochondrial" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|P08907 GOT2 "Aspartate aminotransferase, mitochondrial" [Equus caballus (taxid:9796)] Back     alignment and assigned GO terms
UNIPROTKB|P12344 GOT2 "Aspartate aminotransferase, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P74861TYRB_SALTY2, ., 6, ., 1, ., 5, 70.31720.63800.9370yesN/A
P44425AAT_HAEIN2, ., 6, ., 1, ., 10.30420.60370.8888yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.6.10.766
4th Layer2.6.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query583
PLN02397423 PLN02397, PLN02397, aspartate transaminase 1e-176
PTZ00376404 PTZ00376, PTZ00376, aspartate aminotransferase; Pr 1e-167
COG1448396 COG1448, TyrB, Aspartate/tyrosine/aromatic aminotr 1e-134
PRK09257396 PRK09257, PRK09257, aromatic amino acid aminotrans 1e-130
pfam00155357 pfam00155, Aminotran_1_2, Aminotransferase class I 3e-66
cd00609350 cd00609, AAT_like, Aspartate aminotransferase fami 7e-34
PLN02397423 PLN02397, PLN02397, aspartate transaminase 8e-27
PLN02397423 PLN02397, PLN02397, aspartate transaminase 2e-26
PTZ00376404 PTZ00376, PTZ00376, aspartate aminotransferase; Pr 4e-22
PTZ00376404 PTZ00376, PTZ00376, aspartate aminotransferase; Pr 1e-21
PRK09257396 PRK09257, PRK09257, aromatic amino acid aminotrans 5e-15
PRK09257396 PRK09257, PRK09257, aromatic amino acid aminotrans 5e-15
COG1448396 COG1448, TyrB, Aspartate/tyrosine/aromatic aminotr 9e-15
COG1448396 COG1448, TyrB, Aspartate/tyrosine/aromatic aminotr 9e-15
COG0436393 COG0436, COG0436, Aspartate/tyrosine/aromatic amin 6e-08
pfam00155357 pfam00155, Aminotran_1_2, Aminotransferase class I 2e-07
pfam00155357 pfam00155, Aminotran_1_2, Aminotransferase class I 1e-06
PRK06836394 PRK06836, PRK06836, aspartate aminotransferase; Pr 2e-04
PRK08960387 PRK08960, PRK08960, hypothetical protein; Provisio 5e-04
PRK07309391 PRK07309, PRK07309, aromatic amino acid aminotrans 0.001
PRK06348384 PRK06348, PRK06348, aspartate aminotransferase; Pr 0.003
>gnl|CDD|215222 PLN02397, PLN02397, aspartate transaminase Back     alignment and domain information
 Score =  504 bits (1300), Expect = e-176
 Identities = 177/382 (46%), Positives = 240/382 (62%), Gaps = 43/382 (11%)

Query: 157 FNKDPHPKKMNLGVGAYRGEDGKPYVLPSVKEAERRIYEKNLDHEYANIGGDAKFCKLAA 216
           F  DP P K+NLGVGAYR E+GKP VL  V++AE+R+   + + EY  I G A+F KL+A
Sbjct: 42  FLADPSPVKLNLGVGAYRTEEGKPVVLNVVRKAEQRLLAGSRNKEYLPIEGLAEFNKLSA 101

Query: 217 QLAYGEDFPAFKDNRLAIVQGISGSGSLRVGTAFLERFYPGVKTVYFPTPTWNGHVRFCT 276
           +LAYG D PA K+NR+A VQ +SG+GSLR+G  FL RFYPG  T+Y P PTW  H     
Sbjct: 102 KLAYGADSPAIKENRVATVQCLSGTGSLRLGAEFLARFYPG-STIYIPNPTWGNHHNIFR 160

Query: 277 DSRLNVGAYRYFDNKTNGLDFAGMMEDIKAMPERSILFLQTSSHNPTGVDLSEDQWRQLA 336
           D+ + V  YRY+D KT GLDF G++ED+KA P+ S + L   +HNPTGVD + +QW Q++
Sbjct: 161 DAGVPVRTYRYYDPKTRGLDFDGLLEDLKAAPDGSFVLLHACAHNPTGVDPTPEQWEQIS 220

Query: 337 VVVKQRHLYPFFDMAYLGLTSGDFDKDAFSLRYFAKEVGQLCLAQSFSKNMGLYGERVGT 396
            ++K ++  PFFD AY G  SGD D DA S+R F ++  ++ +AQS++KNMGLYGERVG 
Sbjct: 221 DLIKSKNHLPFFDSAYQGFASGDLDADAQSVRMFVEDGHEILVAQSYAKNMGLYGERVGA 280

Query: 397 FSVLTPTSDETERIMSQLKILIRGFYSNPPIHGARIVTEILSDPKLKAQCDETERIMSQL 456
            SV+  ++D   R+ SQLK++ R      P+                             
Sbjct: 281 LSVVCKSADVAVRVKSQLKLIAR------PM----------------------------- 305

Query: 457 KILIRGFYSNPPIHGARIVTEILSDPKLKAQWFEECKGMSNRISSIREELKSKILDKGSK 516
                  YSNPPIHGA IV  IL DP+L ++W +E KGM++RI S+R++L   +  +GS 
Sbjct: 306 -------YSNPPIHGASIVATILGDPELFSEWTKELKGMADRIISMRQKLYDALEARGSP 358

Query: 517 KNWDHITNQKGMFCYTGLSASQ 538
            +W HIT Q GMF +TGL+  Q
Sbjct: 359 GDWSHITKQIGMFSFTGLNKEQ 380


Length = 423

>gnl|CDD|240390 PTZ00376, PTZ00376, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|224365 COG1448, TyrB, Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|181731 PRK09257, PRK09257, aromatic amino acid aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|215756 pfam00155, Aminotran_1_2, Aminotransferase class I and II Back     alignment and domain information
>gnl|CDD|99734 cd00609, AAT_like, Aspartate aminotransferase family Back     alignment and domain information
>gnl|CDD|215222 PLN02397, PLN02397, aspartate transaminase Back     alignment and domain information
>gnl|CDD|215222 PLN02397, PLN02397, aspartate transaminase Back     alignment and domain information
>gnl|CDD|240390 PTZ00376, PTZ00376, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|240390 PTZ00376, PTZ00376, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|181731 PRK09257, PRK09257, aromatic amino acid aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|181731 PRK09257, PRK09257, aromatic amino acid aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|224365 COG1448, TyrB, Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|224365 COG1448, TyrB, Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|223513 COG0436, COG0436, Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|215756 pfam00155, Aminotran_1_2, Aminotransferase class I and II Back     alignment and domain information
>gnl|CDD|215756 pfam00155, Aminotran_1_2, Aminotransferase class I and II Back     alignment and domain information
>gnl|CDD|180720 PRK06836, PRK06836, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|181595 PRK08960, PRK08960, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|235985 PRK07309, PRK07309, aromatic amino acid aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|180537 PRK06348, PRK06348, aspartate aminotransferase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 583
COG1448396 TyrB Aspartate/tyrosine/aromatic aminotransferase 100.0
PRK09257396 aromatic amino acid aminotransferase; Provisional 100.0
PTZ00376404 aspartate aminotransferase; Provisional 100.0
COG0436393 Aspartate/tyrosine/aromatic aminotransferase [Amin 100.0
PLN02397423 aspartate transaminase 100.0
COG1167459 ARO8 Transcriptional regulators containing a DNA-b 100.0
KOG1411|consensus427 100.0
KOG1412|consensus410 100.0
KOG0257|consensus420 100.0
PLN02368407 alanine transaminase 100.0
PRK06855433 aminotransferase; Validated 100.0
PLN00175413 aminotransferase family protein; Provisional 100.0
PRK07366388 succinyldiaminopimelate transaminase; Validated 100.0
PRK08636403 aspartate aminotransferase; Provisional 100.0
PRK07681399 aspartate aminotransferase; Provisional 100.0
PRK06348384 aspartate aminotransferase; Provisional 100.0
PLN00143409 tyrosine/nicotianamine aminotransferase; Provision 100.0
PRK06207405 aspartate aminotransferase; Provisional 100.0
PLN02187462 rooty/superroot1 100.0
PRK08068389 transaminase; Reviewed 100.0
PTZ00377481 alanine aminotransferase; Provisional 100.0
PRK09276385 LL-diaminopimelate aminotransferase; Provisional 100.0
PRK06290410 aspartate aminotransferase; Provisional 100.0
PRK09148405 aminotransferase; Validated 100.0
TIGR03540383 DapC_direct LL-diaminopimelate aminotransferase. T 100.0
PRK09147396 succinyldiaminopimelate transaminase; Provisional 100.0
PLN02656409 tyrosine transaminase 100.0
PLN02450468 1-aminocyclopropane-1-carboxylate synthase 100.0
PRK05942394 aspartate aminotransferase; Provisional 100.0
PRK07682378 hypothetical protein; Validated 100.0
PLN02376496 1-aminocyclopropane-1-carboxylate synthase 100.0
PLN02231534 alanine transaminase 100.0
PRK08960387 hypothetical protein; Provisional 100.0
PLN00145430 tyrosine/nicotianamine aminotransferase; Provision 100.0
PRK12414384 putative aminotransferase; Provisional 100.0
TIGR01264401 tyr_amTase_E tyrosine aminotransferase, eukaryotic 100.0
PRK15481431 transcriptional regulatory protein PtsJ; Provision 100.0
PRK09082386 methionine aminotransferase; Validated 100.0
PRK07683387 aminotransferase A; Validated 100.0
TIGR03538393 DapC_gpp succinyldiaminopimelate transaminase. Thi 100.0
PRK05839374 hypothetical protein; Provisional 100.0
PTZ00433412 tyrosine aminotransferase; Provisional 100.0
PRK07590409 L,L-diaminopimelate aminotransferase; Validated 100.0
PRK08637388 hypothetical protein; Provisional 100.0
PRK08912387 hypothetical protein; Provisional 100.0
PLN02607447 1-aminocyclopropane-1-carboxylate synthase 100.0
PRK08175395 aminotransferase; Validated 100.0
PRK13355517 bifunctional HTH-domain containing protein/aminotr 100.0
PRK07337388 aminotransferase; Validated 100.0
PRK05957389 aspartate aminotransferase; Provisional 100.0
TIGR03537350 DapC succinyldiaminopimelate transaminase. Note: t 100.0
PRK07309391 aromatic amino acid aminotransferase; Validated 100.0
PRK06108382 aspartate aminotransferase; Provisional 100.0
PRK08361391 aspartate aminotransferase; Provisional 100.0
PRK06107402 aspartate aminotransferase; Provisional 100.0
PRK07550386 hypothetical protein; Provisional 100.0
PRK07777387 aminotransferase; Validated 100.0
PRK07324373 transaminase; Validated 100.0
PRK02610374 histidinol-phosphate aminotransferase; Provisional 100.0
PRK09440416 avtA valine--pyruvate transaminase; Provisional 100.0
PRK08363398 alanine aminotransferase; Validated 100.0
TIGR01265403 tyr_nico_aTase tyrosine/nicotianamine aminotransfe 100.0
PRK09265404 aminotransferase AlaT; Validated 100.0
PRK09275527 aspartate aminotransferase; Provisional 100.0
PF00155363 Aminotran_1_2: Aminotransferase class I and II 1-a 100.0
TIGR03542402 DAPAT_plant LL-diaminopimelate aminotransferase. T 100.0
KOG0256|consensus471 100.0
PRK07865364 N-succinyldiaminopimelate aminotransferase; Review 100.0
COG1168388 MalY Bifunctional PLP-dependent enzyme with beta-c 100.0
PRK07568397 aspartate aminotransferase; Provisional 100.0
PRK01533366 histidinol-phosphate aminotransferase; Validated 100.0
TIGR03539357 DapC_actino succinyldiaminopimelate transaminase. 100.0
PRK05764393 aspartate aminotransferase; Provisional 100.0
PRK06358354 threonine-phosphate decarboxylase; Provisional 100.0
PRK06836394 aspartate aminotransferase; Provisional 100.0
KOG0259|consensus447 100.0
TIGR03801521 asp_4_decarbox aspartate 4-decarboxylase. This enz 100.0
PRK03317368 histidinol-phosphate aminotransferase; Provisional 100.0
PRK14809357 histidinol-phosphate aminotransferase; Provisional 100.0
PRK05166371 histidinol-phosphate aminotransferase; Provisional 100.0
PRK07392360 threonine-phosphate decarboxylase; Validated 100.0
KOG0634|consensus472 100.0
PRK08153369 histidinol-phosphate aminotransferase; Provisional 100.0
PLN026721082 methionine S-methyltransferase 100.0
PRK03158359 histidinol-phosphate aminotransferase; Provisional 100.0
PLN03026380 histidinol-phosphate aminotransferase; Provisional 100.0
PRK09105370 putative aminotransferase; Provisional 100.0
PRK05387353 histidinol-phosphate aminotransferase; Provisional 100.0
PRK14808335 histidinol-phosphate aminotransferase; Provisional 100.0
PRK14807351 histidinol-phosphate aminotransferase; Provisional 100.0
PRK08056356 threonine-phosphate decarboxylase; Provisional 100.0
PRK04870356 histidinol-phosphate aminotransferase; Provisional 100.0
COG0079356 HisC Histidinol-phosphate/aromatic aminotransferas 100.0
PRK04781364 histidinol-phosphate aminotransferase; Provisional 100.0
PRK03967337 histidinol-phosphate aminotransferase; Provisional 100.0
PRK07908349 hypothetical protein; Provisional 100.0
PRK06425332 histidinol-phosphate aminotransferase; Validated 100.0
PRK06225380 aspartate aminotransferase; Provisional 100.0
PRK03321352 putative aminotransferase; Provisional 100.0
PRK01688351 histidinol-phosphate aminotransferase; Provisional 100.0
PRK02731367 histidinol-phosphate aminotransferase; Validated 100.0
PRK05664330 threonine-phosphate decarboxylase; Reviewed 100.0
PRK04635354 histidinol-phosphate aminotransferase; Provisional 100.0
TIGR01141346 hisC histidinol-phosphate aminotransferase. Histid 100.0
PRK08354311 putative aminotransferase; Provisional 100.0
PRK06959339 putative threonine-phosphate decarboxylase; Provis 100.0
PRK00950361 histidinol-phosphate aminotransferase; Validated 100.0
TIGR01140330 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxy 100.0
COG1448396 TyrB Aspartate/tyrosine/aromatic aminotransferase 99.97
COG3977417 Alanine-alpha-ketoisovalerate (or valine-pyruvate) 99.96
cd00609350 AAT_like Aspartate aminotransferase family. This f 99.95
KOG0258|consensus475 99.95
PRK13238460 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-d 99.95
KOG0633|consensus375 99.92
cd00617431 Tnase_like Tryptophanase family (Tnase). This fami 99.91
KOG1411|consensus427 99.91
PRK10534333 L-threonine aldolase; Provisional 99.9
PRK07049427 methionine gamma-lyase; Validated 99.89
TIGR03576346 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 99.88
TIGR00858360 bioF 8-amino-7-oxononanoate synthase. This model r 99.88
PRK06939397 2-amino-3-ketobutyrate coenzyme A ligase; Provisio 99.88
PRK02627396 acetylornithine aminotransferase; Provisional 99.87
TIGR01825385 gly_Cac_T_rel pyridoxal phosphate-dependent acyltr 99.87
TIGR00707379 argD acetylornithine and succinylornithine aminotr 99.87
cd06502338 TA_like Low-specificity threonine aldolase (TA). T 99.87
PF12897425 Aminotran_MocR: Alanine-glyoxylate amino-transfera 99.86
PLN02721353 threonine aldolase 99.86
TIGR01822393 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A lig 99.86
KOG1412|consensus410 99.85
PLN02242418 methionine gamma-lyase 99.85
PRK05958385 8-amino-7-oxononanoate synthase; Reviewed 99.85
PRK06234400 methionine gamma-lyase; Provisional 99.84
PRK03244398 argD acetylornithine aminotransferase; Provisional 99.82
cd00378402 SHMT Serine-glycine hydroxymethyltransferase (SHMT 99.82
PLN02822481 serine palmitoyltransferase 99.82
PRK08247366 cystathionine gamma-synthase; Reviewed 99.82
TIGR02539370 SepCysS Sep-tRNA:Cys-tRNA synthase. Aminoacylation 99.81
cd06454349 KBL_like KBL_like; this family belongs to the pyri 99.81
PRK01278389 argD acetylornithine transaminase protein; Provisi 99.81
PRK08088425 4-aminobutyrate aminotransferase; Validated 99.81
PLN02483489 serine palmitoyltransferase 99.81
TIGR02080382 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase. 99.81
cd00610413 OAT_like Acetyl ornithine aminotransferase family. 99.81
PRK06460376 hypothetical protein; Provisional 99.8
TIGR03392398 FeS_syn_CsdA cysteine desulfurase, catalytic subun 99.8
PRK08133390 O-succinylhomoserine sulfhydrylase; Validated 99.8
PRK13392410 5-aminolevulinate synthase; Provisional 99.79
PRK08045386 cystathionine gamma-synthase; Provisional 99.79
PRK08249398 cystathionine gamma-synthase; Provisional 99.79
cd06452361 SepCysS Sep-tRNA:Cys-tRNA synthase. This family be 99.79
cd00613398 GDC-P Glycine cleavage system P-protein, alpha- an 99.79
PRK07503403 methionine gamma-lyase; Provisional 99.78
PRK06767386 methionine gamma-lyase; Provisional 99.77
PRK07811388 cystathionine gamma-synthase; Provisional 99.77
PRK10874401 cysteine sulfinate desulfinase; Provisional 99.77
PRK02936377 argD acetylornithine aminotransferase; Provisional 99.76
TIGR00713423 hemL glutamate-1-semialdehyde-2,1-aminomutase. Thi 99.76
PRK07504398 O-succinylhomoserine sulfhydrylase; Reviewed 99.76
TIGR01979403 sufS cysteine desulfurases, SufS subfamily. This m 99.76
PRK08776405 cystathionine gamma-synthase; Provisional 99.76
PRK05093403 argD bifunctional N-succinyldiaminopimelate-aminot 99.76
PRK07050394 cystathionine beta-lyase; Provisional 99.76
TIGR02379376 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase 99.75
cd00614369 CGS_like CGS_like: Cystathionine gamma-synthase is 99.75
TIGR01976397 am_tr_V_VC1184 cysteine desulfurase family protein 99.75
PRK08861388 cystathionine gamma-synthase; Provisional 99.75
PRK02948381 cysteine desulfurase; Provisional 99.75
PRK08574385 cystathionine gamma-synthase; Provisional 99.74
TIGR01326418 OAH_OAS_sulfhy OAH/OAS sulfhydrylase. This model d 99.74
TIGR01325380 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase. 99.74
PRK07810403 O-succinylhomoserine sulfhydrylase; Provisional 99.74
PRK07582366 cystathionine gamma-lyase; Validated 99.74
PRK07179407 hypothetical protein; Provisional 99.74
TIGR01328391 met_gam_lyase methionine gamma-lyase. This model d 99.73
PRK04073396 rocD ornithine--oxo-acid transaminase; Provisional 99.73
PRK09295406 bifunctional cysteine desulfurase/selenocysteine l 99.73
cd06453373 SufS_like Cysteine desulfurase (SufS)-like. This f 99.73
cd06450345 DOPA_deC_like DOPA decarboxylase family. This fami 99.72
PLN02409401 serine--glyoxylate aminotransaminase 99.72
TIGR03301355 PhnW-AepZ 2-aminoethylphosphonate aminotransferase 99.71
PRK11658379 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate amin 99.71
PRK11706375 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisio 99.71
TIGR01437363 selA_rel uncharacterized pyridoxal phosphate-depen 99.71
PRK09331387 Sep-tRNA:Cys-tRNA synthetase; Provisional 99.71
TIGR03403382 nifS_epsilon cysteine desulfurase, NifS family, ep 99.7
PRK12381406 bifunctional succinylornithine transaminase/acetyl 99.7
cd06451356 AGAT_like Alanine-glyoxylate aminotransferase (AGA 99.7
PLN02855424 Bifunctional selenocysteine lyase/cysteine desulfu 99.7
PRK04260375 acetylornithine aminotransferase; Provisional 99.69
PRK09028394 cystathionine beta-lyase; Provisional 99.68
PRK09064407 5-aminolevulinate synthase; Validated 99.68
PRK05939397 hypothetical protein; Provisional 99.67
TIGR01821402 5aminolev_synth 5-aminolevulinic acid synthase. Th 99.67
PRK00011416 glyA serine hydroxymethyltransferase; Reviewed 99.67
PRK07269364 cystathionine gamma-synthase; Reviewed 99.67
cd00615294 Orn_deC_like Ornithine decarboxylase family. This 99.67
PRK13479368 2-aminoethylphosphonate--pyruvate transaminase; Pr 99.66
PRK08248431 O-acetylhomoserine aminocarboxypropyltransferase; 99.66
TIGR01324377 cysta_beta_ly_B cystathionine beta-lyase, bacteria 99.65
PRK00854401 rocD ornithine--oxo-acid transaminase; Reviewed 99.65
PRK00451447 glycine dehydrogenase subunit 1; Validated 99.65
PRK06702432 O-acetylhomoserine aminocarboxypropyltransferase; 99.65
TIGR01329378 cysta_beta_ly_E cystathionine beta-lyase, eukaryot 99.65
PRK08064390 cystathionine beta-lyase; Provisional 99.64
PRK07671377 cystathionine beta-lyase; Provisional 99.64
PRK09792421 4-aminobutyrate transaminase; Provisional 99.64
PRK06084425 O-acetylhomoserine aminocarboxypropyltransferase; 99.63
PLN00144382 acetylornithine transaminase 99.63
PLN02509464 cystathionine beta-lyase 99.62
PLN03227392 serine palmitoyltransferase-like protein; Provisio 99.61
TIGR02326363 transamin_PhnW 2-aminoethylphosphonate--pyruvate t 99.61
PRK05968389 hypothetical protein; Provisional 99.61
cd01494170 AAT_I Aspartate aminotransferase (AAT) superfamily 99.6
TIGR03235353 DNA_S_dndA cysteine desulfurase DndA. This model d 99.6
PRK06918451 4-aminobutyrate aminotransferase; Reviewed 99.59
PTZ00125400 ornithine aminotransferase-like protein; Provision 99.59
PRK05967395 cystathionine beta-lyase; Provisional 99.58
PRK13393406 5-aminolevulinate synthase; Provisional 99.58
PRK06176380 cystathionine gamma-synthase/cystathionine beta-ly 99.58
PRK07505402 hypothetical protein; Provisional 99.58
TIGR02006402 IscS cysteine desulfurase IscS. This model represe 99.57
TIGR03402379 FeS_nifS cysteine desulfurase NifS. Members of thi 99.56
TIGR03588380 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-amin 99.56
TIGR03531444 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium tr 99.55
PRK14012404 cysteine desulfurase; Provisional 99.55
TIGR00700420 GABAtrnsam 4-aminobutyrate aminotransferase, proka 99.55
TIGR01977376 am_tr_V_EF2568 cysteine desulfurase family protein 99.54
TIGR03812373 tyr_de_CO2_Arch tyrosine decarboxylase MnfA. Membe 99.54
PRK13520371 L-tyrosine decarboxylase; Provisional 99.54
PRK08360443 4-aminobutyrate aminotransferase; Provisional 99.52
PRK04366481 glycine dehydrogenase subunit 2; Validated 99.51
PRK04612408 argD acetylornithine transaminase protein; Provisi 99.5
PRK15407438 lipopolysaccharide biosynthesis protein RfbH; Prov 99.5
PRK05994427 O-acetylhomoserine aminocarboxypropyltransferase; 99.5
PLN02624474 ornithine-delta-aminotransferase 99.49
TIGR01885401 Orn_aminotrans ornithine aminotransferase. This mo 99.49
PRK00062426 glutamate-1-semialdehyde aminotransferase; Provisi 99.48
TIGR03246397 arg_catab_astC succinylornithine transaminase fami 99.47
PLN02651364 cysteine desulfurase 99.47
cd00616352 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase fa 99.47
PRK07495425 4-aminobutyrate aminotransferase; Provisional 99.44
PRK06777421 4-aminobutyrate aminotransferase; Provisional 99.41
PLN02955476 8-amino-7-oxononanoate synthase 99.4
PRK08134433 O-acetylhomoserine aminocarboxypropyltransferase; 99.38
PRK07812436 O-acetylhomoserine aminocarboxypropyltransferase; 99.35
COG0399374 WecE Predicted pyridoxal phosphate-dependent enzym 99.32
PRK08117433 4-aminobutyrate aminotransferase; Provisional 99.31
TIGR02618450 tyr_phenol_ly tyrosine phenol-lyase. This model de 99.31
TIGR02407412 ectoine_ectB diaminobutyrate--2-oxoglutarate amino 99.31
PRK08114395 cystathionine beta-lyase; Provisional 99.31
PF01053386 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent 99.29
PRK05937370 8-amino-7-oxononanoate synthase; Provisional 99.26
PF01041363 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransfe 99.25
COG0156388 BioF 7-keto-8-aminopelargonate synthetase and rela 99.25
PRK09264425 diaminobutyrate--2-oxoglutarate aminotransferase; 99.25
COG0520405 csdA Selenocysteine lyase/Cysteine desulfurase [Po 99.25
PRK05613437 O-acetylhomoserine aminocarboxypropyltransferase; 99.24
PRK13237460 tyrosine phenol-lyase; Provisional 99.24
PRK06058443 4-aminobutyrate aminotransferase; Provisional 99.24
PRK04311464 selenocysteine synthase; Provisional 99.22
PRK06434384 cystathionine gamma-lyase; Validated 99.17
TIGR00709442 dat 2,4-diaminobutyrate 4-transaminases. This fami 99.12
PRK08593445 4-aminobutyrate aminotransferase; Provisional 99.11
KOG0053|consensus409 99.1
COG0626396 MetC Cystathionine beta-lyases/cystathionine gamma 99.1
PRK05964423 adenosylmethionine--8-amino-7-oxononanoate transam 99.08
TIGR00474454 selA seryl-tRNA(sec) selenium transferase. In bact 99.06
PF00266371 Aminotran_5: Aminotransferase class-V; InterPro: I 99.03
PLN02994153 1-aminocyclopropane-1-carboxylate synthase 99.03
PF01212290 Beta_elim_lyase: Beta-eliminating lyase; InterPro: 99.02
COG2008342 GLY1 Threonine aldolase [Amino acid transport and 98.97
PRK03715395 argD acetylornithine transaminase protein; Provisi 98.94
PRK06541460 hypothetical protein; Provisional 98.94
PRK02769380 histidine decarboxylase; Provisional 98.94
KOG1549|consensus428 98.94
TIGR01814406 kynureninase kynureninase. This model describes ky 98.93
PF01276417 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; 98.88
COG1104386 NifS Cysteine sulfinate desulfinase/cysteine desul 98.87
COG2873426 MET17 O-acetylhomoserine sulfhydrylase [Amino acid 98.86
PRK13034416 serine hydroxymethyltransferase; Reviewed 98.85
COG0075383 Serine-pyruvate aminotransferase/archaeal aspartat 98.82
PF04864363 Alliinase_C: Allinase; InterPro: IPR006948 Allicin 98.81
PLN03032374 serine decarboxylase; Provisional 98.81
PRK05769441 4-aminobutyrate aminotransferase; Provisional 98.79
PRK13580493 serine hydroxymethyltransferase; Provisional 98.73
PLN02482474 glutamate-1-semialdehyde 2,1-aminomutase 98.72
TIGR03372442 putres_am_tran putrescine aminotransferase. Member 98.72
KOG1368|consensus384 98.72
PRK12389428 glutamate-1-semialdehyde aminotransferase; Provisi 98.66
COG1103382 Archaea-specific pyridoxal phosphate-dependent enz 98.66
PRK04013364 argD acetylornithine/acetyl-lysine aminotransferas 98.63
COG4992404 ArgD Ornithine/acetylornithine aminotransferase [A 98.62
COG0160447 GabT 4-aminobutyrate aminotransferase and related 98.62
PRK00615433 glutamate-1-semialdehyde aminotransferase; Provisi 98.61
COG0076460 GadB Glutamate decarboxylase and related PLP-depen 98.61
COG0001432 HemL Glutamate-1-semialdehyde aminotransferase [Co 98.59
PRK11522459 putrescine--2-oxoglutarate aminotransferase; Provi 98.56
PRK15029 755 arginine decarboxylase; Provisional 98.54
PLN02414993 glycine dehydrogenase (decarboxylating) 98.54
PRK05639457 4-aminobutyrate aminotransferase; Provisional 98.53
PRK06062451 hypothetical protein; Provisional 98.52
PRK07046453 aminotransferase; Validated 98.5
PRK07986428 adenosylmethionine--8-amino-7-oxononanoate transam 98.48
PTZ00094452 serine hydroxymethyltransferase; Provisional 98.48
cd00611355 PSAT_like Phosphoserine aminotransferase (PSAT) fa 98.46
PRK06943453 adenosylmethionine--8-amino-7-oxononanoate transam 98.46
PRK13360442 omega amino acid--pyruvate transaminase; Provision 98.46
PLN02760504 4-aminobutyrate:pyruvate transaminase 98.45
PRK05965459 hypothetical protein; Provisional 98.45
PRK06082459 4-aminobutyrate aminotransferase; Provisional 98.45
PRK07482461 hypothetical protein; Provisional 98.45
PLN02263470 serine decarboxylase 98.44
PRK12403460 putative aminotransferase; Provisional 98.42
PRK07030466 adenosylmethionine--8-amino-7-oxononanoate transam 98.41
TIGR01788431 Glu-decarb-GAD glutamate decarboxylase. This model 98.4
TIGR00508427 bioA adenosylmethionine-8-amino-7-oxononanoate tra 98.4
PF00202339 Aminotran_3: Aminotransferase class-III; InterPro: 98.4
PRK09221445 beta alanine--pyruvate transaminase; Provisional 98.37
PRK06173429 adenosylmethionine--8-amino-7-oxononanoate transam 98.37
PRK06916460 adenosylmethionine--8-amino-7-oxononanoate transam 98.36
TIGR02617467 tnaA_trp_ase tryptophanase, leader peptide-associa 98.36
PF06838403 Met_gamma_lyase: Methionine gamma-lyase ; InterPro 98.35
PRK06105460 aminotransferase; Provisional 98.34
TIGR01364349 serC_1 phosphoserine aminotransferase. This model 98.34
PRK08742472 adenosylmethionine--8-amino-7-oxononanoate transam 98.33
PRK07481449 hypothetical protein; Provisional 98.32
PRK07036466 hypothetical protein; Provisional 98.3
PRK07483443 hypothetical protein; Provisional 98.3
PRK07678451 aminotransferase; Validated 98.3
PRK06938464 diaminobutyrate--2-oxoglutarate aminotransferase; 98.29
PRK15400 714 lysine decarboxylase CadA; Provisional 98.29
PRK05630422 adenosylmethionine--8-amino-7-oxononanoate transam 98.28
PLN02880490 tyrosine decarboxylase 98.27
PLN02590539 probable tyrosine decarboxylase 98.26
PRK06917447 hypothetical protein; Provisional 98.26
PRK06209431 glutamate-1-semialdehyde 2,1-aminomutase; Provisio 98.26
PLN03226475 serine hydroxymethyltransferase; Provisional 98.25
PLN02271586 serine hydroxymethyltransferase 98.23
PRK06931459 diaminobutyrate--2-oxoglutarate aminotransferase; 98.21
COG1921395 SelA Selenocysteine synthase [seryl-tRNASer seleni 98.21
PRK07480456 putative aminotransferase; Validated 98.19
PRK15399 713 lysine decarboxylase LdcC; Provisional 98.16
KOG1401|consensus433 98.15
PRK05355360 3-phosphoserine/phosphohydroxythreonine aminotrans 98.13
TIGR03799522 NOD_PanD_pyr putative pyridoxal-dependent aspartat 98.12
PRK06149972 hypothetical protein; Provisional 98.11
PLN02724 805 Molybdenum cofactor sulfurase 98.1
TIGR00461939 gcvP glycine dehydrogenase (decarboxylating). This 98.1
PF00464399 SHMT: Serine hydroxymethyltransferase; InterPro: I 98.08
PF00282373 Pyridoxal_deC: Pyridoxal-dependent decarboxylase c 98.07
KOG1359|consensus417 98.06
PRK13578 720 ornithine decarboxylase; Provisional 98.05
COG1982 557 LdcC Arginine/lysine/ornithine decarboxylases [Ami 97.97
PRK061481013 hypothetical protein; Provisional 97.93
PRK05367954 glycine dehydrogenase; Provisional 97.92
COG0112413 GlyA Glycine/serine hydroxymethyltransferase [Amin 97.91
KOG1360|consensus570 97.9
PRK03080378 phosphoserine aminotransferase; Provisional 97.88
PRK12566954 glycine dehydrogenase; Provisional 97.83
KOG1404|consensus442 97.81
PRK08297443 L-lysine aminotransferase; Provisional 97.79
TIGR03251431 LAT_fam L-lysine 6-transaminase. Characterized mem 97.7
TIGR00699464 GABAtrns_euk 4-aminobutyrate aminotransferase, euk 97.68
PRK05367 954 glycine dehydrogenase; Provisional 97.59
KOG2862|consensus385 97.59
PF03841367 SelA: L-seryl-tRNA selenium transferase; InterPro: 97.48
TIGR03811608 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcu 97.44
TIGR01366361 serC_3 phosphoserine aminotransferase, putative. T 97.44
PLN02452365 phosphoserine transaminase 97.39
PLN02397423 aspartate transaminase 97.39
PLN02974817 adenosylmethionine-8-amino-7-oxononanoate transami 97.39
COG4100416 Cystathionine beta-lyase family protein involved i 97.36
TIGR01365374 serC_2 phosphoserine aminotransferase, Methanosarc 97.18
PLN02672 1082 methionine S-methyltransferase 97.11
COG0161449 BioA Adenosylmethionine-8-amino-7-oxononanoate ami 97.08
KOG1357|consensus519 97.07
PLN02414 993 glycine dehydrogenase (decarboxylating) 96.97
KOG1383|consensus491 96.64
PTZ00376404 aspartate aminotransferase; Provisional 96.58
COG1003496 GcvP Glycine cleavage system protein P (pyridoxal- 96.52
PF05889389 SLA_LP_auto_ag: Soluble liver antigen/liver pancre 96.39
PRK12462364 phosphoserine aminotransferase; Provisional 96.26
COG3033471 TnaA Tryptophanase [Amino acid transport and metab 96.07
PRK09257396 aromatic amino acid aminotransferase; Provisional 95.92
PF02347429 GDC-P: Glycine cleavage system P-protein; InterPro 95.52
KOG3843|consensus432 95.02
TIGR00461 939 gcvP glycine dehydrogenase (decarboxylating). This 94.81
COG0403450 GcvP Glycine cleavage system protein P (pyridoxal- 94.3
PF00155363 Aminotran_1_2: Aminotransferase class I and II 1-a 93.91
KOG1403|consensus452 93.64
KOG1402|consensus427 93.12
KOG1358|consensus467 92.63
KOG0628|consensus511 92.0
KOG0629|consensus510 91.88
COG3844407 Kynureninase [Amino acid transport and metabolism] 90.9
TIGR01264401 tyr_amTase_E tyrosine aminotransferase, eukaryotic 90.69
PLN00145430 tyrosine/nicotianamine aminotransferase; Provision 90.03
PRK08637388 hypothetical protein; Provisional 89.92
PRK07550386 hypothetical protein; Provisional 88.53
KOG0634|consensus472 88.45
PRK08912387 hypothetical protein; Provisional 88.42
KOG1405|consensus484 86.87
PRK09082386 methionine aminotransferase; Validated 86.78
PRK07309391 aromatic amino acid aminotransferase; Validated 85.63
PRK08361391 aspartate aminotransferase; Provisional 85.12
cd01494170 AAT_I Aspartate aminotransferase (AAT) superfamily 84.84
PRK08636403 aspartate aminotransferase; Provisional 84.78
PLN02656409 tyrosine transaminase 84.62
TIGR03540383 DapC_direct LL-diaminopimelate aminotransferase. T 84.49
PRK07337388 aminotransferase; Validated 84.08
COG2102223 Predicted ATPases of PP-loop superfamily [General 83.83
KOG2040|consensus1001 83.48
TIGR01265403 tyr_nico_aTase tyrosine/nicotianamine aminotransfe 82.87
PRK07777387 aminotransferase; Validated 82.68
PRK05957389 aspartate aminotransferase; Provisional 82.49
PTZ00433412 tyrosine aminotransferase; Provisional 82.48
PTZ00377481 alanine aminotransferase; Provisional 82.26
PLN02187462 rooty/superroot1 81.06
PRK09276385 LL-diaminopimelate aminotransferase; Provisional 81.05
PRK06108382 aspartate aminotransferase; Provisional 81.02
>COG1448 TyrB Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
Probab=100.00  E-value=3.1e-54  Score=426.86  Aligned_cols=376  Identities=44%  Similarity=0.804  Sum_probs=345.8

Q ss_pred             ccchhhHhhccccccCCCCCccccCCccccCCCCCCCCChHHHHHHHHHhccCCCCCCCCCCCCHHHHHHHHHHHhCCCC
Q psy14428        145 EDIKPLKQQLKGFNKDPHPKKMNLGVGAYRGEDGKPYVLPSVKEAERRIYEKNLDHEYANIGGDAKFCKLAAQLAYGEDF  224 (583)
Q Consensus       145 ~~~~~i~~l~~~~~~~~~~~~i~l~~g~~~~~~~~p~~~~~v~~a~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g  224 (583)
                      .+.++|+.+.+.++++.++++|||++|.+.++.|.++..+.|++|.+.+.+......|.|..|.+++++++++.+.....
T Consensus         8 ~p~DpIlgL~e~f~~D~R~~KVNLgIGvY~de~Gk~pvl~aV~~Ae~~l~~~~~~k~Yl~i~G~~~f~~~~~~llFG~d~   87 (396)
T COG1448           8 APADPILGLKEAFKADPRPNKVNLGIGVYKDEDGKTPVLRAVKKAEKRLLEQEKTKNYLPIEGLPEFLEAVQKLLFGADS   87 (396)
T ss_pred             CCCCchhHHHHHHhcCCCcCeeeeeeeeeeCCCCCcchhHHHHHHHHHhhccccccccCCcCCcHHHHHHHHHHhcCCCc
Confidence            36889999999999999999999999999999999989999999999999887788999999999999999999987666


Q ss_pred             CCCCCCCeEEEecCCchhHHHHHHHHHHHhCCCCCEEEEcCCCChhhHHHHhhcCCeEEEEecccCCCCCCChhhHHHHH
Q psy14428        225 PAFKDNRLAIVQGISGSGSLRVGTAFLERFYPGVKTVYFPTPTWNGHVRFCTDSRLNVGAYRYFDNKTNGLDFAGMMEDI  304 (583)
Q Consensus       225 ~~~~~~~I~i~~t~G~~~al~l~~~~l~~~~~~gd~Vlv~~P~y~~~~~~~~~~G~~~~~v~~~d~~~~g~d~~~l~~~l  304 (583)
                      ..++.++|.-+||.||++|+.+.+.++..+.+ ..+|++++|+|+++..+|+.+|.++..+|++|.++.++|++.+.+.|
T Consensus        88 ~~l~~~Rv~t~Qt~GGTGAL~~~A~fl~~~~~-~~~vwis~PtW~NH~~If~~aGl~v~~Y~Yyd~~~~~~df~~mla~L  166 (396)
T COG1448          88 PALAEDRVATVQTLGGTGALRVAADFLARFFP-DATVWISDPTWPNHKAIFEAAGLEVETYPYYDAETKGLDFDGMLADL  166 (396)
T ss_pred             HHHHhhhHhheecCCcchHHHHHHHHHHHhCC-CceEEeCCCCcHhHHHHHHhcCCceeeeeccccccccccHHHHHHHH
Confidence            66888999999999999999999999988887 67899999999999999999999999999999998999999999999


Q ss_pred             HcCCCCcEEEEeCCCCCCCCCCCCHHHHHHHHHHHHhcCeEEEEeccCCCCCCCCCCCchHHHHHHHHhcCcEEEEecCc
Q psy14428        305 KAMPERSILFLQTSSHNPTGVDLSEDQWRQLAVVVKQRHLYPFFDMAYLGLTSGDFDKDAFSLRYFAKEVGQLCLAQSFS  384 (583)
Q Consensus       305 ~~~~~~~~~i~i~~p~NPTG~~~s~~~~~~l~~~a~~~~i~iI~De~Y~~l~~~~~~~~~~~~~~~~~~~~~vi~i~S~S  384 (583)
                      ++.+++..+++-+++|||||..++.++|++|+++.++++++.+.|-+|++|..+ .+++...++.++.....+++..|||
T Consensus       167 ~~a~~~~vvLLH~CcHNPTG~D~t~~qW~~l~~~~~~r~lip~~D~AYQGF~~G-leeDa~~lR~~a~~~~~~lva~S~S  245 (396)
T COG1448         167 KTAPEGSVVLLHGCCHNPTGIDPTEEQWQELADLIKERGLIPFFDIAYQGFADG-LEEDAYALRLFAEVGPELLVASSFS  245 (396)
T ss_pred             HhCCCCCEEEEecCCCCCCCCCCCHHHHHHHHHHHHHcCCeeeeehhhhhhccc-hHHHHHHHHHHHHhCCcEEEEehhh
Confidence            999999999999999999999999999999999999999999999999999977 4567888888887777799999999


Q ss_pred             ccccccCccceEEEEEcCCchhHHHHHHHHHHHHhccccCCChHHHHHHHHHhCChhhhhhhhhHHHHHHHHHHHHhhcc
Q psy14428        385 KNMGLYGERVGTFSVLTPTSDETERIMSQLKILIRGFYSNPPIHGARIVTEILSDPKLKAQCDETERIMSQLKILIRGFY  464 (583)
Q Consensus       385 K~~~l~GlRiG~lv~~~p~~~~~~~li~~l~~~~~~~~~~~s~~~q~~~~~~l~~~~~~~~~~~~~~~~~~l~~~~r~~~  464 (583)
                      |+||+.|.|+|.+.+++++++                                          ...++.+|++..+|..|
T Consensus       246 KnfgLYgERVGa~~vva~~~~------------------------------------------~a~~v~sqlk~~iR~~y  283 (396)
T COG1448         246 KNFGLYGERVGALSVVAEDAE------------------------------------------EADRVLSQLKAIIRTNY  283 (396)
T ss_pred             hhhhhhhhccceeEEEeCCHH------------------------------------------HHHHHHHHHHHHHHhcc
Confidence            999999999999998777643                                          34466778889999999


Q ss_pred             CCCccchhhHHHHhcCChhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCcccccccccceeecCCChhhhhhhhh
Q psy14428        465 SNPPIHGARIVTEILSDPKLKAQWFEECKGMSNRISSIREELKSKILDKGSKKNWDHITNQKGMFCYTGLSASQGMSNRI  544 (583)
Q Consensus       465 ~~~p~~g~~i~~~~l~~~~~~~~~~~~l~~~~~~~~~~r~~l~~~L~~~~~pg~~~~~~~~~g~f~~~~l~~~~~~~~~~  544 (583)
                      ++||.+|+.++..+++||++++.|.+++..||+|+.++|..|.+.|++.+.+.+|+++..|.|||+|++++++|+++   
T Consensus       284 SnPP~~Ga~vva~IL~~p~Lra~W~~El~~Mr~Ri~~mR~~lv~~L~~~~~~~~f~~i~~Q~GMFsy~Gls~~QV~r---  360 (396)
T COG1448         284 SNPPAHGAAVVATILNNPELRAEWEQELEEMRQRILEMRQALVDALKALGAPRNFDFIISQRGMFSYTGLSPEQVDR---  360 (396)
T ss_pred             CCCchhhHHHHHHHhCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhCCCcccchHhhcCceeecCCCCHHHHHH---
Confidence            99999999999999999999999999999999999999999999999998888899999999999999999999877   


Q ss_pred             hhhHHHHHHHHhhcCCCccccccccCCcceeecCCCCC
Q psy14428        545 SSIREELKSKILDKGSKKNWDHITNQKGMFCYTGLSAS  582 (583)
Q Consensus       545 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  582 (583)
                        +++++.+++++            . |++|.+||++.
T Consensus       361 --Lree~~IY~v~------------s-GRi~vaGl~~~  383 (396)
T COG1448         361 --LREEFGIYLVA------------S-GRINVAGLNTS  383 (396)
T ss_pred             --HHHhccEEEec------------C-CeeeeccCChh
Confidence              78888777653            3 68888888764



>PRK09257 aromatic amino acid aminotransferase; Provisional Back     alignment and domain information
>PTZ00376 aspartate aminotransferase; Provisional Back     alignment and domain information
>COG0436 Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02397 aspartate transaminase Back     alignment and domain information
>COG1167 ARO8 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>KOG1411|consensus Back     alignment and domain information
>KOG1412|consensus Back     alignment and domain information
>KOG0257|consensus Back     alignment and domain information
>PLN02368 alanine transaminase Back     alignment and domain information
>PRK06855 aminotransferase; Validated Back     alignment and domain information
>PLN00175 aminotransferase family protein; Provisional Back     alignment and domain information
>PRK07366 succinyldiaminopimelate transaminase; Validated Back     alignment and domain information
>PRK08636 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07681 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK06348 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN00143 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PRK06207 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN02187 rooty/superroot1 Back     alignment and domain information
>PRK08068 transaminase; Reviewed Back     alignment and domain information
>PTZ00377 alanine aminotransferase; Provisional Back     alignment and domain information
>PRK09276 LL-diaminopimelate aminotransferase; Provisional Back     alignment and domain information
>PRK06290 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK09148 aminotransferase; Validated Back     alignment and domain information
>TIGR03540 DapC_direct LL-diaminopimelate aminotransferase Back     alignment and domain information
>PRK09147 succinyldiaminopimelate transaminase; Provisional Back     alignment and domain information
>PLN02656 tyrosine transaminase Back     alignment and domain information
>PLN02450 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK05942 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07682 hypothetical protein; Validated Back     alignment and domain information
>PLN02376 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PLN02231 alanine transaminase Back     alignment and domain information
>PRK08960 hypothetical protein; Provisional Back     alignment and domain information
>PLN00145 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PRK12414 putative aminotransferase; Provisional Back     alignment and domain information
>TIGR01264 tyr_amTase_E tyrosine aminotransferase, eukaryotic Back     alignment and domain information
>PRK15481 transcriptional regulatory protein PtsJ; Provisional Back     alignment and domain information
>PRK09082 methionine aminotransferase; Validated Back     alignment and domain information
>PRK07683 aminotransferase A; Validated Back     alignment and domain information
>TIGR03538 DapC_gpp succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK05839 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00433 tyrosine aminotransferase; Provisional Back     alignment and domain information
>PRK07590 L,L-diaminopimelate aminotransferase; Validated Back     alignment and domain information
>PRK08637 hypothetical protein; Provisional Back     alignment and domain information
>PRK08912 hypothetical protein; Provisional Back     alignment and domain information
>PLN02607 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK08175 aminotransferase; Validated Back     alignment and domain information
>PRK13355 bifunctional HTH-domain containing protein/aminotransferase; Provisional Back     alignment and domain information
>PRK07337 aminotransferase; Validated Back     alignment and domain information
>PRK05957 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR03537 DapC succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK07309 aromatic amino acid aminotransferase; Validated Back     alignment and domain information
>PRK06108 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08361 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK06107 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07550 hypothetical protein; Provisional Back     alignment and domain information
>PRK07777 aminotransferase; Validated Back     alignment and domain information
>PRK07324 transaminase; Validated Back     alignment and domain information
>PRK02610 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK09440 avtA valine--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK08363 alanine aminotransferase; Validated Back     alignment and domain information
>TIGR01265 tyr_nico_aTase tyrosine/nicotianamine aminotransferases Back     alignment and domain information
>PRK09265 aminotransferase AlaT; Validated Back     alignment and domain information
>PRK09275 aspartate aminotransferase; Provisional Back     alignment and domain information
>PF00155 Aminotran_1_2: Aminotransferase class I and II 1-aminocyclopropane-1-carboxylate synthase signature aspartate aminotransferase signature; InterPro: IPR004839 Aminotransferases share certain mechanistic features with other pyridoxal-phosphate dependent enzymes, such as the covalent binding of the pyridoxal-phosphate group to a lysine residue Back     alignment and domain information
>TIGR03542 DAPAT_plant LL-diaminopimelate aminotransferase Back     alignment and domain information
>KOG0256|consensus Back     alignment and domain information
>PRK07865 N-succinyldiaminopimelate aminotransferase; Reviewed Back     alignment and domain information
>COG1168 MalY Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07568 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK01533 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>TIGR03539 DapC_actino succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK05764 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK06358 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK06836 aspartate aminotransferase; Provisional Back     alignment and domain information
>KOG0259|consensus Back     alignment and domain information
>TIGR03801 asp_4_decarbox aspartate 4-decarboxylase Back     alignment and domain information
>PRK03317 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK14809 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK05166 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK07392 threonine-phosphate decarboxylase; Validated Back     alignment and domain information
>KOG0634|consensus Back     alignment and domain information
>PRK08153 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PRK03158 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN03026 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK09105 putative aminotransferase; Provisional Back     alignment and domain information
>PRK05387 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK14808 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK14807 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK08056 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK04870 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>COG0079 HisC Histidinol-phosphate/aromatic aminotransferase and cobyric acid decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK04781 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK03967 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK07908 hypothetical protein; Provisional Back     alignment and domain information
>PRK06425 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK06225 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK03321 putative aminotransferase; Provisional Back     alignment and domain information
>PRK01688 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK02731 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK05664 threonine-phosphate decarboxylase; Reviewed Back     alignment and domain information
>PRK04635 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR01141 hisC histidinol-phosphate aminotransferase Back     alignment and domain information
>PRK08354 putative aminotransferase; Provisional Back     alignment and domain information
>PRK06959 putative threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK00950 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>TIGR01140 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxylase Back     alignment and domain information
>COG1448 TyrB Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>COG3977 Alanine-alpha-ketoisovalerate (or valine-pyruvate) aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>cd00609 AAT_like Aspartate aminotransferase family Back     alignment and domain information
>KOG0258|consensus Back     alignment and domain information
>PRK13238 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-dependent; Provisional Back     alignment and domain information
>KOG0633|consensus Back     alignment and domain information
>cd00617 Tnase_like Tryptophanase family (Tnase) Back     alignment and domain information
>KOG1411|consensus Back     alignment and domain information
>PRK10534 L-threonine aldolase; Provisional Back     alignment and domain information
>PRK07049 methionine gamma-lyase; Validated Back     alignment and domain information
>TIGR03576 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 family Back     alignment and domain information
>TIGR00858 bioF 8-amino-7-oxononanoate synthase Back     alignment and domain information
>PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional Back     alignment and domain information
>PRK02627 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>TIGR01825 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransferase, putative Back     alignment and domain information
>TIGR00707 argD acetylornithine and succinylornithine aminotransferases Back     alignment and domain information
>cd06502 TA_like Low-specificity threonine aldolase (TA) Back     alignment and domain information
>PF12897 Aminotran_MocR: Alanine-glyoxylate amino-transferase; InterPro: IPR024551 This entry represents a family of putative aminotransferases Back     alignment and domain information
>PLN02721 threonine aldolase Back     alignment and domain information
>TIGR01822 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase Back     alignment and domain information
>KOG1412|consensus Back     alignment and domain information
>PLN02242 methionine gamma-lyase Back     alignment and domain information
>PRK05958 8-amino-7-oxononanoate synthase; Reviewed Back     alignment and domain information
>PRK06234 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK03244 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>cd00378 SHMT Serine-glycine hydroxymethyltransferase (SHMT) Back     alignment and domain information
>PLN02822 serine palmitoyltransferase Back     alignment and domain information
>PRK08247 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>TIGR02539 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) Back     alignment and domain information
>PRK01278 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK08088 4-aminobutyrate aminotransferase; Validated Back     alignment and domain information
>PLN02483 serine palmitoyltransferase Back     alignment and domain information
>TIGR02080 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase Back     alignment and domain information
>cd00610 OAT_like Acetyl ornithine aminotransferase family Back     alignment and domain information
>PRK06460 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03392 FeS_syn_CsdA cysteine desulfurase, catalytic subunit CsdA Back     alignment and domain information
>PRK08133 O-succinylhomoserine sulfhydrylase; Validated Back     alignment and domain information
>PRK13392 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PRK08045 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK08249 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>cd06452 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>cd00613 GDC-P Glycine cleavage system P-protein, alpha- and beta-subunits Back     alignment and domain information
>PRK07503 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK06767 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK07811 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK10874 cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>PRK02936 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>TIGR00713 hemL glutamate-1-semialdehyde-2,1-aminomutase Back     alignment and domain information
>PRK07504 O-succinylhomoserine sulfhydrylase; Reviewed Back     alignment and domain information
>TIGR01979 sufS cysteine desulfurases, SufS subfamily Back     alignment and domain information
>PRK08776 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK05093 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Reviewed Back     alignment and domain information
>PRK07050 cystathionine beta-lyase; Provisional Back     alignment and domain information
>TIGR02379 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase Back     alignment and domain information
>cd00614 CGS_like CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis Back     alignment and domain information
>TIGR01976 am_tr_V_VC1184 cysteine desulfurase family protein, VC1184 subfamily Back     alignment and domain information
>PRK08861 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK02948 cysteine desulfurase; Provisional Back     alignment and domain information
>PRK08574 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>TIGR01326 OAH_OAS_sulfhy OAH/OAS sulfhydrylase Back     alignment and domain information
>TIGR01325 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase Back     alignment and domain information
>PRK07810 O-succinylhomoserine sulfhydrylase; Provisional Back     alignment and domain information
>PRK07582 cystathionine gamma-lyase; Validated Back     alignment and domain information
>PRK07179 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01328 met_gam_lyase methionine gamma-lyase Back     alignment and domain information
>PRK04073 rocD ornithine--oxo-acid transaminase; Provisional Back     alignment and domain information
>PRK09295 bifunctional cysteine desulfurase/selenocysteine lyase; Validated Back     alignment and domain information
>cd06453 SufS_like Cysteine desulfurase (SufS)-like Back     alignment and domain information
>cd06450 DOPA_deC_like DOPA decarboxylase family Back     alignment and domain information
>PLN02409 serine--glyoxylate aminotransaminase Back     alignment and domain information
>TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase Back     alignment and domain information
>PRK11658 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK11706 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisional Back     alignment and domain information
>TIGR01437 selA_rel uncharacterized pyridoxal phosphate-dependent enzyme Back     alignment and domain information
>PRK09331 Sep-tRNA:Cys-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR03403 nifS_epsilon cysteine desulfurase, NifS family, epsilon proteobacteria type Back     alignment and domain information
>PRK12381 bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional Back     alignment and domain information
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>PLN02855 Bifunctional selenocysteine lyase/cysteine desulfurase Back     alignment and domain information
>PRK04260 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK09028 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK09064 5-aminolevulinate synthase; Validated Back     alignment and domain information
>PRK05939 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01821 5aminolev_synth 5-aminolevulinic acid synthase Back     alignment and domain information
>PRK00011 glyA serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>PRK07269 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>cd00615 Orn_deC_like Ornithine decarboxylase family Back     alignment and domain information
>PRK13479 2-aminoethylphosphonate--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK08248 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>TIGR01324 cysta_beta_ly_B cystathionine beta-lyase, bacterial Back     alignment and domain information
>PRK00854 rocD ornithine--oxo-acid transaminase; Reviewed Back     alignment and domain information
>PRK00451 glycine dehydrogenase subunit 1; Validated Back     alignment and domain information
>PRK06702 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>TIGR01329 cysta_beta_ly_E cystathionine beta-lyase, eukaryotic Back     alignment and domain information
>PRK08064 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK07671 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK09792 4-aminobutyrate transaminase; Provisional Back     alignment and domain information
>PRK06084 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PLN00144 acetylornithine transaminase Back     alignment and domain information
>PLN02509 cystathionine beta-lyase Back     alignment and domain information
>PLN03227 serine palmitoyltransferase-like protein; Provisional Back     alignment and domain information
>TIGR02326 transamin_PhnW 2-aminoethylphosphonate--pyruvate transaminase Back     alignment and domain information
>PRK05968 hypothetical protein; Provisional Back     alignment and domain information
>cd01494 AAT_I Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>TIGR03235 DNA_S_dndA cysteine desulfurase DndA Back     alignment and domain information
>PRK06918 4-aminobutyrate aminotransferase; Reviewed Back     alignment and domain information
>PTZ00125 ornithine aminotransferase-like protein; Provisional Back     alignment and domain information
>PRK05967 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK13393 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PRK06176 cystathionine gamma-synthase/cystathionine beta-lyase; Validated Back     alignment and domain information
>PRK07505 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02006 IscS cysteine desulfurase IscS Back     alignment and domain information
>TIGR03402 FeS_nifS cysteine desulfurase NifS Back     alignment and domain information
>TIGR03588 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase Back     alignment and domain information
>TIGR03531 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium transferase Back     alignment and domain information
>PRK14012 cysteine desulfurase; Provisional Back     alignment and domain information
>TIGR00700 GABAtrnsam 4-aminobutyrate aminotransferase, prokaryotic type Back     alignment and domain information
>TIGR01977 am_tr_V_EF2568 cysteine desulfurase family protein Back     alignment and domain information
>TIGR03812 tyr_de_CO2_Arch tyrosine decarboxylase MnfA Back     alignment and domain information
>PRK13520 L-tyrosine decarboxylase; Provisional Back     alignment and domain information
>PRK08360 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK04366 glycine dehydrogenase subunit 2; Validated Back     alignment and domain information
>PRK04612 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK15407 lipopolysaccharide biosynthesis protein RfbH; Provisional Back     alignment and domain information
>PRK05994 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PLN02624 ornithine-delta-aminotransferase Back     alignment and domain information
>TIGR01885 Orn_aminotrans ornithine aminotransferase Back     alignment and domain information
>PRK00062 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>TIGR03246 arg_catab_astC succinylornithine transaminase family Back     alignment and domain information
>PLN02651 cysteine desulfurase Back     alignment and domain information
>cd00616 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn) Back     alignment and domain information
>PRK07495 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK06777 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PLN02955 8-amino-7-oxononanoate synthase Back     alignment and domain information
>PRK08134 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK07812 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>COG0399 WecE Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK08117 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>TIGR02618 tyr_phenol_ly tyrosine phenol-lyase Back     alignment and domain information
>TIGR02407 ectoine_ectB diaminobutyrate--2-oxoglutarate aminotransferase Back     alignment and domain information
>PRK08114 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PF01053 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent enzyme; InterPro: IPR000277 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PRK05937 8-amino-7-oxononanoate synthase; Provisional Back     alignment and domain information
>PF01041 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransferase family; InterPro: IPR000653 This entry represents a family that are probably all pyridoxal-phosphate-dependent aminotransferase enzymes with a variety of molecular functions Back     alignment and domain information
>COG0156 BioF 7-keto-8-aminopelargonate synthetase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>PRK09264 diaminobutyrate--2-oxoglutarate aminotransferase; Validated Back     alignment and domain information
>COG0520 csdA Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05613 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK13237 tyrosine phenol-lyase; Provisional Back     alignment and domain information
>PRK06058 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK04311 selenocysteine synthase; Provisional Back     alignment and domain information
>PRK06434 cystathionine gamma-lyase; Validated Back     alignment and domain information
>TIGR00709 dat 2,4-diaminobutyrate 4-transaminases Back     alignment and domain information
>PRK08593 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>KOG0053|consensus Back     alignment and domain information
>COG0626 MetC Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05964 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>TIGR00474 selA seryl-tRNA(sec) selenium transferase Back     alignment and domain information
>PF00266 Aminotran_5: Aminotransferase class-V; InterPro: IPR000192 Aminotransferases share certain mechanistic features with other pyridoxal- phosphate dependent enzymes, such as the covalent binding of the pyridoxal- phosphate group to a lysine residue Back     alignment and domain information
>PLN02994 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PF01212 Beta_elim_lyase: Beta-eliminating lyase; InterPro: IPR001597 This domain is found in many tryptophanases (tryptophan indole-lyase, TNase), tyrosine phenol-lyases (TPL) and threonine aldolases Back     alignment and domain information
>COG2008 GLY1 Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK03715 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK06541 hypothetical protein; Provisional Back     alignment and domain information
>PRK02769 histidine decarboxylase; Provisional Back     alignment and domain information
>KOG1549|consensus Back     alignment and domain information
>TIGR01814 kynureninase kynureninase Back     alignment and domain information
>PF01276 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; InterPro: IPR000310 Pyridoxal-dependent decarboxylases are bacterial proteins acting on ornithine, lysine, arginine and related substrates [] Back     alignment and domain information
>COG1104 NifS Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>COG2873 MET17 O-acetylhomoserine sulfhydrylase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13034 serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>COG0075 Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PF04864 Alliinase_C: Allinase; InterPro: IPR006948 Allicin is a thiosulphinate that gives rise to dithiines, allyl sulphides and ajoenes, the three groups of active compounds in Allium species Back     alignment and domain information
>PLN03032 serine decarboxylase; Provisional Back     alignment and domain information
>PRK05769 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK13580 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PLN02482 glutamate-1-semialdehyde 2,1-aminomutase Back     alignment and domain information
>TIGR03372 putres_am_tran putrescine aminotransferase Back     alignment and domain information
>KOG1368|consensus Back     alignment and domain information
>PRK12389 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>COG1103 Archaea-specific pyridoxal phosphate-dependent enzymes [General function prediction only] Back     alignment and domain information
>PRK04013 argD acetylornithine/acetyl-lysine aminotransferase; Provisional Back     alignment and domain information
>COG4992 ArgD Ornithine/acetylornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0160 GabT 4-aminobutyrate aminotransferase and related aminotransferases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00615 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>COG0076 GadB Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism] Back     alignment and domain information
>COG0001 HemL Glutamate-1-semialdehyde aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK11522 putrescine--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK15029 arginine decarboxylase; Provisional Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK05639 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK06062 hypothetical protein; Provisional Back     alignment and domain information
>PRK07046 aminotransferase; Validated Back     alignment and domain information
>PRK07986 adenosylmethionine--8-amino-7-oxononanoate transaminase; Validated Back     alignment and domain information
>PTZ00094 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>cd00611 PSAT_like Phosphoserine aminotransferase (PSAT) family Back     alignment and domain information
>PRK06943 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK13360 omega amino acid--pyruvate transaminase; Provisional Back     alignment and domain information
>PLN02760 4-aminobutyrate:pyruvate transaminase Back     alignment and domain information
>PRK05965 hypothetical protein; Provisional Back     alignment and domain information
>PRK06082 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK07482 hypothetical protein; Provisional Back     alignment and domain information
>PLN02263 serine decarboxylase Back     alignment and domain information
>PRK12403 putative aminotransferase; Provisional Back     alignment and domain information
>PRK07030 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>TIGR01788 Glu-decarb-GAD glutamate decarboxylase Back     alignment and domain information
>TIGR00508 bioA adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>PF00202 Aminotran_3: Aminotransferase class-III; InterPro: IPR005814 Aminotransferases share certain mechanistic features with other pyridoxalphosphate-dependent enzymes, such as the covalent binding of the pyridoxalphosphate group to a lysine residue Back     alignment and domain information
>PRK09221 beta alanine--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK06173 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK06916 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>TIGR02617 tnaA_trp_ase tryptophanase, leader peptide-associated Back     alignment and domain information
>PF06838 Met_gamma_lyase: Methionine gamma-lyase ; InterPro: IPR009651 This family represents the aluminium resistance protein, which confers resistance to aluminium in bacteria [] Back     alignment and domain information
>PRK06105 aminotransferase; Provisional Back     alignment and domain information
>TIGR01364 serC_1 phosphoserine aminotransferase Back     alignment and domain information
>PRK08742 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK07481 hypothetical protein; Provisional Back     alignment and domain information
>PRK07036 hypothetical protein; Provisional Back     alignment and domain information
>PRK07483 hypothetical protein; Provisional Back     alignment and domain information
>PRK07678 aminotransferase; Validated Back     alignment and domain information
>PRK06938 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK15400 lysine decarboxylase CadA; Provisional Back     alignment and domain information
>PRK05630 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PLN02880 tyrosine decarboxylase Back     alignment and domain information
>PLN02590 probable tyrosine decarboxylase Back     alignment and domain information
>PRK06917 hypothetical protein; Provisional Back     alignment and domain information
>PRK06209 glutamate-1-semialdehyde 2,1-aminomutase; Provisional Back     alignment and domain information
>PLN03226 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PLN02271 serine hydroxymethyltransferase Back     alignment and domain information
>PRK06931 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>COG1921 SelA Selenocysteine synthase [seryl-tRNASer selenium transferase] [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07480 putative aminotransferase; Validated Back     alignment and domain information
>PRK15399 lysine decarboxylase LdcC; Provisional Back     alignment and domain information
>KOG1401|consensus Back     alignment and domain information
>PRK05355 3-phosphoserine/phosphohydroxythreonine aminotransferase; Provisional Back     alignment and domain information
>TIGR03799 NOD_PanD_pyr putative pyridoxal-dependent aspartate 1-decarboxylase Back     alignment and domain information
>PRK06149 hypothetical protein; Provisional Back     alignment and domain information
>PLN02724 Molybdenum cofactor sulfurase Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PF00464 SHMT: Serine hydroxymethyltransferase; InterPro: IPR001085 Synonym(s): Serine hydroxymethyltransferase, Serine aldolase, Threonine aldolase Serine hydroxymethyltransferase (SHMT) is a pyridoxal phosphate (PLP) dependent enzyme and belongs to the aspartate aminotransferase superfamily (fold type I) [] Back     alignment and domain information
>PF00282 Pyridoxal_deC: Pyridoxal-dependent decarboxylase conserved domain; InterPro: IPR002129 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>KOG1359|consensus Back     alignment and domain information
>PRK13578 ornithine decarboxylase; Provisional Back     alignment and domain information
>COG1982 LdcC Arginine/lysine/ornithine decarboxylases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06148 hypothetical protein; Provisional Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>COG0112 GlyA Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1360|consensus Back     alignment and domain information
>PRK03080 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>KOG1404|consensus Back     alignment and domain information
>PRK08297 L-lysine aminotransferase; Provisional Back     alignment and domain information
>TIGR03251 LAT_fam L-lysine 6-transaminase Back     alignment and domain information
>TIGR00699 GABAtrns_euk 4-aminobutyrate aminotransferase, eukaryotic type Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>KOG2862|consensus Back     alignment and domain information
>PF03841 SelA: L-seryl-tRNA selenium transferase; InterPro: IPR018319 In prokaryotes, the incorporation of selenocysteine as the 21st amino acid, encoded by TGA, requires several elements: SelC is the tRNA itself, SelD acts as a donor of reduced selenium, SelA modifies a serine residue on SelC into selenocysteine, and SelB is a selenocysteine-specific translation elongation factor Back     alignment and domain information
>TIGR03811 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcus type Back     alignment and domain information
>TIGR01366 serC_3 phosphoserine aminotransferase, putative Back     alignment and domain information
>PLN02452 phosphoserine transaminase Back     alignment and domain information
>PLN02397 aspartate transaminase Back     alignment and domain information
>PLN02974 adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>COG4100 Cystathionine beta-lyase family protein involved in aluminum resistance [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01365 serC_2 phosphoserine aminotransferase, Methanosarcina type Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>COG0161 BioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>KOG1357|consensus Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>KOG1383|consensus Back     alignment and domain information
>PTZ00376 aspartate aminotransferase; Provisional Back     alignment and domain information
>COG1003 GcvP Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>PF05889 SLA_LP_auto_ag: Soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen); InterPro: IPR008829 This family consists of several eukaryotic and archaeal proteins which are related to the Homo sapiens soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen) Back     alignment and domain information
>PRK12462 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>COG3033 TnaA Tryptophanase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09257 aromatic amino acid aminotransferase; Provisional Back     alignment and domain information
>PF02347 GDC-P: Glycine cleavage system P-protein; InterPro: IPR020580 This family consists of glycine cleavage system P-proteins (1 Back     alignment and domain information
>KOG3843|consensus Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>COG0403 GcvP Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>PF00155 Aminotran_1_2: Aminotransferase class I and II 1-aminocyclopropane-1-carboxylate synthase signature aspartate aminotransferase signature; InterPro: IPR004839 Aminotransferases share certain mechanistic features with other pyridoxal-phosphate dependent enzymes, such as the covalent binding of the pyridoxal-phosphate group to a lysine residue Back     alignment and domain information
>KOG1403|consensus Back     alignment and domain information
>KOG1402|consensus Back     alignment and domain information
>KOG1358|consensus Back     alignment and domain information
>KOG0628|consensus Back     alignment and domain information
>KOG0629|consensus Back     alignment and domain information
>COG3844 Kynureninase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01264 tyr_amTase_E tyrosine aminotransferase, eukaryotic Back     alignment and domain information
>PLN00145 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PRK08637 hypothetical protein; Provisional Back     alignment and domain information
>PRK07550 hypothetical protein; Provisional Back     alignment and domain information
>KOG0634|consensus Back     alignment and domain information
>PRK08912 hypothetical protein; Provisional Back     alignment and domain information
>KOG1405|consensus Back     alignment and domain information
>PRK09082 methionine aminotransferase; Validated Back     alignment and domain information
>PRK07309 aromatic amino acid aminotransferase; Validated Back     alignment and domain information
>PRK08361 aspartate aminotransferase; Provisional Back     alignment and domain information
>cd01494 AAT_I Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>PRK08636 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN02656 tyrosine transaminase Back     alignment and domain information
>TIGR03540 DapC_direct LL-diaminopimelate aminotransferase Back     alignment and domain information
>PRK07337 aminotransferase; Validated Back     alignment and domain information
>COG2102 Predicted ATPases of PP-loop superfamily [General function prediction only] Back     alignment and domain information
>KOG2040|consensus Back     alignment and domain information
>TIGR01265 tyr_nico_aTase tyrosine/nicotianamine aminotransferases Back     alignment and domain information
>PRK07777 aminotransferase; Validated Back     alignment and domain information
>PRK05957 aspartate aminotransferase; Provisional Back     alignment and domain information
>PTZ00433 tyrosine aminotransferase; Provisional Back     alignment and domain information
>PTZ00377 alanine aminotransferase; Provisional Back     alignment and domain information
>PLN02187 rooty/superroot1 Back     alignment and domain information
>PRK09276 LL-diaminopimelate aminotransferase; Provisional Back     alignment and domain information
>PRK06108 aspartate aminotransferase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query583
3pd6_A401 Crystal Structure Of Mouse Mitochondrial Aspartate 1e-104
3hlm_A401 Crystal Structure Of Mouse Mitochondrial Aspartate 1e-104
7aat_A401 X-Ray Structure Refinement And Comparison Of Three 1e-100
1aka_A401 Structural Basis For The Catalytic Activity Of Aspa 1e-100
1ajs_A412 Refinement And Comparison Of The Crystal Structures 5e-83
1ajr_A412 Refinement And Comparison Of The Crystal Structures 2e-82
3ii0_A422 Crystal Structure Of Human Glutamate Oxaloacetate T 2e-80
2cst_A411 Crystal Structure Of The Closed Form Of Chicken Cyt 3e-79
1aat_A411 Oxoglutarate-Induced Conformational Changes In Cyto 1e-78
4eu1_A409 Structure Of A Mitochondrial Aspartate Aminotransfe 4e-71
1yaa_A412 Aspartate Aminotransferase From Saccharomyces Cerev 2e-67
3tat_A397 Tyrosine Aminotransferase From E. Coli Length = 397 2e-64
3fsl_A397 Crystal Structure Of Tyrosine Aminotransferase Trip 1e-62
4h51_A420 Crystal Structure Of A Putative Aspartate Aminotran 6e-62
4f4e_A420 Crystal Structure Of Aromatic-Amino-Acid Aminotrans 7e-60
4eff_A420 Crystal Structure Of Aromatic-Amino-Acid Aminotrans 7e-60
3meb_A448 Structure Of Cytoplasmic Aspartate Aminotransferase 2e-58
1b4x_A396 Aspartate Aminotransferase From E. Coli, C191s Muta 4e-56
3aat_A396 Activity And Structure Of The Active-Site Mutants R 1e-55
1asl_A396 Crystal Structures Of Escherichia Coli Aspartate Am 1e-55
1qir_A396 Aspartate Aminotransferase From Escherichia Coli, C 2e-55
1qit_A396 Aspartate Aminotransferase From Escherichia Coli, C 2e-55
1qis_A396 Aspartate Aminotransferase From Escherichia Coli, C 2e-55
1ix6_A396 Aspartate Aminotransferase Active Site Mutant V39f 3e-55
1asf_A396 The Structural Basis For The Reduced Activity Of Th 3e-55
2q7w_A396 Structural Studies Reveals The Inactivation Of E. C 4e-55
2aat_A396 2.8-Angstroms-Resolution Crystal Structure Of An Ac 5e-55
1aia_A396 Structural Basis For The Catalytic Activity Of Aspa 5e-55
4f5m_A406 Wild-type E. Coli Aspartate Aminotransferase: A Tem 5e-55
1g7w_A396 Aspartate Aminotransferase Active Site Mutant N194a 8e-55
1aam_A396 The Structural Basis For The Altered Substrate Spec 9e-55
1asb_A396 The Structural Basis For The Reduced Activity Of Th 9e-55
1arh_A396 Aspartate Aminotransferase, Y225rR386A MUTANT Lengt 1e-54
1ix8_A396 Aspartate Aminotransferase Active Site Mutant V39fN 2e-54
1g4v_A396 Aspartate Aminotransferase Active Site Mutant N194a 2e-54
4f5f_A406 Structure Of Aspartate Aminotransferase Conversion 4e-54
1bqa_A396 Aspartate Aminotransferase P195a Mutant Length = 39 4e-54
1ahy_A396 Aspartate Aminotransferase Hexamutant Length = 396 5e-54
1ari_A396 Aspartate Aminotransferase, W140h Mutant, Maleate C 5e-54
1g4x_A396 Aspartate Aminotransferase Active Site Mutant N194a 6e-54
1g7x_A396 Aspartate Aminotransferase Active Site Mutant N194a 7e-54
2d5y_A396 Aspartate Aminotransferase Mutant Mc With Isovaleri 2e-53
1toe_A396 Unliganded Structure Of Hexamutant + A293d Mutant O 3e-53
3zzj_A396 Structure Of An Engineered Aspartate Aminotransfera 3e-53
1bqd_A396 Aspartate Aminotransferase P138aP195A DOUBLE MUTANT 4e-53
2d61_A396 Aspartate Aminotransferase Mutant Ma With Maleic Ac 5e-53
1toj_A396 Hydrocinnamic Acid-Bound Structure Of Srhept Mutant 5e-53
4f5j_A406 Rational Design And Directed Evolution For Conversi 7e-53
1tog_A396 Hydrocinnamic Acid-Bound Structure Of Srhept + A293 9e-53
4f5i_A406 Substrate Specificity Conversion Of E. Coli Pyridox 2e-52
2d66_A396 Aspartate Aminotransferase Mutant Mab Length = 396 2e-52
4f5h_A406 Intercoversion Of Substrate Specificity: E. Coli As 3e-52
4f5g_A406 Rational Design And Directed Evolution Of E. Coli A 4e-52
4f5k_A406 Substrate Specificity Conversion Of Aspartate Amino 7e-52
1czc_A396 Aspartate Aminotransferase Mutant Atb17139S142N WIT 2e-51
2d64_A396 Aspartate Aminotransferase Mutant Mabc With Isovale 3e-51
1yoo_A396 Aspartate Aminotransferase Mutant Atb17 With Isoval 6e-51
1ay4_A394 Aromatic Amino Acid Aminotransferase Without Substr 1e-47
3uak_A406 Crystal Structure Of De Novo Designed Cysteine Este 4e-43
3k7y_A405 Aspartate Aminotransferase Of Plasmodium Falciparum 1e-36
3rq1_A418 Crystal Structure Of Aminotransferase Class I And I 2e-09
4emy_A413 Crystal Structure Of Aminotransferase From Anaeroco 3e-06
>pdb|3PD6|A Chain A, Crystal Structure Of Mouse Mitochondrial Aspartate Aminotransferase, A Newly Identified Kynurenine Aminotransferase-Iv Length = 401 Back     alignment and structure

Iteration: 1

Score = 377 bits (967), Expect = e-104, Method: Compositional matrix adjust. Identities = 182/390 (46%), Positives = 249/390 (63%), Gaps = 42/390 (10%) Query: 149 PLKQQLKGFNKDPHPKKMNLGVGAYRGEDGKPYVLPSVKEAERRIYEKNLDHEYANIGGD 208 P+ + F +D + KKMNLGVGAYR ++GKPYVLPSV++AE +I KNLD EY IGG Sbjct: 14 PILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGL 73 Query: 209 AKFCKLAAQLAYGEDFPAFKDNRLAIVQGISGSGSLRVGTAFLERFYPGVKTVYFPTPTW 268 A+FCK +A+LA GE+ K R VQ ISG+G+LRVG +FL+RF+ + V+ P P+W Sbjct: 74 AEFCKASAELALGENNEVLKSGRFVTVQTISGTGALRVGASFLQRFFKFSRDVFLPKPSW 133 Query: 269 NGHVRFCTDSRLNVGAYRYFDNKTNGLDFAGMMEDIKAMPERSILFLQTSSHNPTGVDLS 328 H D+ + + YRY+D KT G DF+G +EDI +PE+S+L L +HNPTGVD Sbjct: 134 GNHTPIFRDAGMQLQGYRYYDPKTCGFDFSGALEDISKIPEQSVLLLHACAHNPTGVDPR 193 Query: 329 EDQWRQLAVVVKQRHLYPFFDMAYLGLTSGDFDKDAFSLRYFAKEVGQLCLAQSFSKNMG 388 +QW+++A VVK+++L+ FFDMAY G SGD DKDA+++R+F ++ +CL QS++KNMG Sbjct: 194 PEQWKEIASVVKKKNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMG 253 Query: 389 LYGERVGTFSVLTPTSDETERIMSQLKILIRGFYSNPPIHGARIVTEILSDPKLKAQCDE 448 LYGERVG F+V+ ++E +R+ SQLKILIR YSNPP++GARI IL+ P L Sbjct: 254 LYGERVGAFTVVCKDAEEAKRVESQLKILIRPLYSNPPLNGARIAATILTSPDL------ 307 Query: 449 TERIMSQLKILIRGFYSNPPIHGARIVTEILSDPKLKAQWFEECKGMSNRISSIREELKS 508 + QW +E KGM++RI S+R +L S Sbjct: 308 ------------------------------------RKQWLQEVKGMADRIISMRTQLVS 331 Query: 509 KILDKGSKKNWDHITNQKGMFCYTGLSASQ 538 + +GS NW HIT+Q GMFC+TGL Q Sbjct: 332 NLKKEGSSHNWQHITDQIGMFCFTGLKPEQ 361
>pdb|3HLM|A Chain A, Crystal Structure Of Mouse Mitochondrial Aspartate AminotransferaseKYNURENINE AMINOTRANSFERASE IV Length = 401 Back     alignment and structure
>pdb|7AAT|A Chain A, X-Ray Structure Refinement And Comparison Of Three Forms Of Mitochondrial Aspartate Aminotransferase Length = 401 Back     alignment and structure
>pdb|1AKA|A Chain A, Structural Basis For The Catalytic Activity Of Aspartate Aminotransferase K258h Lacking Its Pyridoxal-5'-Phosphate-Binding Lysine Residue Length = 401 Back     alignment and structure
>pdb|1AJS|A Chain A, Refinement And Comparison Of The Crystal Structures Of Pig Cytosolic Aspartate Aminotransferase And Its Complex With 2-Methylaspartate Length = 412 Back     alignment and structure
>pdb|1AJR|A Chain A, Refinement And Comparison Of The Crystal Structures Of Pig Cytosolic Aspartate Aminotransferase And Its Complex With 2-Methylaspartate Length = 412 Back     alignment and structure
>pdb|3II0|A Chain A, Crystal Structure Of Human Glutamate Oxaloacetate Transaminase 1 (Got1) Length = 422 Back     alignment and structure
>pdb|2CST|A Chain A, Crystal Structure Of The Closed Form Of Chicken Cytosolic Aspartate Aminotransferase At 1.9 Angstroms Resolution Length = 411 Back     alignment and structure
>pdb|1AAT|A Chain A, Oxoglutarate-Induced Conformational Changes In Cytosolic Aspartate Aminotransferase Length = 411 Back     alignment and structure
>pdb|4EU1|A Chain A, Structure Of A Mitochondrial Aspartate Aminotransferase From Trypanosoma Brucei Length = 409 Back     alignment and structure
>pdb|1YAA|A Chain A, Aspartate Aminotransferase From Saccharomyces Cerevisiae Cytoplasm Length = 412 Back     alignment and structure
>pdb|3TAT|A Chain A, Tyrosine Aminotransferase From E. Coli Length = 397 Back     alignment and structure
>pdb|3FSL|A Chain A, Crystal Structure Of Tyrosine Aminotransferase Tripple Mutant (P181q, R183g,A321k) From Escherichia Coli At 2.35 A Resolution Length = 397 Back     alignment and structure
>pdb|4H51|A Chain A, Crystal Structure Of A Putative Aspartate Aminotransferase From Leishmania Major Friedlin Length = 420 Back     alignment and structure
>pdb|4F4E|A Chain A, Crystal Structure Of Aromatic-Amino-Acid Aminotransferase From Burkholderia Pseudomallei Covalently Bound To Pyridoxal Phosphate Length = 420 Back     alignment and structure
>pdb|4EFF|A Chain A, Crystal Structure Of Aromatic-Amino-Acid Aminotransferase From Burkholderia Pseudomallei Length = 420 Back     alignment and structure
>pdb|3MEB|A Chain A, Structure Of Cytoplasmic Aspartate Aminotransferase From Giardia Lamblia Length = 448 Back     alignment and structure
>pdb|1B4X|A Chain A, Aspartate Aminotransferase From E. Coli, C191s Mutation, With Bound Maleate Length = 396 Back     alignment and structure
>pdb|3AAT|A Chain A, Activity And Structure Of The Active-Site Mutants R386y And R386f Of Escherichia Coli Aspartate Aminotransferase Length = 396 Back     alignment and structure
>pdb|1ASL|A Chain A, Crystal Structures Of Escherichia Coli Aspartate Aminotransferase In Two Conformations: Comparison Of An Unliganded Open And Two Liganded Closed Forms Length = 396 Back     alignment and structure
>pdb|1QIR|A Chain A, Aspartate Aminotransferase From Escherichia Coli, C191y Mutation, With Bound Maleate Length = 396 Back     alignment and structure
>pdb|1QIT|A Chain A, Aspartate Aminotransferase From Escherichia Coli, C191w Mutation, With Bound Maleate Length = 396 Back     alignment and structure
>pdb|1QIS|A Chain A, Aspartate Aminotransferase From Escherichia Coli, C191f Mutation, With Bound Maleate Length = 396 Back     alignment and structure
>pdb|1IX6|A Chain A, Aspartate Aminotransferase Active Site Mutant V39f Length = 396 Back     alignment and structure
>pdb|1ASF|A Chain A, The Structural Basis For The Reduced Activity Of The Y226f(Y225f) Active Site Mutant Of E. Coli Aspartate Aminotransferase Length = 396 Back     alignment and structure
>pdb|2Q7W|A Chain A, Structural Studies Reveals The Inactivation Of E. Coli L-Aspartate Aminotransferase (S)-4,5-Amino-Dihydro-2-Thiophenecarboxylic Acid (Sadta) Via Two Mechanisms At Ph 6.0 Length = 396 Back     alignment and structure
>pdb|2AAT|A Chain A, 2.8-Angstroms-Resolution Crystal Structure Of An Active-Site Mutant Of Aspartate Aminotransferase From Escherichia Coli Length = 396 Back     alignment and structure
>pdb|1AIA|A Chain A, Structural Basis For The Catalytic Activity Of Aspartate Aminotransferase K258h Lacking The Pyridoxal-5'-Phosphate Binding Lysine Residue Length = 396 Back     alignment and structure
>pdb|4F5M|A Chain A, Wild-type E. Coli Aspartate Aminotransferase: A Template For The Interconversion Of Substrate Specificity And Activity To Tyrosine Aminotransferase By The Janus Algorithm. Length = 406 Back     alignment and structure
>pdb|1G7W|A Chain A, Aspartate Aminotransferase Active Site Mutant N194aR386L Length = 396 Back     alignment and structure
>pdb|1AAM|A Chain A, The Structural Basis For The Altered Substrate Specificity Of The R292d Active Site Mutant Of Aspartate Aminotransferase From E. Coli Length = 396 Back     alignment and structure
>pdb|1ASB|A Chain A, The Structural Basis For The Reduced Activity Of The D223a(D222a) Active Site Mutant Of E. Coli Aspartate Aminotransferase Length = 396 Back     alignment and structure
>pdb|1ARH|A Chain A, Aspartate Aminotransferase, Y225rR386A MUTANT Length = 396 Back     alignment and structure
>pdb|1IX8|A Chain A, Aspartate Aminotransferase Active Site Mutant V39fN194A Length = 396 Back     alignment and structure
>pdb|1G4V|A Chain A, Aspartate Aminotransferase Active Site Mutant N194a/y225f Length = 396 Back     alignment and structure
>pdb|4F5F|A Chain A, Structure Of Aspartate Aminotransferase Conversion To Tyrosine Aminotransferase: Chimera P1. Length = 406 Back     alignment and structure
>pdb|1BQA|A Chain A, Aspartate Aminotransferase P195a Mutant Length = 396 Back     alignment and structure
>pdb|1AHY|A Chain A, Aspartate Aminotransferase Hexamutant Length = 396 Back     alignment and structure
>pdb|1ARI|A Chain A, Aspartate Aminotransferase, W140h Mutant, Maleate Complex Length = 396 Back     alignment and structure
>pdb|1G4X|A Chain A, Aspartate Aminotransferase Active Site Mutant N194aR292L Length = 396 Back     alignment and structure
>pdb|1G7X|A Chain A, Aspartate Aminotransferase Active Site Mutant N194aR292LR386L Length = 396 Back     alignment and structure
>pdb|2D5Y|A Chain A, Aspartate Aminotransferase Mutant Mc With Isovaleric Acid Length = 396 Back     alignment and structure
>pdb|1TOE|A Chain A, Unliganded Structure Of Hexamutant + A293d Mutant Of E. Coli Aspartate Aminotransferase Length = 396 Back     alignment and structure
>pdb|3ZZJ|A Chain A, Structure Of An Engineered Aspartate Aminotransferase Length = 396 Back     alignment and structure
>pdb|1BQD|A Chain A, Aspartate Aminotransferase P138aP195A DOUBLE MUTANT Length = 396 Back     alignment and structure
>pdb|2D61|A Chain A, Aspartate Aminotransferase Mutant Ma With Maleic Acid Length = 396 Back     alignment and structure
>pdb|1TOJ|A Chain A, Hydrocinnamic Acid-Bound Structure Of Srhept Mutant Of E. Coli Aspartate Aminotransferase Length = 396 Back     alignment and structure
>pdb|4F5J|A Chain A, Rational Design And Directed Evolution For Conversion Of Substrate Specificity From E.coli Aspartate Aminotransferase To Tyrosine Aminotransferase: Mutant P5. Length = 406 Back     alignment and structure
>pdb|1TOG|A Chain A, Hydrocinnamic Acid-Bound Structure Of Srhept + A293d Mutant Of E. Coli Aspartate Aminotransferase Length = 396 Back     alignment and structure
>pdb|4F5I|A Chain A, Substrate Specificity Conversion Of E. Coli Pyridoxal-5'-phosphate Dependent Aspartate Aminotransferase To Tyrosine Aminotransferase: Chimera P4. Length = 406 Back     alignment and structure
>pdb|2D66|A Chain A, Aspartate Aminotransferase Mutant Mab Length = 396 Back     alignment and structure
>pdb|4F5H|A Chain A, Intercoversion Of Substrate Specificity: E. Coli Aspatate Aminotransferase To Tyrosine Aminotransferase: Chimera P3. Length = 406 Back     alignment and structure
>pdb|4F5G|A Chain A, Rational Design And Directed Evolution Of E. Coli Apartate Aminotransferase To Tyrosine Aminotransferase: Mutant P2. Length = 406 Back     alignment and structure
>pdb|4F5K|A Chain A, Substrate Specificity Conversion Of Aspartate Aminotransferase To Tyrosine Aminotransferase By The Janus Algorithm: Chimera P6. Length = 406 Back     alignment and structure
>pdb|1CZC|A Chain A, Aspartate Aminotransferase Mutant Atb17139S142N WITH GLUTARIC ACID Length = 396 Back     alignment and structure
>pdb|2D64|A Chain A, Aspartate Aminotransferase Mutant Mabc With Isovaleric Acid Length = 396 Back     alignment and structure
>pdb|1YOO|A Chain A, Aspartate Aminotransferase Mutant Atb17 With Isovaleric Acid Length = 396 Back     alignment and structure
>pdb|1AY4|A Chain A, Aromatic Amino Acid Aminotransferase Without Substrate Length = 394 Back     alignment and structure
>pdb|3UAK|A Chain A, Crystal Structure Of De Novo Designed Cysteine Esterase Ech14, Northeast Structural Genomics Consortium Target Or54 Length = 406 Back     alignment and structure
>pdb|3K7Y|A Chain A, Aspartate Aminotransferase Of Plasmodium Falciparum Length = 405 Back     alignment and structure
>pdb|3RQ1|A Chain A, Crystal Structure Of Aminotransferase Class I And Ii From Veillonella Parvula Length = 418 Back     alignment and structure
>pdb|4EMY|A Chain A, Crystal Structure Of Aminotransferase From Anaerococcus Prevotii Dsm 20548. Length = 413 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query583
7aat_A401 Aspartate aminotransferase; transferase(aminotrans 0.0
7aat_A401 Aspartate aminotransferase; transferase(aminotrans 7e-25
7aat_A401 Aspartate aminotransferase; transferase(aminotrans 8e-25
4eu1_A409 Mitochondrial aspartate aminotransferase; ssgcid, 1e-180
4eu1_A409 Mitochondrial aspartate aminotransferase; ssgcid, 3e-25
4eu1_A409 Mitochondrial aspartate aminotransferase; ssgcid, 4e-25
3k7y_A405 Aspartate aminotransferase; aminotrans pyridoxal p 1e-179
3k7y_A405 Aspartate aminotransferase; aminotrans pyridoxal p 6e-23
3k7y_A405 Aspartate aminotransferase; aminotrans pyridoxal p 7e-23
4f4e_A420 Aromatic-amino-acid aminotransferase; ssgcid, stru 1e-179
4f4e_A420 Aromatic-amino-acid aminotransferase; ssgcid, stru 2e-23
4f4e_A420 Aromatic-amino-acid aminotransferase; ssgcid, stru 2e-23
3fsl_A397 Aromatic-amino-acid aminotransferase; tyrosine ami 1e-177
3fsl_A397 Aromatic-amino-acid aminotransferase; tyrosine ami 9e-24
3fsl_A397 Aromatic-amino-acid aminotransferase; tyrosine ami 1e-23
1yaa_A412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 1e-177
1yaa_A412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 6e-23
1yaa_A412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 7e-23
2ay1_A394 Aroat, aromatic amino acid aminotransferase; HET: 1e-176
2ay1_A394 Aroat, aromatic amino acid aminotransferase; HET: 1e-23
2ay1_A394 Aroat, aromatic amino acid aminotransferase; HET: 2e-23
1ajs_A412 Aspartate aminotransferase; PIG, in the presence o 1e-176
1ajs_A412 Aspartate aminotransferase; PIG, in the presence o 2e-20
1ajs_A412 Aspartate aminotransferase; PIG, in the presence o 2e-20
2q7w_A396 Aspartate aminotransferase; mechanism-based inhibi 1e-176
2q7w_A396 Aspartate aminotransferase; mechanism-based inhibi 1e-23
2q7w_A396 Aspartate aminotransferase; mechanism-based inhibi 1e-23
3meb_A448 Aspartate aminotransferase; pyridoxal PHOS transfe 1e-172
3meb_A448 Aspartate aminotransferase; pyridoxal PHOS transfe 2e-19
3meb_A448 Aspartate aminotransferase; pyridoxal PHOS transfe 2e-19
3rq1_A418 Aminotransferase class I and II; structural genomi 1e-153
3rq1_A418 Aminotransferase class I and II; structural genomi 3e-18
3rq1_A418 Aminotransferase class I and II; structural genomi 4e-18
3t18_A413 Aminotransferase class I and II; PSI-biology, MCSG 1e-147
3t18_A413 Aminotransferase class I and II; PSI-biology, MCSG 1e-16
3t18_A413 Aminotransferase class I and II; PSI-biology, MCSG 4e-16
2x5f_A430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 1e-108
2x5f_A430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 3e-11
2x5f_A430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 2e-10
3ftb_A361 Histidinol-phosphate aminotransferase; structural 1e-06
1fg7_A356 Histidinol phosphate aminotransferase; HISC, histi 7e-06
3ei9_A432 LL-diaminopimelate aminotransferase; lysine biosyn 1e-05
3cq5_A369 Histidinol-phosphate aminotransferase; PLP, PMP, a 1e-05
1lc5_A364 COBD, L-threonine-O-3-phosphate decarboxylase; PLP 2e-05
3if2_A444 Aminotransferase; YP_265399.1, structura genomics, 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-05
3hdo_A360 Histidinol-phosphate aminotransferase; PSI-II, his 3e-04
3b40_A417 PVDM, probable dipeptidase; structural genomics, h 6e-04
2dou_A376 Probable N-succinyldiaminopimelate aminotransfera; 7e-04
3qgu_A449 LL-diaminopimelate aminotransferase; L-lysine, pyr 7e-04
3fkd_A350 L-threonine-O-3-phosphate decarboxylase; structura 8e-04
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Length = 401 Back     alignment and structure
 Score =  523 bits (1350), Expect = 0.0
 Identities = 179/382 (46%), Positives = 241/382 (63%), Gaps = 42/382 (10%)

Query: 157 FNKDPHPKKMNLGVGAYRGEDGKPYVLPSVKEAERRIYEKNLDHEYANIGGDAKFCKLAA 216
           F +D + KKMNLGVGAYR ++GKPYVL  V++AE  I  K +D EY  I G A F + +A
Sbjct: 22  FKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIAAKKMDKEYLPIAGLADFTRASA 81

Query: 217 QLAYGEDFPAFKDNRLAIVQGISGSGSLRVGTAFLERFYPGVKTVYFPTPTWNGHVRFCT 276
           +LA GE+  AFK  R   VQGISG+GSLRVG  FL+RF+   + VY P P+W  H     
Sbjct: 82  ELALGENSEAFKSGRYVTVQGISGTGSLRVGANFLQRFFKFSRDVYLPKPSWGNHTPIFR 141

Query: 277 DSRLNVGAYRYFDNKTNGLDFAGMMEDIKAMPERSILFLQTSSHNPTGVDLSEDQWRQLA 336
           D+ L + AYRY+D KT  LDF G MEDI  +PE+SI+ L   +HNPTGVD  ++QW++LA
Sbjct: 142 DAGLQLQAYRYYDPKTCSLDFTGAMEDISKIPEKSIILLHACAHNPTGVDPRQEQWKELA 201

Query: 337 VVVKQRHLYPFFDMAYLGLTSGDFDKDAFSLRYFAKEVGQLCLAQSFSKNMGLYGERVGT 396
            VVK+R+L  +FDMAY G  SGD ++DA++LR+F ++   + L+QS++KNMGLYGER G 
Sbjct: 202 SVVKKRNLLAYFDMAYQGFASGDINRDAWALRHFIEQGIDVVLSQSYAKNMGLYGERAGA 261

Query: 397 FSVLTPTSDETERIMSQLKILIRGFYSNPPIHGARIVTEILSDPKLKAQCDETERIMSQL 456
           F+V+   +                                          +E +R+ SQL
Sbjct: 262 FTVICRDA------------------------------------------EEAKRVESQL 279

Query: 457 KILIRGFYSNPPIHGARIVTEILSDPKLKAQWFEECKGMSNRISSIREELKSKILDKGSK 516
           KILIR  YSNPP++GARI + IL+ P+L+ +W  E KGM++RI S+R +L S +  +GS 
Sbjct: 280 KILIRPMYSNPPMNGARIASLILNTPELRKEWLVEVKGMADRIISMRTQLVSNLKKEGSS 339

Query: 517 KNWDHITNQKGMFCYTGLSASQ 538
            NW HIT+Q GMFC+TGL   Q
Sbjct: 340 HNWQHITDQIGMFCFTGLKPEQ 361


>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Length = 401 Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Length = 401 Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Length = 409 Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Length = 409 Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Length = 409 Back     alignment and structure
>3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} Length = 405 Back     alignment and structure
>3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} Length = 405 Back     alignment and structure
>3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} Length = 405 Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Length = 420 Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Length = 420 Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Length = 420 Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} PDB: 3tat_A* Length = 397 Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} PDB: 3tat_A* Length = 397 Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} PDB: 3tat_A* Length = 397 Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Length = 412 Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Length = 412 Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Length = 412 Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Length = 394 Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Length = 394 Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Length = 394 Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Length = 412 Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Length = 412 Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Length = 412 Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Length = 396 Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Length = 396 Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Length = 396 Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Length = 448 Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Length = 448 Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Length = 448 Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Length = 418 Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Length = 418 Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Length = 418 Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Length = 430 Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Length = 430 Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Length = 430 Back     alignment and structure
>3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} Length = 361 Back     alignment and structure
>1fg7_A Histidinol phosphate aminotransferase; HISC, histidine biosynthesis, pyridoxal PH montreal-kingston bacterial structural genomics initiative; HET: PMP; 1.50A {Escherichia coli} SCOP: c.67.1.1 PDB: 1fg3_A* 1gew_A* 1gex_A* 1gey_A* 1iji_A* Length = 356 Back     alignment and structure
>3ei9_A LL-diaminopimelate aminotransferase; lysine biosynthesis, pyridoxal 5' phosphat external aldimine, chloroplast, pyridox phosphate; HET: PL6; 1.55A {Arabidopsis thaliana} PDB: 3ei8_A* 3eib_A* 3ei6_A* 2z1z_A* 3ei5_A* 2z20_A* 3ei7_A 3eia_A* Length = 432 Back     alignment and structure
>3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A Length = 369 Back     alignment and structure
>1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase cobalamin, lyase; 1.46A {Salmonella enterica} SCOP: c.67.1.1 PDB: 1lc7_A* 1lc8_A* 1lkc_A* Length = 364 Back     alignment and structure
>3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} Length = 444 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3hdo_A Histidinol-phosphate aminotransferase; PSI-II, histidinol-phosphate aminotrans structural genomics, protein structure initiative; 1.61A {Geobacter metallireducens gs-15} Length = 360 Back     alignment and structure
>3b40_A PVDM, probable dipeptidase; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.00A {Pseudomonas aeruginosa} Length = 417 Back     alignment and structure
>2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} Length = 376 Back     alignment and structure
>3qgu_A LL-diaminopimelate aminotransferase; L-lysine, pyridoxal-5' phosphate, chamydomonas reinhardtii; HET: GOL; 1.55A {Chlamydomonas reinhardtii} Length = 449 Back     alignment and structure
>3fkd_A L-threonine-O-3-phosphate decarboxylase; structural genomic, , structural genomics, PSI-2, protein structure initiative; 2.50A {Porphyromonas gingivalis} Length = 350 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query583
3k7y_A405 Aspartate aminotransferase; aminotrans pyridoxal p 100.0
4h51_A420 Aspartate aminotransferase; ssgcid, structural gen 100.0
7aat_A401 Aspartate aminotransferase; transferase(aminotrans 100.0
4f4e_A420 Aromatic-amino-acid aminotransferase; ssgcid, stru 100.0
3meb_A448 Aspartate aminotransferase; pyridoxal PHOS transfe 100.0
4eu1_A409 Mitochondrial aspartate aminotransferase; ssgcid, 100.0
3fsl_A397 Aromatic-amino-acid aminotransferase; tyrosine ami 100.0
1yaa_A412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 100.0
2q7w_A396 Aspartate aminotransferase; mechanism-based inhibi 100.0
1ajs_A412 Aspartate aminotransferase; PIG, in the presence o 100.0
2ay1_A394 Aroat, aromatic amino acid aminotransferase; HET: 100.0
1b5p_A385 Protein (aspartate aminotransferase); pyridoxal en 100.0
3aow_A448 Putative uncharacterized protein PH0207; protein-P 100.0
3b46_A447 Aminotransferase BNA3; kynurenine aminotransferase 100.0
3dyd_A427 Tyrosine aminotransferase; PLP, SGC, structural ge 100.0
3tcm_A500 Alanine aminotransferase 2; pyridoxal phosphate (P 100.0
3t18_A413 Aminotransferase class I and II; PSI-biology, MCSG 100.0
2r2n_A425 Kynurenine/alpha-aminoadipate aminotransferase mit 100.0
3rq1_A418 Aminotransferase class I and II; structural genomi 100.0
3ihj_A498 Alanine aminotransferase 2; helix, structural geno 100.0
1gd9_A389 Aspartate aminotransferase; pyridoxal enzyme, temp 100.0
3jtx_A396 Aminotransferase; NP_283882.1, structural genomics 100.0
3e2y_A410 Kynurenine-oxoglutarate transaminase 3; alpha beta 100.0
2x5f_A430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 100.0
2o1b_A404 Aminotransferase, class I; aminotrasferase; HET: P 100.0
3ezs_A376 Aminotransferase ASPB; NP_207418.1, structural gen 100.0
3fvs_A422 Kynurenine--oxoglutarate transaminase 1; alpha bet 100.0
1vp4_A425 Aminotransferase, putative; structural genomics, j 100.0
1u08_A386 Hypothetical aminotransferase YBDL; alpha beta pro 100.0
2dou_A376 Probable N-succinyldiaminopimelate aminotransfera; 100.0
3h14_A391 Aminotransferase, classes I and II; YP_167802.1, S 100.0
3ele_A398 Amino transferase; RER070207001803, structural gen 100.0
3ppl_A427 Aspartate aminotransferase; dimer, PLP-dependent t 100.0
3g0t_A437 Putative aminotransferase; NP_905498.1, putative a 100.0
2x5d_A412 Probable aminotransferase; HET: LLP PLP; 2.25A {Ps 100.0
3d6k_A422 Putative aminotransferase; APC82464, corynebacteri 100.0
3nra_A407 Aspartate aminotransferase; structural genomics, j 100.0
1j32_A388 Aspartate aminotransferase; HET: PLP; 2.10A {Phorm 100.0
1iay_A428 ACC synthase 2, 1-aminocyclopropane-1-carboxylate 100.0
1o4s_A389 Aspartate aminotransferase; TM1255, structural gen 100.0
3qgu_A449 LL-diaminopimelate aminotransferase; L-lysine, pyr 100.0
1yiz_A429 Kynurenine aminotransferase; glutamine transaminas 100.0
2zc0_A407 Alanine glyoxylate transaminase; alanine:glyoxylat 100.0
1xi9_A406 Putative transaminase; alanine aminotransferase, s 100.0
3piu_A435 1-aminocyclopropane-1-carboxylate synthase; fruit 100.0
2o0r_A411 RV0858C (N-succinyldiaminopimelate aminotransfera; 100.0
2z61_A370 Probable aspartate aminotransferase 2; amino acid 100.0
3fdb_A377 Beta C-S lyase, putative PLP-dependent beta-cystat 100.0
1bw0_A416 TAT, protein (tyrosine aminotransferase); tyrosine 100.0
3g7q_A417 Valine-pyruvate aminotransferase; NP_462565.1, str 100.0
2zyj_A397 Alpha-aminodipate aminotransferase; alpha-aminoadi 100.0
3ez1_A423 Aminotransferase MOCR family; YP_604413.1, struct 100.0
3kax_A383 Aminotransferase, classes I and II; PLP, C-S lyase 100.0
1c7n_A399 Cystalysin; transferase, aminotransferase, pyridox 100.0
4dq6_A391 Putative pyridoxal phosphate-dependent transferas; 100.0
3ei9_A432 LL-diaminopimelate aminotransferase; lysine biosyn 100.0
3dzz_A391 Putative pyridoxal 5'-phosphate-dependent C-S LYA; 100.0
3ly1_A354 Putative histidinol-phosphate aminotransferase; st 100.0
1v2d_A381 Glutamine aminotransferase; PLP, riken structural 100.0
3if2_A444 Aminotransferase; YP_265399.1, structura genomics, 100.0
1d2f_A390 MALY protein; aminotransferase fold, large PLP-bin 100.0
3f6t_A533 Aspartate aminotransferase; YP_194538.1, STRU geno 100.0
3get_A365 Histidinol-phosphate aminotransferase; NP_281508.1 100.0
2gb3_A409 Aspartate aminotransferase; TM1698, structural gen 100.0
1fg7_A356 Histidinol phosphate aminotransferase; HISC, histi 100.0
3asa_A400 LL-diaminopimelate aminotransferase; PLP dependent 100.0
3l8a_A421 METC, putative aminotransferase, probable beta-cys 100.0
3euc_A367 Histidinol-phosphate aminotransferase 2; YP_297314 100.0
3ffh_A363 Histidinol-phosphate aminotransferase; APC88260, l 100.0
2zy4_A546 L-aspartate beta-decarboxylase; pyridoxal 5'-phosp 100.0
3bwn_A391 AT1G70560, L-tryptophan aminotransferase; auxin sy 100.0
3op7_A375 Aminotransferase class I and II; PLP-dependent tra 100.0
3b1d_A392 Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococ 100.0
3fkd_A350 L-threonine-O-3-phosphate decarboxylase; structura 99.97
3ftb_A361 Histidinol-phosphate aminotransferase; structural 99.97
1lc5_A364 COBD, L-threonine-O-3-phosphate decarboxylase; PLP 99.97
3cq5_A369 Histidinol-phosphate aminotransferase; PLP, PMP, a 99.97
1uu1_A335 Histidinol-phosphate aminotransferase; histidine b 99.97
3p1t_A337 Putative histidinol-phosphate aminotransferase; PL 99.97
3hdo_A360 Histidinol-phosphate aminotransferase; PSI-II, his 99.97
2hox_A427 ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINA 99.97
3a2b_A398 Serine palmitoyltransferase; vitamin B6-dependent 99.95
1e5e_A404 MGL, methionine gamma-lyase; methionine biosynthes 99.94
3tqx_A399 2-amino-3-ketobutyrate coenzyme A ligase; energy m 99.93
1bs0_A384 Protein (8-amino-7-oxonanoate synthase); PLP-depen 99.92
1sff_A426 4-aminobutyrate aminotransferase; enzyme complexes 99.92
1t3i_A420 Probable cysteine desulfurase; PLP-binding enzyme, 99.92
2dr1_A386 PH1308 protein, 386AA long hypothetical serine ami 99.91
2eh6_A375 Acoat, acetylornithine aminotransferase; ARGD, str 99.91
1vjo_A393 Alanine--glyoxylate aminotransferase; 17130350, AL 99.91
2ord_A397 Acoat, acetylornithine aminotransferase; TM1785, a 99.91
1kmj_A406 Selenocysteine lyase; persulfide perselenide NIFS 99.91
2e7j_A371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 99.91
1fc4_A401 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino 99.91
1jg8_A347 L-ALLO-threonine aldolase; glycine biosynthesis, p 99.91
4adb_A406 Succinylornithine transaminase; transferase, PLP e 99.9
2rfv_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate, PL 99.9
1eg5_A384 Aminotransferase; PLP-dependent enzymes, iron-sulf 99.9
1elu_A390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 99.89
1svv_A359 Threonine aldolase; structural genomics, structura 99.89
3ruy_A392 Ornithine aminotransferase; structural genomics, c 99.89
2ez2_A456 Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend 99.89
2bwn_A401 5-aminolevulinate synthase; tetrapyrrole biosynthe 99.89
3i4j_A430 Aminotransferase, class III; structural GENOMICS,N 99.89
2w8t_A427 SPT, serine palmitoyltransferase; HET: LLP; 1.25A 99.88
1b9h_A388 AHBA synthase, protein (3-amino-5-hydroxybenzoic a 99.88
2aeu_A374 Hypothetical protein MJ0158; selenocysteine syntha 99.88
2eo5_A419 419AA long hypothetical aminotransferase; PLP enzy 99.88
2z9v_A392 Aspartate aminotransferase; pyridoxamine, pyruvate 99.88
3dxv_A439 Alpha-amino-epsilon-caprolactam racemase; fold-TYP 99.88
3f9t_A397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 99.88
1iug_A352 Putative aspartate aminotransferase; wild type, py 99.88
1vef_A395 Acetylornithine/acetyl-lysine aminotransferase; PL 99.88
3kki_A409 CAI-1 autoinducer synthase; quorum sensing, CQSA, 99.87
2pb2_A420 Acetylornithine/succinyldiaminopimelate aminotran; 99.87
3lvm_A423 Cysteine desulfurase; structural genomics, montrea 99.87
2ch1_A396 3-hydroxykynurenine transaminase; PLP-enzyme, kynu 99.87
1ibj_A464 CBL, cystathionine beta-lyase; PLP-dependent enzym 99.87
2huf_A393 Alanine glyoxylate aminotransferase; alpha and bet 99.87
3zrp_A384 Serine-pyruvate aminotransferase (AGXT); HET: PLP; 99.87
1m32_A366 2-aminoethylphosphonate-pyruvate aminotransferase; 99.87
3cai_A406 Possible aminotransferase; RV3778C; 1.80A {Mycobac 99.87
1s0a_A429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 99.87
3nx3_A395 Acoat, acetylornithine aminotransferase; csgid, st 99.87
4ffc_A453 4-aminobutyrate aminotransferase (GABT); structura 99.86
2yrr_A353 Aminotransferase, class V; structural genomics, NP 99.86
4eb5_A382 Probable cysteine desulfurase 2; scaffold, transfe 99.86
2oga_A399 Transaminase; PLP-dependent enzyme, desosamine, de 99.86
4a6r_A459 Omega transaminase; transferase, PLP-binding enzym 99.86
1zod_A433 DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, 99.86
2cy8_A453 D-phgat, D-phenylglycine aminotransferase; structu 99.85
3a9z_A432 Selenocysteine lyase; PLP, cytoplasm, pyridoxal ph 99.85
3gju_A460 Putative aminotransferase; pyridoxal phosphate, PL 99.85
2bkw_A385 Alanine-glyoxylate aminotransferase 1; analine-gly 99.85
2po3_A424 4-dehydrase; external aldimine, PLP, aminotransfer 99.85
1v72_A356 Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2 99.85
3cog_A403 Cystathionine gamma-lyase; CTH, PLP, propargylglyc 99.85
3isl_A416 Purine catabolism protein PUCG; pyridoxalphosphate 99.85
3l44_A434 Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha 99.85
1ax4_A467 Tryptophanase; tryptophan biosynthesis, tryptophan 99.84
1cs1_A386 CGS, protein (cystathionine gamma-synthase); lyase 99.84
3acz_A389 Methionine gamma-lyase; L-methionine; HET: LLP; 1. 99.84
3nnk_A411 Ureidoglycine-glyoxylate aminotransferase; PLP-dep 99.84
3lws_A357 Aromatic amino acid beta-eliminating lyase/threoni 99.84
1mdo_A393 ARNB aminotransferase; type 1 aminotransferase fol 99.84
2dkj_A407 Serine hydroxymethyltransferase; PLP dependent enz 99.84
3fq8_A427 Glutamate-1-semialdehyde 2,1-aminomutase; drug res 99.84
3qhx_A392 Cystathionine gamma-synthase METB (CGS); structura 99.84
3kgw_A393 Alanine-glyoxylate aminotransferase; AAH25799.1, p 99.84
3ndn_A414 O-succinylhomoserine sulfhydrylase; seattle struct 99.84
3f0h_A376 Aminotransferase; RER070207000802, structural geno 99.84
3a8u_X449 Omega-amino acid--pyruvate aminotransferase; large 99.83
3oks_A451 4-aminobutyrate transaminase; ssgcid, transferase, 99.83
1gc0_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate; HE 99.83
4hvk_A382 Probable cysteine desulfurase 2; transferase and I 99.83
3mad_A514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.83
3n5m_A452 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.83
1pff_A331 Methionine gamma-lyase; homocysteine; 2.50A {Trich 99.83
1n8p_A393 Cystathionine gamma-lyase; three open alpha/beta s 99.83
3k28_A429 Glutamate-1-semialdehyde 2,1-aminomutase 2; biosyn 99.83
3dod_A448 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.83
3mc6_A497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.83
3i5t_A476 Aminotransferase; pyridoxal 5'-phosphate, PSI-2, N 99.83
3dr4_A391 Putative perosamine synthetase; deoxysugar, pyrido 99.82
3tfu_A457 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.82
1o69_A394 Aminotransferase; structural genomics, unknown fun 99.82
2c81_A418 Glutamine-2-deoxy-scyllo-inosose aminotransferase; 99.82
2epj_A434 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 99.82
2e7u_A424 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 99.82
3vax_A400 Putative uncharacterized protein DNDA; desulfurase 99.82
1z7d_A433 Ornithine aminotransferase; structural genomics co 99.82
2oat_A439 Ornithine aminotransferase; 5-fluoromethylornithin 99.81
3uwc_A374 Nucleotide-sugar aminotransferase; lipopolysacchar 99.81
3pj0_A359 LMO0305 protein; structural genomics, joint center 99.81
4e77_A429 Glutamate-1-semialdehyde 2,1-aminomutase; structur 99.81
3ffr_A362 Phosphoserine aminotransferase SERC; structural ge 99.8
3hmu_A472 Aminotransferase, class III; structural genomics, 99.8
3nyt_A367 Aminotransferase WBPE; PLP binding, nucleotide-sug 99.8
3ht4_A431 Aluminum resistance protein; lyase, putative cysta 99.79
2cb1_A412 O-acetyl homoserine sulfhydrylase; PLP enzyme, lya 99.79
1w23_A360 Phosphoserine aminotransferase; pyridoxal-5'-phosp 99.79
2fnu_A375 Aminotransferase; protein-product complex, structu 99.79
1qgn_A445 Protein (cystathionine gamma-synthase); methionine 99.79
3n0l_A417 Serine hydroxymethyltransferase; alpha beta class, 99.79
3jzl_A409 Putative cystathionine beta-lyase involved in ALU 99.79
2cjg_A449 L-lysine-epsilon aminotransferase; internal aldimi 99.79
1qz9_A416 Kynureninase; kynurenine, tryptophan, PLP, vitamin 99.78
2fq6_A415 Cystathionine beta-lyase; protein-inhibitor comple 99.77
1wyu_B474 Glycine dehydrogenase subunit 2 (P-protein); alpha 99.77
3frk_A373 QDTB; aminotransferase, sugar-modification, natura 99.77
3i16_A427 Aluminum resistance protein; YP_878183.1, carbon-s 99.77
3hvy_A427 Cystathionine beta-lyase family protein, YNBB B.S 99.77
3ri6_A430 O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate 99.76
3ecd_A425 Serine hydroxymethyltransferase 2; ssgcid, decode, 99.75
2c0r_A362 PSAT, phosphoserine aminotransferase; pyridoxal-5' 99.75
3nmy_A400 Xometc, cystathionine gamma-lyase-like protein; Cy 99.75
2oqx_A467 Tryptophanase; lyase, pyridoxal phosphate, tryptop 99.74
3h7f_A447 Serine hydroxymethyltransferase 1; cytoplasm, one- 99.73
1rv3_A483 Serine hydroxymethyltransferase, cytosolic; one-ca 99.73
3bb8_A437 CDP-4-keto-6-deoxy-D-glucose-3-dehydrase; aspartat 99.73
3e9k_A465 Kynureninase; kynurenine-L-hydrolase, kynurenine h 99.72
3gbx_A420 Serine hydroxymethyltransferase; structural genomi 99.72
2vi8_A405 Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, 99.71
3ju7_A377 Putative PLP-dependent aminotransferase; NP_978343 99.71
2dgk_A452 GAD-beta, GADB, glutamate decarboxylase beta; gadb 99.71
3b8x_A390 WBDK, pyridoxamine 5-phosphate-dependent dehydrase 99.69
2fyf_A398 PSAT, phosphoserine aminotransferase; PLP-dependen 99.69
2ctz_A421 O-acetyl-L-homoserine sulfhydrylase; crystal, O-ac 99.68
2z67_A456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 99.66
1js3_A486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 99.65
3vp6_A511 Glutamate decarboxylase 1; catalytic loop SWAP, ly 99.64
2yky_A465 Beta-transaminase; transferase; HET: PLP SFE; 1.69 99.43
2x3l_A446 ORN/Lys/Arg decarboxylase family protein; lyase; H 99.61
3hbx_A502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 99.61
2okj_A504 Glutamate decarboxylase 1; PLP-dependent decarboxy 99.6
2qma_A497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 99.6
4h51_A420 Aspartate aminotransferase; ssgcid, structural gen 99.59
3ke3_A379 Putative serine-pyruvate aminotransferase; structu 99.55
2jis_A515 Cysteine sulfinic acid decarboxylase; pyridoxal ph 99.54
2vyc_A 755 Biodegradative arginine decarboxylase; pyridoxal p 99.52
2a7v_A490 Serine hydroxymethyltransferase; structural genomi 99.52
1wyu_A438 Glycine dehydrogenase (decarboxylating) subunit 1; 99.5
1ohv_A472 4-aminobutyrate aminotransferase; PLP-dependent en 99.48
1c4k_A 730 Protein (ornithine decarboxylase); lyase; HET: PLP 99.47
4e1o_A481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 99.46
3k40_A475 Aromatic-L-amino-acid decarboxylase; PLP dependent 99.41
3n75_A 715 LDC, lysine decarboxylase, inducible; pyridoxal-5' 99.37
4ao9_A454 Beta-phenylalanine aminotransferase; HET: PLP; 1.5 98.94
3hl2_A501 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 98.87
3bc8_A450 O-phosphoseryl-tRNA(SEC) selenium transferase; dis 98.67
4a0g_A831 Adenosylmethionine-8-amino-7-oxononanoate aminotra 98.32
3e77_A377 Phosphoserine aminotransferase; SERC, PLP, structu 98.3
4atq_A456 4-aminobutyrate transaminase; transferase; HET: PL 98.29
3m5u_A361 Phosphoserine aminotransferase; alpha-beta half sa 98.25
3qm2_A386 Phosphoserine aminotransferase; structural genomic 98.2
4e3q_A473 Pyruvate transaminase; aminotransferase, transfera 98.19
3meb_A448 Aspartate aminotransferase; pyridoxal PHOS transfe 97.94
3k7y_A405 Aspartate aminotransferase; aminotrans pyridoxal p 97.67
3ou5_A490 Serine hydroxymethyltransferase, mitochondrial; st 97.58
7aat_A401 Aspartate aminotransferase; transferase(aminotrans 96.8
4f4e_A420 Aromatic-amino-acid aminotransferase; ssgcid, stru 96.56
4eu1_A409 Mitochondrial aspartate aminotransferase; ssgcid, 96.43
3dyd_A427 Tyrosine aminotransferase; PLP, SGC, structural ge 96.35
1yaa_A412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 95.47
3tcm_A500 Alanine aminotransferase 2; pyridoxal phosphate (P 93.91
2ay1_A394 Aroat, aromatic amino acid aminotransferase; HET: 93.42
3rq1_A418 Aminotransferase class I and II; structural genomi 93.05
3fsl_A397 Aromatic-amino-acid aminotransferase; tyrosine ami 92.9
1ajs_A412 Aspartate aminotransferase; PIG, in the presence o 92.09
2q7w_A396 Aspartate aminotransferase; mechanism-based inhibi 92.09
3t18_A413 Aminotransferase class I and II; PSI-biology, MCSG 91.01
3nra_A407 Aspartate aminotransferase; structural genomics, j 85.13
3gh5_A525 HEX1, beta-hexosaminidase; beta-N-acetylhexosamini 80.9
2x5f_A430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 80.87
1jak_A512 Beta-N-acetylhexosaminidase; glycoside hydrolase, 80.39
>3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} SCOP: c.67.1.0 Back     alignment and structure
Probab=100.00  E-value=1.3e-51  Score=437.64  Aligned_cols=370  Identities=25%  Similarity=0.488  Sum_probs=292.7

Q ss_pred             cchhhHhhccccccCCCCCccccCCccccCCCCCCCCChHHHHHHHHHh-ccCCCCCCCCCCCCHHHHHHHHHHHhCCCC
Q psy14428        146 DIKPLKQQLKGFNKDPHPKKMNLGVGAYRGEDGKPYVLPSVKEAERRIY-EKNLDHEYANIGGDAKFCKLAAQLAYGEDF  224 (583)
Q Consensus       146 ~~~~i~~l~~~~~~~~~~~~i~l~~g~~~~~~~~p~~~~~v~~a~~~~~-~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g  224 (583)
                      ++++++.+...+++...+++|||++|.+.++.+.+++++.++++.. +. .....++|++..|.++||++|++|+.+.++
T Consensus        12 ~~~~i~~~~~~~~~~~~~~~I~l~~G~~~d~~~~~~~~~~v~~a~~-~~~~~~~~~~Y~~~~G~~~lr~aia~~~~~~~~   90 (405)
T 3k7y_A           12 EVDNILKTAREFKEDTCEEKINLSIGVCCNDDGDLHIFDSVLNADK-LVTENYKEKPYLLGNGTEDFSTLTQNLIFGNNS   90 (405)
T ss_dssp             CCCHHHHHHHHHTTSSCSSCEECSCSSCBCTTSSBCCCHHHHHHHH-HHHHHCCCCCCCTTSSCHHHHHHHHHHHHCSSC
T ss_pred             CCChHHHHHHHHhcCCCcCcEEeeeeeeECCCCCCcccHHHHHHHH-HhcCCCCCCCCCCCCCcHHHHHHHHHHHcCCCC
Confidence            4667888887777667789999999997555566667899999987 54 334467899999999999999999988887


Q ss_pred             CCCCCCCe--EEEecCCchhHHHHHHHHHHHhCCCCCEEEEcCCCChhhHHHHhhcCCeEEEEecccCCCCCCChhhHHH
Q psy14428        225 PAFKDNRL--AIVQGISGSGSLRVGTAFLERFYPGVKTVYFPTPTWNGHVRFCTDSRLNVGAYRYFDNKTNGLDFAGMME  302 (583)
Q Consensus       225 ~~~~~~~I--~i~~t~G~~~al~l~~~~l~~~~~~gd~Vlv~~P~y~~~~~~~~~~G~~~~~v~~~d~~~~g~d~~~l~~  302 (583)
                      ..+++++|  ++  |+|+++|+.++..++..+. | |+|++++|+|+.|..+++.+|++++.+|+.+++++++|++.+++
T Consensus        91 ~~~~~~~i~i~~--t~G~~~al~~~~~~l~~~~-~-d~Vlv~~P~y~~~~~~~~~~g~~~~~v~~~~~~~~~~d~~~l~~  166 (405)
T 3k7y_A           91 KYIEDKKICTIQ--CIGGTGAIFVLLEFLKMLN-V-ETLYVTNPPYINHVNMIESRGFNLKYINFFDYNLIDINYDLFLN  166 (405)
T ss_dssp             TTTTTTCEEEEE--EEHHHHHHHHHHHHHHTTT-C-CEEEEESSCCHHHHHHHHTTTCEEEEECCEETTTTEECHHHHHH
T ss_pred             ccccccceEEEE--cCchHHHHHHHHHHHHhcC-C-CEEEEeCCCCHhHHHHHHHcCCeEEEEeccccccCCcCHHHHHH
Confidence            77888865  66  9999999999754443322 6 99999999999999999999999999998555568999999999


Q ss_pred             HHHcCCCCcEEEEe-CCCCCCCCCCCCHHHHHHHHHHHHhcCeEEEEeccCCCCCCCCCCCchHHHHHHHHhcCcEEEEe
Q psy14428        303 DIKAMPERSILFLQ-TSSHNPTGVDLSEDQWRQLAVVVKQRHLYPFFDMAYLGLTSGDFDKDAFSLRYFAKEVGQLCLAQ  381 (583)
Q Consensus       303 ~l~~~~~~~~~i~i-~~p~NPTG~~~s~~~~~~l~~~a~~~~i~iI~De~Y~~l~~~~~~~~~~~~~~~~~~~~~vi~i~  381 (583)
                      ++.+. ++++++++ ++||||||.+++.+++++|+++|++++++||+||+|.+|.+++...+..++..+.+..+++|+++
T Consensus       167 ~l~~~-~~~~~i~l~~~~~NPTG~~~s~~~~~~l~~~~~~~~~~vi~De~Y~~l~~~~~~~~~~~~~~~~~~~~~~i~~~  245 (405)
T 3k7y_A          167 DLRNI-PNGSSVILQISCYNPCSVNIEEKYFDEIIEIVLHKKHVIIFDIAYQGFGHTNLEEDVLLIRKFEEKNIAFSVCQ  245 (405)
T ss_dssp             HHHHS-CSSCEEEECCSSCTTTCCCCCHHHHHHHHHHHHHHCCEEEEEESCTTTSSSSTTGGGHHHHHHHTTTCCEEEEE
T ss_pred             HHHhC-CCCeEEEEeCCCCCCCCCCCCHHHHHHHHHHHHHCCeEEEEecCcccccCCCcccchHHHHHHHhcCCcEEEEe
Confidence            98653 33445555 55699999999999999999999999999999999999998742223445666655568999999


Q ss_pred             cCcccccccCccceEEEEEcCCchhHHHHHHHHHHHHhccccCCChHHHHHHHHHhCChhhhhhhhhHHHHHHHHHHHHh
Q psy14428        382 SFSKNMGLYGERVGTFSVLTPTSDETERIMSQLKILIRGFYSNPPIHGARIVTEILSDPKLKAQCDETERIMSQLKILIR  461 (583)
Q Consensus       382 S~SK~~~l~GlRiG~lv~~~p~~~~~~~li~~l~~~~~~~~~~~s~~~q~~~~~~l~~~~~~~~~~~~~~~~~~l~~~~r  461 (583)
                      ||||+|+|||||+||+++..++++..+.+.+.+.+..+..+++++.++|.+++.+++++                     
T Consensus       246 S~SK~~~l~GlRiG~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~q~~~~~~l~~~---------------------  304 (405)
T 3k7y_A          246 SFSKNMSLYGERAGALHIVCKNQEEKKIVFNNLCFIVRKFYSSPVIHTNRILCQLLNNQ---------------------  304 (405)
T ss_dssp             ECTTTSCCTTTTEEEEEEECSSHHHHHHHHHHHHHHHHTTTSSCCHHHHHHHHHHHHCH---------------------
T ss_pred             eCCccCCCccccceEEEEEeCCHHHHHHHHHHHHHHHhcccCCCcHHHHHHHHHHhCCH---------------------
Confidence            99999999999999998644553222234445555566677788888888888887663                     


Q ss_pred             hccCCCccchhhHHHHhcCChhHHHHHHHHHHHHHHHHHHHHHHHHHHHH----hcCCCCCcccccccccceeecCCChh
Q psy14428        462 GFYSNPPIHGARIVTEILSDPKLKAQWFEECKGMSNRISSIREELKSKIL----DKGSKKNWDHITNQKGMFCYTGLSAS  537 (583)
Q Consensus       462 ~~~~~~p~~g~~i~~~~l~~~~~~~~~~~~l~~~~~~~~~~r~~l~~~L~----~~~~pg~~~~~~~~~g~f~~~~l~~~  537 (583)
                                           .+.+.|.+++++++++|.++|+.+.+.|+    +++.|+.|.+..+++|||+|.+++.+
T Consensus       305 ---------------------~l~~~~~~~l~~~~~~~~~~R~~l~~~L~~~~~~~g~~~~~~~~~p~gg~f~~~~l~~~  363 (405)
T 3k7y_A          305 ---------------------NLKLNWIKELSQLSQRITNNRILFFNKLETYQKKYNLNYDWNVYKKQRGLFSFVPLLAK  363 (405)
T ss_dssp             ---------------------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHGGGGTCCCCGGGGSSCCSSEEECGGGGG
T ss_pred             ---------------------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhcCCCCCCccccCCceEEEecCCCHH
Confidence                                 23457888999999999999999999999    88878889999999999999988765


Q ss_pred             hhhhhhhhhhHHHHHHHHhhcCCCccccccccCCcceeecCCCCC
Q psy14428        538 QGMSNRISSIREELKSKILDKGSKKNWDHITNQKGMFCYTGLSAS  582 (583)
Q Consensus       538 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  582 (583)
                      ..++     + ++.++.+.             +.|+|||++++++
T Consensus       364 ~~~~-----L-~~~gV~v~-------------p~~Ris~a~~~~~  389 (405)
T 3k7y_A          364 IAEH-----L-KTHHIYII-------------NNGRINVSGITKN  389 (405)
T ss_dssp             GTTT-----T-TTTTEECC-------------TTSEEEGGGCCTT
T ss_pred             HHHH-----H-HHCCEeec-------------CCCeEEEeccCHH
Confidence            4433     2 22222221             2368999998876



>4h51_A Aspartate aminotransferase; ssgcid, structural genomics, seattle struc genomics center for infectious disease, aspartate aminotran transferase; HET: LLP; 1.85A {Leishmania major} Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} SCOP: c.67.1.1 PDB: 3tat_A* Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Back     alignment and structure
>1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A* Back     alignment and structure
>3aow_A Putative uncharacterized protein PH0207; protein-PLP-AKG triple complex, schiff-base linkage, kynuren aminotransferase; HET: PLP AKG; 1.56A {Pyrococcus horikoshii} PDB: 3aov_A* 3ath_A* 3av7_A* 1x0m_A 1wst_A* Back     alignment and structure
>3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* Back     alignment and structure
>3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} Back     alignment and structure
>2r2n_A Kynurenine/alpha-aminoadipate aminotransferase mitochondrial; alpha & beta protein, PLP-dependent transferase, aminotransf mitochondrion; HET: PMP KYN; 1.95A {Homo sapiens} PDB: 2qlr_A* 3dc1_A* 3ue8_A* 2vgz_A* 2xh1_A* Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Back     alignment and structure
>3ihj_A Alanine aminotransferase 2; helix, structural genomics, structural genomics consortium, pyridoxal phosphate; HET: PLP; 2.30A {Homo sapiens} Back     alignment and structure
>1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* Back     alignment and structure
>3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} Back     alignment and structure
>3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: GLN PMP; 2.26A {Mus musculus} SCOP: c.67.1.0 PDB: 2zjg_A* 3e2f_A* 3e2z_A* Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Back     alignment and structure
>2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus} Back     alignment and structure
>3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 2.19A {Helicobacter pylori 26695} SCOP: c.67.1.0 Back     alignment and structure
>3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} SCOP: c.67.1.1 PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A* Back     alignment and structure
>1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1 Back     alignment and structure
>2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} Back     alignment and structure
>3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} Back     alignment and structure
>3ppl_A Aspartate aminotransferase; dimer, PLP-dependent transferase-like fold structural genomics, joint center for structural genomics; HET: MSE PLP UNL; 1.25A {Corynebacterium glutamicum} Back     alignment and structure
>3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} Back     alignment and structure
>2x5d_A Probable aminotransferase; HET: LLP PLP; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>3d6k_A Putative aminotransferase; APC82464, corynebacterium diphthe structural genomics, PSI-2, protein structure initiative; 2.00A {Corynebacterium diphtheriae} Back     alignment and structure
>3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} Back     alignment and structure
>1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 Back     alignment and structure
>1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, LYA; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A* Back     alignment and structure
>1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3qgu_A LL-diaminopimelate aminotransferase; L-lysine, pyridoxal-5' phosphate, chamydomonas reinhardtii; HET: GOL; 1.55A {Chlamydomonas reinhardtii} Back     alignment and structure
>1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A* Back     alignment and structure
>2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} Back     alignment and structure
>1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 Back     alignment and structure
>3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} SCOP: c.67.1.4 PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* Back     alignment and structure
>2o0r_A RV0858C (N-succinyldiaminopimelate aminotransfera; PLP-binding enzyme, lysine biosynthesis, aminotransferase, S genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii} Back     alignment and structure
>3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} Back     alignment and structure
>1bw0_A TAT, protein (tyrosine aminotransferase); tyrosine catabolism, pyridoxal-5'-phosphate, PLP; HET: LLP; 2.50A {Trypanosoma cruzi} SCOP: c.67.1.1 Back     alignment and structure
>3g7q_A Valine-pyruvate aminotransferase; NP_462565.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Salmonella typhimurium} Back     alignment and structure
>2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* Back     alignment and structure
>3ez1_A Aminotransferase MOCR family; YP_604413.1, struct genomics, joint center for structural genomics, JCSG; 2.60A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* Back     alignment and structure
>4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* Back     alignment and structure
>3ei9_A LL-diaminopimelate aminotransferase; lysine biosynthesis, pyridoxal 5' phosphat external aldimine, chloroplast, pyridox phosphate; HET: PL6; 1.55A {Arabidopsis thaliana} PDB: 3ei8_A* 3eib_A* 3ei6_A* 2z1z_A* 3ei5_A* 2z20_A* 3ei7_A 3eia_A* Back     alignment and structure
>3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} SCOP: c.67.1.0 Back     alignment and structure
>3ly1_A Putative histidinol-phosphate aminotransferase; structural G joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica} Back     alignment and structure
>1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* Back     alignment and structure
>3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} Back     alignment and structure
>1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>3f6t_A Aspartate aminotransferase; YP_194538.1, STRU genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: LLP; 2.15A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>3get_A Histidinol-phosphate aminotransferase; NP_281508.1, structural genomics, joint center for structural genomics; HET: LLP MSE; 2.01A {Campylobacter jejuni subsp} Back     alignment and structure
>2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI structure initiative, joint center for structural genomics; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>1fg7_A Histidinol phosphate aminotransferase; HISC, histidine biosynthesis, pyridoxal PH montreal-kingston bacterial structural genomics initiative; HET: PMP; 1.50A {Escherichia coli} SCOP: c.67.1.1 PDB: 1fg3_A* 1gew_A* 1gex_A* 1gey_A* 1iji_A* Back     alignment and structure
>3asa_A LL-diaminopimelate aminotransferase; PLP dependent aminotransferase; 2.05A {Chlamydia trachomatis} PDB: 3asb_A* Back     alignment and structure
>3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} Back     alignment and structure
>3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134} SCOP: c.67.1.0 Back     alignment and structure
>3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria in CLIP11262, structural genomics, PSI-2; 2.31A {Listeria innocua} SCOP: c.67.1.0 Back     alignment and structure
>2zy4_A L-aspartate beta-decarboxylase; pyridoxal 5'-phosphate, aminotransferase, lyase; HET: PLP; 2.00A {Alcaligenes faecalis subsp} PDB: 2zy3_A* 2zy5_A* 3fdd_A* 2zy2_A* Back     alignment and structure
>3bwn_A AT1G70560, L-tryptophan aminotransferase; auxin synthesis, pyridoxal-5'- phosphate, indole-3-pyruvate; HET: LLP PMP PHE; 2.25A {Arabidopsis thaliana} PDB: 3bwo_A* Back     alignment and structure
>3op7_A Aminotransferase class I and II; PLP-dependent transferase, structural genomics, joint center structural genomics, JCSG; HET: LLP UNL; 1.70A {Streptococcus suis 89} PDB: 3p6k_A* Back     alignment and structure
>3b1d_A Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococcus anginosus} PDB: 3b1c_A* 3b1e_A* Back     alignment and structure
>3fkd_A L-threonine-O-3-phosphate decarboxylase; structural genomic, , structural genomics, PSI-2, protein structure initiative; 2.50A {Porphyromonas gingivalis} Back     alignment and structure
>3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} SCOP: c.67.1.0 Back     alignment and structure
>1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase cobalamin, lyase; 1.46A {Salmonella enterica} SCOP: c.67.1.1 PDB: 1lc7_A* 1lc8_A* 1lkc_A* Back     alignment and structure
>3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A Back     alignment and structure
>1uu1_A Histidinol-phosphate aminotransferase; histidine biosynthesis, pyridoxal phosphate, complete proteome; HET: PMP HSA; 2.38A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1uu0_A 1h1c_A* 1uu2_A* 2f8j_A* Back     alignment and structure
>3p1t_A Putative histidinol-phosphate aminotransferase; PLP-dependent transferase-like, structural genomics, joint C structural genomics, JCSG; HET: TLA; 2.60A {Burkholderia pseudomallei} Back     alignment and structure
>3hdo_A Histidinol-phosphate aminotransferase; PSI-II, histidinol-phosphate aminotrans structural genomics, protein structure initiative; 1.61A {Geobacter metallireducens gs-15} Back     alignment and structure
>2hox_A ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINASE; HET: NAG FUC BMA P1T; 1.40A {Allium sativum} SCOP: c.67.1.1 PDB: 2hor_A* 1lk9_A* Back     alignment and structure
>3a2b_A Serine palmitoyltransferase; vitamin B6-dependent enzyme fold type I, acyltransferase, PY phosphate; HET: PLP; 2.30A {Sphingobacterium multivorum} Back     alignment and structure
>1e5e_A MGL, methionine gamma-lyase; methionine biosynthesis, PLP-dependent enzymes, C-S gamma lyase; HET: PPJ; 2.18A {Trichomonas vaginalis} SCOP: c.67.1.3 PDB: 1e5f_A* Back     alignment and structure
>3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1bs0_A Protein (8-amino-7-oxonanoate synthase); PLP-dependent acyl-COA synthase, biotin biosynthesis, 8-AMIN oxonanoate synthase; 1.65A {Escherichia coli} SCOP: c.67.1.4 PDB: 2g6w_A* 1dje_A* 1dj9_A* Back     alignment and structure
>1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* Back     alignment and structure
>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Back     alignment and structure
>2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 Back     alignment and structure
>2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* Back     alignment and structure
>1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Back     alignment and structure
>1fc4_A 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino-3-ketobutyrate COA ligase, pyridoxal phosphate, COEN transferase, structural genomics; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.4 Back     alignment and structure
>1jg8_A L-ALLO-threonine aldolase; glycine biosynthesis, pyridoxal-5'- phosphate, calcium binding site, structural genomics, PSI; HET: LLP; 1.80A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1lw4_A* 1lw5_A* 1m6s_A* 2fm1_A* Back     alignment and structure
>4adb_A Succinylornithine transaminase; transferase, PLP enzymes, aminotransferase; HET: PLP; 2.20A {Escherichia coli} PDB: 4adc_A* 4add_A* 4ade_A Back     alignment and structure
>2rfv_A Methionine gamma-lyase; pyridoxal-5'-phosphate, PLP-dependent enzyme; HET: LLP; 1.35A {Citrobacter freundii} PDB: 1y4i_A* 3jwa_A* 3jw9_A* 3jwb_A* 3mkj_A* Back     alignment and structure
>1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Back     alignment and structure
>1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic proto SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} SCOP: c.67.1.1 Back     alignment and structure
>3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* Back     alignment and structure
>2bwn_A 5-aminolevulinate synthase; tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal PHOS dependent, transferase, acyltransferase; HET: LLP; 2.1A {Rhodobacter capsulatus} SCOP: c.67.1.4 PDB: 2bwo_A* 2bwp_A* Back     alignment and structure
>3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, deino radiodurans, pyridoxal phosphate, transfe PSI-2; 1.70A {Deinococcus radiodurans} Back     alignment and structure
>2w8t_A SPT, serine palmitoyltransferase; HET: LLP; 1.25A {Sphingomonas paucimobilis} PDB: 2w8u_A* 2w8w_A* 2xbn_A* 2w8j_A* 2w8v_A* 2jg2_A* 2jgt_A 2x8u_A* Back     alignment and structure
>1b9h_A AHBA synthase, protein (3-amino-5-hydroxybenzoic acid synthase); rifamycin biosynthesis (RIFD gene); HET: PLP; 2.00A {Amycolatopsis mediterranei} SCOP: c.67.1.4 PDB: 1b9i_A* Back     alignment and structure
>2aeu_A Hypothetical protein MJ0158; selenocysteine synthase, PLP, pyridoxal phosphate, HOMO- oligomerization, unknown function; 1.70A {Methanocaldococcus jannaschii} SCOP: c.67.1.8 PDB: 2aev_A* Back     alignment and structure
>2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* Back     alignment and structure
>3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* Back     alignment and structure
>3kki_A CAI-1 autoinducer synthase; quorum sensing, CQSA, P virulence, acyltransferase, aminotransferase, pyridoxal PHO transferase; HET: PLP; 1.80A {Vibrio cholerae} PDB: 3hqt_A* 2wk9_A* 2wk8_A* 2wka_A* 2wk7_A Back     alignment and structure
>2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* Back     alignment and structure
>3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* Back     alignment and structure
>2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* Back     alignment and structure
>1ibj_A CBL, cystathionine beta-lyase; PLP-dependent enzyme, methionine biosynthesis, transsulfurat lyase; HET: PLP; 2.30A {Arabidopsis thaliana} SCOP: c.67.1.3 Back     alignment and structure
>2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* Back     alignment and structure
>3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* Back     alignment and structure
>1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 Back     alignment and structure
>3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A* Back     alignment and structure
>3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} Back     alignment and structure
>2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* Back     alignment and structure
>4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* Back     alignment and structure
>2oga_A Transaminase; PLP-dependent enzyme, desosamine, deoxysugars, antibiotics, hydrolase; HET: PGU; 2.05A {Streptomyces venezuelae} PDB: 2oge_A* Back     alignment and structure
>4a6r_A Omega transaminase; transferase, PLP-binding enzyme, transaminase fold type I; HET: TA8; 1.35A {Chromobacterium violaceum} PDB: 4a6t_A* 4a6u_A 4a72_A* 4ah3_A* Back     alignment and structure
>1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A* Back     alignment and structure
>2cy8_A D-phgat, D-phenylglycine aminotransferase; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; 2.30A {Pseudomonas stutzeri} Back     alignment and structure
>3a9z_A Selenocysteine lyase; PLP, cytoplasm, pyridoxal phosphate, transferase; HET: PLP SLP; 1.55A {Rattus norvegicus} PDB: 3a9x_A* 3a9y_A* 3gzd_A* 3gzc_A* 2hdy_A* Back     alignment and structure
>3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* Back     alignment and structure
>2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>2po3_A 4-dehydrase; external aldimine, PLP, aminotransferase, TDP-sugar; HET: T4K; 2.10A {Streptomyces venezuelae} Back     alignment and structure
>1v72_A Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2.05A {Pseudomonas putida} SCOP: c.67.1.1 Back     alignment and structure
>3cog_A Cystathionine gamma-lyase; CTH, PLP, propargylglycine, SGC, inhibitor, structural genom stockholm, structural genomics consortium; HET: PLP; 2.00A {Homo sapiens} PDB: 2nmp_A* 3elp_B Back     alignment and structure
>3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} Back     alignment and structure
>3l44_A Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha beta class, PLP-dependent transferase-like, bacillus A csgid, porphyrin biosynthesis; HET: LLP; 2.05A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Back     alignment and structure
>1cs1_A CGS, protein (cystathionine gamma-synthase); lyase, LLP-dependent enzymes, methionine biosynthesis; HET: LLP DHD; 1.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>3acz_A Methionine gamma-lyase; L-methionine; HET: LLP; 1.97A {Entamoeba histolytica} PDB: 3aej_A* 3ael_A* 3aem_A* 3aen_A* 3aeo_A* 3aep_A* Back     alignment and structure
>3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} Back     alignment and structure
>3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>1mdo_A ARNB aminotransferase; type 1 aminotransferase fold; HET: MSE PMP; 1.70A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1mdx_A* 1mdz_A* Back     alignment and structure
>2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics; HET: PLP; 1.15A {Thermus thermophilus} Back     alignment and structure
>3fq8_A Glutamate-1-semialdehyde 2,1-aminomutase; drug resistance, microev0lution, integrated approach, chlorophyll biosynthesis; HET: PMP; 2.00A {Synechococcus elongatus pcc 6301} SCOP: c.67.1.4 PDB: 2hp1_A* 2hoz_A* 2hoy_A* 2hp2_A* 3fq7_A* 3usf_A* 2gsa_A* 3gsb_A* 4gsa_A* 3fqa_A* 2cfb_A* Back     alignment and structure
>3qhx_A Cystathionine gamma-synthase METB (CGS); structural genomics, seattle structural genomics center for infectious disease, ssgcid, CGS_LIKE; HET: LLP EPE; 1.65A {Mycobacterium ulcerans} SCOP: c.67.1.0 PDB: 3qi6_A* Back     alignment and structure
>3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} SCOP: c.67.1.3 PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* Back     alignment and structure
>3ndn_A O-succinylhomoserine sulfhydrylase; seattle structural genomics center for infectious disease, S mycobacterium, PLP, schiff base; HET: LLP; 1.85A {Mycobacterium tuberculosis} Back     alignment and structure
>3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} Back     alignment and structure
>3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} Back     alignment and structure
>3oks_A 4-aminobutyrate transaminase; ssgcid, transferase, seattle structural genomics center for infectious disease; HET: LLP; 1.80A {Mycobacterium smegmatis} PDB: 3r4t_A* 3q8n_A Back     alignment and structure
>1gc0_A Methionine gamma-lyase; pyridoxal-5'-phosphate; HET: LLP; 1.70A {Pseudomonas putida} SCOP: c.67.1.3 PDB: 1gc2_A* 1pg8_A* 1ukj_A* 2o7c_A* Back     alignment and structure
>4hvk_A Probable cysteine desulfurase 2; transferase and ISCS, transferase; HET: PMP PG4; 1.43A {Archaeoglobus fulgidus} PDB: 4eb7_A* 4eb5_A* Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Back     alignment and structure
>3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} Back     alignment and structure
>1pff_A Methionine gamma-lyase; homocysteine; 2.50A {Trichomonas vaginalis} SCOP: c.67.1.3 Back     alignment and structure
>1n8p_A Cystathionine gamma-lyase; three open alpha/beta structures; HET: PLP; 2.60A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>3k28_A Glutamate-1-semialdehyde 2,1-aminomutase 2; biosynthesis of cofactors, prosthetic groups, and carriers, csgid, cytoplasm, isomerase; HET: MSE PLP; 1.95A {Bacillus anthracis str} SCOP: c.67.1.4 PDB: 3bs8_A* Back     alignment and structure
>3dod_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, biotin biosynthesis, pyridoxal phosphate, adenosyl-L-methionine; HET: PLP; 1.90A {Bacillus subtilis} SCOP: c.67.1.0 PDB: 3drd_A 3du4_A* Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Back     alignment and structure
>3i5t_A Aminotransferase; pyridoxal 5'-phosphate, PSI-2, NYSGXRC, ST genomics, protein structure initiative; HET: PLP; 2.00A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3dr4_A Putative perosamine synthetase; deoxysugar, pyridoxal phosphate, aspartate aminotransferase, O-antigen; HET: G4M; 1.60A {Caulobacter crescentus} PDB: 3dr7_A* 3bn1_A* Back     alignment and structure
>3tfu_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; transferase, transferase-transferase inhibitor complex; HET: PL8; 1.94A {Mycobacterium tuberculosis} PDB: 3tft_A* 3bv0_A* 3lv2_A* Back     alignment and structure
>1o69_A Aminotransferase; structural genomics, unknown function; HET: X04; 1.84A {Campylobacter jejuni} SCOP: c.67.1.4 PDB: 1o62_A 1o61_A* Back     alignment and structure
>2c81_A Glutamine-2-deoxy-scyllo-inosose aminotransferase; SMAT, butirosin, aminoglycoside antibiotics; HET: PMP; 1.7A {Bacillus circulans} PDB: 2c7t_A* Back     alignment and structure
>2epj_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.70A {Aeropyrum pernix} PDB: 2zsl_A* 2zsm_A* Back     alignment and structure
>2e7u_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.90A {Thermus thermophilus} Back     alignment and structure
>3vax_A Putative uncharacterized protein DNDA; desulfurase, transferase; HET: PLP; 2.40A {Streptomyces lividans} Back     alignment and structure
>1z7d_A Ornithine aminotransferase; structural genomics consortium, SGC, malaria; 2.10A {Plasmodium yoelii yoelii} SCOP: c.67.1.4 PDB: 3lg0_A 3ntj_A Back     alignment and structure
>2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* Back     alignment and structure
>3uwc_A Nucleotide-sugar aminotransferase; lipopolysaccharide biosynthesis; HET: MSE PMP; 1.80A {Coxiella burnetii} Back     alignment and structure
>3pj0_A LMO0305 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, lyase; HET: LLP MSE; 1.80A {Listeria monocytogenes} Back     alignment and structure
>4e77_A Glutamate-1-semialdehyde 2,1-aminomutase; structural genomics, center for structural genomics of infec diseases, csgid, porphyrin biosynthesis; 2.00A {Yersinia pestis} Back     alignment and structure
>3ffr_A Phosphoserine aminotransferase SERC; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi} Back     alignment and structure
>3nyt_A Aminotransferase WBPE; PLP binding, nucleotide-sugar binding; HET: ULP; 1.30A {Pseudomonas aeruginosa} PDB: 3nys_A* 3nyu_A* 3nu8_A* 3nu7_A* 3nub_A* Back     alignment and structure
>3ht4_A Aluminum resistance protein; lyase, putative cystathionine BEAT-lyase, aluminium resistance protein, Q81A77_baccr, NESG, BCR213; 2.90A {Bacillus cereus atcc 14579} Back     alignment and structure
>2cb1_A O-acetyl homoserine sulfhydrylase; PLP enzyme, lyase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: LLP; 2.0A {Thermus thermophilus} Back     alignment and structure
>1w23_A Phosphoserine aminotransferase; pyridoxal-5'-phosphate; HET: PGE PLP EPE; 1.08A {Bacillus alcalophilus} SCOP: c.67.1.4 PDB: 2bhx_A* 2bi1_A* 2bi2_A* 2bi3_A* 2bi5_A* 2bi9_A* 2bia_A* 2bie_A* 2big_A* Back     alignment and structure
>2fnu_A Aminotransferase; protein-product complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PMP UD1; 1.50A {Helicobacter pylori} SCOP: c.67.1.4 PDB: 2fni_A* 2fn6_A* Back     alignment and structure
>1qgn_A Protein (cystathionine gamma-synthase); methionine biosynthesis, pyridoxal 5'-phosphate, gamma-famil; HET: PLP; 2.90A {Nicotiana tabacum} SCOP: c.67.1.3 PDB: 1i41_A* 1i48_A* 1i43_A* Back     alignment and structure
>3n0l_A Serine hydroxymethyltransferase; alpha beta class, 3-layer(ABA) sandwich, CSGI transferase, structural genomics; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>3jzl_A Putative cystathionine beta-lyase involved in ALU resistance; putative cystathionine beta-lyase involved in aluminum resis structural genomics; HET: LLP; 1.91A {Listeria monocytogenes str} PDB: 3fd0_A* Back     alignment and structure
>2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A Back     alignment and structure
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 Back     alignment and structure
>2fq6_A Cystathionine beta-lyase; protein-inhibitor complex, PLP cofactor covalently bound to inhibitor; HET: P3F; 1.78A {Escherichia coli} SCOP: c.67.1.3 PDB: 2gqn_A* 1cl1_A* 1cl2_A* Back     alignment and structure
>1wyu_B Glycine dehydrogenase subunit 2 (P-protein); alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_B* 1wyv_B* Back     alignment and structure
>3frk_A QDTB; aminotransferase, sugar-modification, natural porduct; HET: TQP; 2.15A {Thermoanaerobacteriumthermosaccharolyticum} Back     alignment and structure
>3i16_A Aluminum resistance protein; YP_878183.1, carbon-sulfur lyase involved in aluminum resist structural genomics; HET: MSE TLA PLP; 2.00A {Clostridium novyi} PDB: 3gwp_A* Back     alignment and structure
>3hvy_A Cystathionine beta-lyase family protein, YNBB B.S ortholog; NP_348457.1, putative cystathionine beta-lyase involved in A resistance; HET: LLP MSE; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3ri6_A O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate, gamma-elimination, direct sulfhydrylation, CY metabolism, protein thiocarboxylate, TR; 2.20A {Wolinella succinogenes} Back     alignment and structure
>3ecd_A Serine hydroxymethyltransferase 2; ssgcid, decode, bupsa00008A, one-carbon metabolism, pyridoxa phosphate, structural genomics; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>2c0r_A PSAT, phosphoserine aminotransferase; pyridoxal-5'-phosphate, pyridine serine biosynthesis, amino-acid biosynthesis, pyridoxal phosphate; HET: PLP; 1.2A {Bacillus circulans} SCOP: c.67.1.4 PDB: 1bt4_A* 1w3u_A* Back     alignment and structure
>3nmy_A Xometc, cystathionine gamma-lyase-like protein; Cys-Met metabolism PLP-dependent enzyme family, CYST gamma lyase, pyridoxal-phosphate; HET: PLP; 2.07A {Xanthomonas oryzae PV} SCOP: c.67.1.0 PDB: 3e6g_A* 3nnp_A* Back     alignment and structure
>2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* Back     alignment and structure
>3h7f_A Serine hydroxymethyltransferase 1; cytoplasm, one-carbon metabolism, pyridoxal phosphate, structural genomics; HET: LLP; 1.50A {Mycobacterium tuberculosis} Back     alignment and structure
>1rv3_A Serine hydroxymethyltransferase, cytosolic; one-carbon metabolism; HET: GLY PLP; 2.40A {Oryctolagus cuniculus} SCOP: c.67.1.4 PDB: 1rv4_A* 1rvu_A* 1rvy_A* 1ls3_A* 1cj0_A* 1bj4_A* 1eji_A* Back     alignment and structure
>3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* Back     alignment and structure
>3gbx_A Serine hydroxymethyltransferase; structural genomics, IDP01011, serine hydroxymethyltransfera salmonella typhimurium.; HET: MSE; 1.80A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1dfo_A* 3g8m_A* 1eqb_A* Back     alignment and structure
>2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 2w7f_A* 2w7d_A* 2w7e_A* 2w7g_A* 2w7h_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* ... Back     alignment and structure
>3ju7_A Putative PLP-dependent aminotransferase; NP_978343.1, struct genomics, joint center for structural genomics, JCSG; HET: LLP PGE; 2.19A {Bacillus cereus atcc 10987} Back     alignment and structure
>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* Back     alignment and structure
>3b8x_A WBDK, pyridoxamine 5-phosphate-dependent dehydrase; aspartate aminotransferase, colitose, perosamine, O-antigen, pyridoxal phosphate,; HET: G4M; 1.70A {Escherichia coli} PDB: 2gms_A* 2gmu_A* 2r0t_A* 3gr9_A* Back     alignment and structure
>2fyf_A PSAT, phosphoserine aminotransferase; PLP-dependent enzyme, dimer, structural genomics; HET: PLP; 1.50A {Mycobacterium tuberculosis} PDB: 3vom_A* Back     alignment and structure
>2ctz_A O-acetyl-L-homoserine sulfhydrylase; crystal, O-acetyl homoserine sulfhydrase, structural genomic structural genomics/proteomics initiative; HET: PLP; 2.60A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Back     alignment and structure
>3vp6_A Glutamate decarboxylase 1; catalytic loop SWAP, lyase; HET: LLP HLD; 2.10A {Homo sapiens} PDB: 2okj_A* 2okk_A* Back     alignment and structure
>2yky_A Beta-transaminase; transferase; HET: PLP SFE; 1.69A {Mesorhizobium SP} PDB: 2ykv_A* 2yku_A* 2ykx_A* Back     alignment and structure
>2x3l_A ORN/Lys/Arg decarboxylase family protein; lyase; HET: LLP; 2.00A {Staphylococcus aureus} Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Back     alignment and structure
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Back     alignment and structure
>4h51_A Aspartate aminotransferase; ssgcid, structural genomics, seattle struc genomics center for infectious disease, aspartate aminotran transferase; HET: LLP; 1.85A {Leishmania major} Back     alignment and structure
>3ke3_A Putative serine-pyruvate aminotransferase; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP; 2.20A {Psychrobacter arcticus 273-4} Back     alignment and structure
>2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>2a7v_A Serine hydroxymethyltransferase; structural genomics, structural genomics consortium, SGC; 2.04A {Homo sapiens} PDB: 3ou5_A Back     alignment and structure
>1wyu_A Glycine dehydrogenase (decarboxylating) subunit 1; alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_A* 1wyv_A* Back     alignment and structure
>1ohv_A 4-aminobutyrate aminotransferase; PLP-dependent enzyme, 4- AMIN acid, antiepileptic drug target; HET: PLP; 2.3A {Sus scrofa} SCOP: c.67.1.4 PDB: 1ohw_A* 1ohy_A* Back     alignment and structure
>1c4k_A Protein (ornithine decarboxylase); lyase; HET: PLP GTP; 2.70A {Lactobacillus SP} SCOP: c.23.1.4 c.67.1.5 d.125.1.1 PDB: 1ord_A* Back     alignment and structure
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Back     alignment and structure
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} SCOP: c.67.1.6 Back     alignment and structure
>3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* Back     alignment and structure
>4ao9_A Beta-phenylalanine aminotransferase; HET: PLP; 1.50A {Variovorax paradoxus} PDB: 4aoa_A* Back     alignment and structure
>3hl2_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine, sepsecs, protein-RNA complex, alternative splicing, cytoplasm, protein biosynthesis, pyridoxal phosphate, selenium; HET: PLR SEP; 2.81A {Homo sapiens} Back     alignment and structure
>3bc8_A O-phosphoseryl-tRNA(SEC) selenium transferase; disorder-order transition, phosphate-loop, pyridoxal phospha selenocysteine synthase (SECS, sepsecs); HET: LLP; 1.65A {Mus musculus} SCOP: c.67.1.9 PDB: 3bca_A* 3bcb_A* Back     alignment and structure
>4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A* Back     alignment and structure
>3e77_A Phosphoserine aminotransferase; SERC, PLP, structural genomi structural genomics consortium, SGC, amino-acid biosynthesi aminotransferase; HET: PLP; 2.50A {Homo sapiens} Back     alignment and structure
>4atq_A 4-aminobutyrate transaminase; transferase; HET: PLP; 2.75A {Arthrobacter aurescens} PDB: 4atp_A* Back     alignment and structure
>3m5u_A Phosphoserine aminotransferase; alpha-beta half sandwich, csgid, amino-acid biosynthesis, cytoplasm, pyridoxal phosphate; HET: MES; 2.15A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>3qm2_A Phosphoserine aminotransferase; structural genomics, center for structural genomics of infec diseases, csgid; 2.25A {Salmonella enterica subsp} PDB: 1bjn_A* 1bjo_A* 3qbo_A* Back     alignment and structure
>4e3q_A Pyruvate transaminase; aminotransferase, transferase; HET: PMP; 1.90A {Vibrio fluvialis} PDB: 4e3r_A* 3nui_A Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Back     alignment and structure
>3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} SCOP: c.67.1.0 Back     alignment and structure
>3ou5_A Serine hydroxymethyltransferase, mitochondrial; structural genomics, STRU genomics consortium, SGC; 2.04A {Homo sapiens} Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Back     alignment and structure
>3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Back     alignment and structure
>3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} SCOP: c.67.1.1 PDB: 3tat_A* Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Back     alignment and structure
>3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} Back     alignment and structure
>3gh5_A HEX1, beta-hexosaminidase; beta-N-acetylhexosaminidase, glycosphingolipids, paenibacill GH20, hydrolase, structural genomics, NPPSFA; HET: NAG; 1.60A {Paenibacillus SP} PDB: 3gh4_A* 3gh7_A* 3sur_A* 3sus_A* 3sut_A* 3suu_A* 3suv_A* 3suw_A* Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Back     alignment and structure
>1jak_A Beta-N-acetylhexosaminidase; glycoside hydrolase, family 20, substrate-assisted catalysis, alpha/beta barrel, isofagomin inhibitor complex; HET: IFG; 1.75A {Streptomyces plicatus} SCOP: c.1.8.6 d.92.2.1 PDB: 1hp4_A* 1hp5_A* 1m01_A* 1m04_A* 1m03_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 583
d1ajsa_412 c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig 5e-71
d7aata_401 c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chi 9e-67
d1yaaa_412 c.67.1.1 (A:) Aspartate aminotransferase, AAT {Bak 7e-62
d3tata_397 c.67.1.1 (A:) Aromatic aminoacid aminotransferase, 2e-61
d2q7wa1396 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT 8e-60
d2ay1a_394 c.67.1.1 (A:) Aromatic aminoacid aminotransferase, 2e-59
d1b5pa_382 c.67.1.1 (A:) Aspartate aminotransferase, AAT {The 3e-13
d1j32a_388 c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pho 5e-13
d1gdea_388 c.67.1.1 (A:) Aromatic aminoacid aminotransferase, 1e-12
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Length = 412 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: AAT-like
domain: Aspartate aminotransferase, AAT
species: Pig (Sus scrofa), cytosolic form [TaxId: 9823]
 Score =  232 bits (591), Expect = 5e-71
 Identities = 157/388 (40%), Positives = 227/388 (58%), Gaps = 48/388 (12%)

Query: 157 FNKDPHPKKMNLGVGAYRGEDGKPYVLPSVKEAERRIYE-KNLDHEYANIGGDAKFCKLA 215
           F +DP P+K+NLGVGAYR +D +P+VLP V++ E+RI    +L+HEY  I G A+F   A
Sbjct: 24  FREDPDPRKVNLGVGAYRTDDCQPWVLPVVRKVEQRIANNSSLNHEYLPILGLAEFRTCA 83

Query: 216 AQLAYGEDFPAFKDNRLAIVQGISGSGSLRVGTAFLERFYPGV----KTVYFPTPTWNGH 271
           ++LA G+D PA ++ R+  VQ + G+G+LR+G  FL R+Y G       VY  +PTW  H
Sbjct: 84  SRLALGDDSPALQEKRVGGVQSLGGTGALRIGAEFLARWYNGTNNKDTPVYVSSPTWENH 143

Query: 272 VRFCTDSRLN-VGAYRYFDNKTNGLDFAGMMEDIKAMPERSILFLQTSSHNPTGVDLSED 330
               T +    + +YRY+D +  GLD  G + D++  PE SI  L   +HNPTG D + +
Sbjct: 144 NGVFTTAGFKDIRSYRYWDTEKRGLDLQGFLSDLENAPEFSIFVLHACAHNPTGTDPTPE 203

Query: 331 QWRQLAVVVKQRHLYPFFDMAYLGLTSGDFDKDAFSLRYFAKEVGQLCLAQSFSKNMGLY 390
           QW+Q+A V+K+R L+PFFD AY G  SG+ +KDA+++RYF  E  +L  AQSFSKN GLY
Sbjct: 204 QWKQIASVMKRRFLFPFFDSAYQGFASGNLEKDAWAIRYFVSEGFELFCAQSFSKNFGLY 263

Query: 391 GERVGTFSVLTPTSDETERIMSQLKILIRGFYSNPPIHGARIVTEILSDPKLKAQCDETE 450
            ERVG  +V+                                            + D   
Sbjct: 264 NERVGNLTVVAK------------------------------------------EPDSIL 281

Query: 451 RIMSQLKILIRGFYSNPPIHGARIVTEILSDPKLKAQWFEECKGMSNRISSIREELKSKI 510
           R++SQ++ ++R  +SNPP  GARIV   LSDP+L  +W    K M++RI S+R EL++++
Sbjct: 282 RVLSQMQKIVRVTWSNPPAQGARIVARTLSDPELFHEWTGNVKTMADRILSMRSELRARL 341

Query: 511 LDKGSKKNWDHITNQKGMFCYTGLSASQ 538
               +   W+HIT+Q GMF +TGL+  Q
Sbjct: 342 EALKTPGTWNHITDQIGMFSFTGLNPKQ 369


>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Length = 401 Back     information, alignment and structure
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Length = 412 Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Length = 397 Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Length = 396 Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Length = 394 Back     information, alignment and structure
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Length = 382 Back     information, alignment and structure
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Length = 388 Back     information, alignment and structure
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 388 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query583
d7aata_401 Aspartate aminotransferase, AAT {Chicken (Gallus g 100.0
d2q7wa1396 Aspartate aminotransferase, AAT {Escherichia coli 100.0
d1yaaa_412 Aspartate aminotransferase, AAT {Baker's yeast (Sa 100.0
d1ajsa_412 Aspartate aminotransferase, AAT {Pig (Sus scrofa), 100.0
d3tata_397 Aromatic aminoacid aminotransferase, AroAT {Escher 100.0
d2ay1a_394 Aromatic aminoacid aminotransferase, AroAT {Paraco 100.0
d1b5pa_382 Aspartate aminotransferase, AAT {Thermus thermophi 100.0
d1j32a_388 Aspartate aminotransferase, AAT {Phormidium lapide 100.0
d1gdea_388 Aromatic aminoacid aminotransferase, AroAT {Archae 100.0
d1xi9a_395 Putative alanine aminotransferase {Pyrococcus furi 100.0
d2r5ea1418 Kynurenine--oxoglutarate transaminase I {Yellowfev 100.0
d1wsta1403 Multiple substrate aminotransferase, MSAT {Thermoc 100.0
d1vp4a_420 Putative aminotransferase TM1131 {Thermotoga marit 100.0
d1w7la_418 Kynurenine--oxoglutarate transaminase I {Human (Ho 100.0
d1u08a_382 Putative methionine aminotransferase YdbL {Escheri 100.0
d1o4sa_375 Aspartate aminotransferase, AAT {Thermotoga mariti 100.0
d1bw0a_412 Tyrosine aminotransferase (TAT) {Trypanosoma cruzi 100.0
d1c7na_394 Cystalysin {Treponema denticola [TaxId: 158]} 100.0
d2gb3a1389 AAT homologue TM1698 {Thermotoga maritima [TaxId: 100.0
d1iaya_428 1-aminocyclopropane-1-carboxylate synthase (ACC sy 100.0
d1m7ya_431 1-aminocyclopropane-1-carboxylate synthase (ACC sy 100.0
d1d2fa_361 Modulator in mal gene expression, MalY {Escherichi 100.0
d1v2da_368 Glutamine aminotransferase {Thermus thermophilus [ 100.0
d2f8ja1334 Histidinol-phosphate aminotransferase HisC {Thermo 100.0
d1lc5a_355 L-threonine-O-3-phosphate decarboxylase CobD {Salm 100.0
d1fg7a_354 Histidinol-phosphate aminotransferase HisC {Escher 100.0
d2hoxa1425 Alliinase {Garlic (Allium sativum) [TaxId: 4682]} 99.95
d2aeua1366 Hypothetical protein MJ0158 {Archaeon Methanococcu 99.86
d2e7ja1364 Selenocysteinyl-tRNA synthase (SepSecS) {Archaeogl 99.81
d1p3wa_391 Cysteine desulfurase IscS {Escherichia coli [TaxId 99.59
d1m6sa_343 Low-specificity threonine aldolase {Thermotoga mar 99.52
d1elua_381 Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 99.49
d1bs0a_383 PLP-dependent acyl-CoA synthase (8-amino-7-oxonano 99.48
d1fc4a_401 2-amino-3-ketobutyrate CoA ligase {Escherichia col 99.39
d1eg5a_376 NifS-like protein/selenocysteine lyase {Thermotoga 99.39
d1mdoa_376 Aminotransferase ArnB {Salmonella typhimurium [Tax 99.36
d2bwna1396 5-aminolevulinate synthase {Rhodobacter capsulatus 99.36
d1y4ia1397 Methionine gamma-lyase, MGL {Citrobacter freundii 99.34
d1gc0a_392 Methionine gamma-lyase, MGL {Pseudomonas putida [T 99.32
d1ibja_380 Cystathionine beta-lyase, CBL {Thale cress (Arabid 99.29
d1c7ga_456 Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 5 99.27
d1b9ha_384 3-amino-5-hydroxybenzoic acid synthase (AHBA synth 99.27
d1svva_340 Low-specificity threonine aldolase {Leishmania maj 99.27
d1cs1a_384 Cystathionine gamma-synthase, CGS {Escherichia col 99.26
d3bc8a1445 Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mu 99.25
d1qgna_398 Cystathionine gamma-synthase, CGS {Common tobacco 99.25
d1ax4a_465 Tryptophan indol-lyase (tryptophanase) {Proteus vu 99.22
d1jf9a_405 NifS-like protein/selenocysteine lyase {Escherichi 99.19
d1cl1a_391 Cystathionine beta-lyase, CBL {Escherichia coli [T 99.12
d2ctza1421 O-acetyl-L-homoserine sulfhydrylase {Thermus therm 99.11
d1v72a1345 Phenylserine aldolase PSALD {Pseudomonas putida [T 99.1
d1pffa_331 Methionine gamma-lyase, MGL {Trichomonas vaginalis 99.09
d2z67a1434 Selenocysteinyl-tRNA synthase (SepSecS) {Methanoco 99.09
d1e5ea_394 Methionine gamma-lyase, MGL {Trichomonas vaginalis 99.01
d1n8pa_393 Cystathionine gamma-lyase (CYS3) {Baker's yeast (S 98.96
d1o69a_374 Aminotransferase homolog WlaK (PglE, Cj1121c) {Cam 98.93
d2fnua1371 Spore coat polysaccharide biosynthesis protein C { 98.87
d2v1pa1467 Tryptophan indol-lyase (tryptophanase) {Escherichi 98.77
d1t3ia_408 Probable cysteine desulfurase SufS {Synechocystis 98.77
d2gsaa_427 Glutamate-1-semialdehyde aminomutase (aminotransfe 98.72
d1qz9a_404 Kynureninase {Pseudomonas fluorescens [TaxId: 294] 98.59
d1vefa1387 Acetylornithine/acetyl-lysine aminotransferase Arg 98.58
d1pmma_450 Glutamate decarboxylase beta, GadB {Escherichia co 98.55
d2byla1404 Ornithine aminotransferase {Human (Homo sapiens) [ 98.48
d2bkwa1382 Alanine-glyoxylate aminotransferase {Baker's yeast 98.41
d1zoda1431 Dialkylglycine decarboxylase {Pseudomonas cepacia 98.4
d1m32a_361 2-aminoethylphosphonate transaminase {Salmonella t 98.39
d1c4ka2462 Ornithine decarboxylase major domain {Lactobacillu 98.32
d1h0ca_388 Alanine-glyoxylate aminotransferase {Human (Homo s 98.3
d1sffa_425 4-aminobutyrate aminotransferase, GABA-aminotransf 98.28
d1kl1a_405 Serine hydroxymethyltransferase {Bacillus stearoth 98.18
d1s0aa_429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 98.15
d1z7da1404 Ornithine aminotransferase {Plasmodium yoelii yoel 98.11
d1vjoa_377 Alanine-glyoxylate aminotransferase {Cyanobacteria 98.11
d1dfoa_416 Serine hydroxymethyltransferase {Escherichia coli 98.1
d1js3a_476 DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823] 98.09
d1iuga_348 Subgroup IV putative aspartate aminotransferase {T 97.96
d2ay1a_394 Aromatic aminoacid aminotransferase, AroAT {Paraco 97.84
d3tata_397 Aromatic aminoacid aminotransferase, AroAT {Escher 97.8
d2ch1a1388 3-hydroxykynurenine transaminase {Malaria mosquito 97.74
d2a7va1463 Serine hydroxymethyltransferase {Human (Homo sapie 97.66
d1rv3a_470 Serine hydroxymethyltransferase {Rabbit (Oryctolag 97.64
d1ohwa_461 4-aminobutyrate aminotransferase, GABA-aminotransf 97.59
d1ajsa_412 Aspartate aminotransferase, AAT {Pig (Sus scrofa), 97.56
d2q7wa1396 Aspartate aminotransferase, AAT {Escherichia coli 97.55
d7aata_401 Aspartate aminotransferase, AAT {Chicken (Gallus g 97.51
d1yaaa_412 Aspartate aminotransferase, AAT {Baker's yeast (Sa 96.96
d2c0ra1361 Phosphoserine aminotransferase, PSAT {Bacillus cir 96.89
d1bjna_360 Phosphoserine aminotransferase, PSAT {Escherichia 96.43
d1w23a_360 Phosphoserine aminotransferase, PSAT {Bacillus alc 95.85
d1wyua1437 Glycine dehydrogenase (decarboxylating) subunit 1 95.36
d1m7ya_431 1-aminocyclopropane-1-carboxylate synthase (ACC sy 90.96
d1wyub1471 Glycine dehydrogenase subunit 2 (P-protein) {Therm 86.84
d1d2fa_361 Modulator in mal gene expression, MalY {Escherichi 85.57
d1gdea_388 Aromatic aminoacid aminotransferase, AroAT {Archae 80.74
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: AAT-like
domain: Aspartate aminotransferase, AAT
species: Chicken (Gallus gallus), mitochondria [TaxId: 9031]
Probab=100.00  E-value=1.3e-52  Score=443.26  Aligned_cols=377  Identities=49%  Similarity=0.871  Sum_probs=308.0

Q ss_pred             ccchhhHhhccccccCCCCCccccCCccccCCCCCCCCChHHHHHHHHHhccCCCCCCCCCCCCHHHHHHHHHHHhCCCC
Q psy14428        145 EDIKPLKQQLKGFNKDPHPKKMNLGVGAYRGEDGKPYVLPSVKEAERRIYEKNLDHEYANIGGDAKFCKLAAQLAYGEDF  224 (583)
Q Consensus       145 ~~~~~i~~l~~~~~~~~~~~~i~l~~g~~~~~~~~p~~~~~v~~a~~~~~~~~~~~~Y~~~~G~~~Lr~aia~~~~~~~g  224 (583)
                      .|+++++.+.+.++++.++++|||++|.+.++.+.+++++.|+++..++..++..++|+|..|.++||++|++++.++++
T Consensus        10 ~p~d~i~~~~~~~~~d~~~~~InL~iG~~~d~~~~~~~~~~V~~a~~~~~~~~~~~~Y~~~~G~~~lr~aia~~~~~~~~   89 (401)
T d7aata_          10 GPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIAAKKMDKEYLPIAGLADFTRASAELALGENS   89 (401)
T ss_dssp             CCCCHHHHHHHHHHHCCCTTCEECCCCSCCCTTSCCCCCHHHHHHHHHHHHTTCCCCCCCTTCCHHHHHHHHHHHHCTTC
T ss_pred             CCCChHHHHHHHHhCCCCCCcEEccCCCCcCCCCCCCCCHHHHHHHHHHhhCCCCCCCCCCCCCHHHHHHHHHHHhccCC
Confidence            57889999988888888999999999998777787778899999999988776667899999999999999999999999


Q ss_pred             CCCCCCCeEEEecCCchhHHHHHHHHHHHhCCCCCEEEEcCCCChhhHHHHhhcCCeEEEEecccCCCCCCChhhHHHHH
Q psy14428        225 PAFKDNRLAIVQGISGSGSLRVGTAFLERFYPGVKTVYFPTPTWNGHVRFCTDSRLNVGAYRYFDNKTNGLDFAGMMEDI  304 (583)
Q Consensus       225 ~~~~~~~I~i~~t~G~~~al~l~~~~l~~~~~~gd~Vlv~~P~y~~~~~~~~~~G~~~~~v~~~d~~~~g~d~~~l~~~l  304 (583)
                      ..+.+++|++.++.++++++..+..++..+++|||+|++++|+|+.|..+++.+|++++.+|+.+++++.++++.+.+.+
T Consensus        90 ~~~~~~~i~~~~~~~~~g~~~~~~~~~~~l~~pGd~Vlv~~P~y~~y~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~  169 (401)
T d7aata_          90 EAFKSGRYVTVQGISGTGSLRVGANFLQRFFKFSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYDPKTCSLDFTGAMEDI  169 (401)
T ss_dssp             HHHHTTCEEEEEEEHHHHHHHHHHHHHHHHCTTCCEEEEEESCCTTHHHHHHHTTCEEEEEECEETTTTEECHHHHHHHH
T ss_pred             cccCcCceEEeccchHHHHHHHHHHhhHhhcCCCceEEEecCCCcchhhHHHHcCCeEEEEeccccccccccHHHHHHHH
Confidence            99999999996677777777777667788889999999999999999999999999999999966666778899998888


Q ss_pred             HcCCCCcEEEEeCCCCCCCCCCCCHHHHHHHHHHHHhcCeEEEEeccCCCCCCCCCCCchHHHHHHHHhcCcEEEEecCc
Q psy14428        305 KAMPERSILFLQTSSHNPTGVDLSEDQWRQLAVVVKQRHLYPFFDMAYLGLTSGDFDKDAFSLRYFAKEVGQLCLAQSFS  384 (583)
Q Consensus       305 ~~~~~~~~~i~i~~p~NPTG~~~s~~~~~~l~~~a~~~~i~iI~De~Y~~l~~~~~~~~~~~~~~~~~~~~~vi~i~S~S  384 (583)
                      ....++++++++||||||||.++|.+++++|+++|++|+++||+||+|.+|.|++..........+.+..++++++.|+|
T Consensus       170 ~~~~~~~~~iii~~p~NPTG~~~s~e~~~~l~~~a~~~~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~~~~~~s~s  249 (401)
T d7aata_         170 SKIPEKSIILLHACAHNPTGVDPRQEQWKELASVVKKRNLLAYFDMAYQGFASGDINRDAWALRHFIEQGIDVVLSQSYA  249 (401)
T ss_dssp             TTSCTTCEEEEESSSCTTTCCCCCHHHHHHHHHHHHHTTCEEEEEESCTTTTTSCHHHHTHHHHHHHHTTCCCEEEEECT
T ss_pred             hcCCCceEEEEecCCCCCccccCCHHHHHHHHHHHhcceEEEEEeccchhhhcCCcccchhhhhhhhhhhcccceeEecc
Confidence            77778899999999999999999999999999999999999999999999999862111222333345567899999999


Q ss_pred             ccccccCccceEEEEEcCCch--hHHHHHHHHHHHHhccccCCChHHHHHHHHHhCChhhhhhhhhHHHHHHHHHHHHhh
Q psy14428        385 KNMGLYGERVGTFSVLTPTSD--ETERIMSQLKILIRGFYSNPPIHGARIVTEILSDPKLKAQCDETERIMSQLKILIRG  462 (583)
Q Consensus       385 K~~~l~GlRiG~lv~~~p~~~--~~~~li~~l~~~~~~~~~~~s~~~q~~~~~~l~~~~~~~~~~~~~~~~~~l~~~~r~  462 (583)
                      |.++++|+|+||+++  +...  ....+...+....+..+.+++.+.|.+++.++.+                       
T Consensus       250 k~~~~~G~RiG~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~q~~~~~~l~~-----------------------  304 (401)
T d7aata_         250 KNMGLYGERAGAFTV--ICRDAEEAKRVESQLKILIRPMYSNPPMNGARIASLILNT-----------------------  304 (401)
T ss_dssp             TTSCCGGGCEEEEEE--ECSSHHHHHHHHHHHHHHHHHHHSSCCHHHHHHHHHHHHC-----------------------
T ss_pred             ccceeeccccceeec--chHHHHHHHHHHHHHHHHhhccccccchHHHHHHHHhcCC-----------------------
Confidence            999999999999999  5321  0111222222233445566666767666666655                       


Q ss_pred             ccCCCccchhhHHHHhcCChhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCcccccccccceeecCCChhhhhhh
Q psy14428        463 FYSNPPIHGARIVTEILSDPKLKAQWFEECKGMSNRISSIREELKSKILDKGSKKNWDHITNQKGMFCYTGLSASQGMSN  542 (583)
Q Consensus       463 ~~~~~p~~g~~i~~~~l~~~~~~~~~~~~l~~~~~~~~~~r~~l~~~L~~~~~pg~~~~~~~~~g~f~~~~l~~~~~~~~  542 (583)
                                         +.+..+|.+++++++++|..+|+.+.+.|++.+.++.|.+..+++|||+|..++.+..++ 
T Consensus       305 -------------------~~~~~~~~~~~~~~~~~~~~~r~~l~~~L~~~~~~~~~~~~~~~~G~F~~~~ls~e~~~~-  364 (401)
T d7aata_         305 -------------------PELRKEWLVEVKGMADRIISMRTQLVSNLKKEGSSHNWQHITDQIGMFCFTGLKPEQVER-  364 (401)
T ss_dssp             -------------------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCCSCCHHHHHCCSSEEECCCCHHHHHH-
T ss_pred             -------------------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCCCcceECCCCeEEEecCCCHHHHHH-
Confidence                               344556777889999999999999999999998888898899999999999998876544 


Q ss_pred             hhhhhHHHHHHHHhhcCCCccccccccCCcceeecCCCCCC
Q psy14428        543 RISSIREELKSKILDKGSKKNWDHITNQKGMFCYTGLSASQ  583 (583)
Q Consensus       543 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  583 (583)
                          |.++.++++.             +.+++||+++++++
T Consensus       365 ----L~~e~gV~~~-------------pg~Ris~a~~~~~~  388 (401)
T d7aata_         365 ----LTKEFSIYMT-------------KDGRISVAGVASSN  388 (401)
T ss_dssp             ----HHHHHCEECC-------------TTCEEEGGGCCTTT
T ss_pred             ----HHHhCCEEEC-------------CCcEEEeccCCHHH
Confidence                4444433332             22589999988874



>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Back     information, alignment and structure
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2r5ea1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]} Back     information, alignment and structure
>d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} Back     information, alignment and structure
>d1vp4a_ c.67.1.1 (A:) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w7la_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1bw0a_ c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} Back     information, alignment and structure
>d2gb3a1 c.67.1.1 (A:4-392) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iaya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]} Back     information, alignment and structure
>d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2f8ja1 c.67.1.1 (A:1-334) Histidinol-phosphate aminotransferase HisC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lc5a_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d1fg7a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hoxa1 c.67.1.1 (A:1-425) Alliinase {Garlic (Allium sativum) [TaxId: 4682]} Back     information, alignment and structure
>d2aeua1 c.67.1.8 (A:9-374) Hypothetical protein MJ0158 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mdoa_ c.67.1.4 (A:) Aminotransferase ArnB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1y4ia1 c.67.1.3 (A:2-398) Methionine gamma-lyase, MGL {Citrobacter freundii [TaxId: 546]} Back     information, alignment and structure
>d1gc0a_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ibja_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} Back     information, alignment and structure
>d1b9ha_ c.67.1.4 (A:) 3-amino-5-hydroxybenzoic acid synthase (AHBA synthase) {Amycolatopsis mediterranei [TaxId: 33910]} Back     information, alignment and structure
>d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1cs1a_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qgna_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cl1a_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ctza1 c.67.1.3 (A:1-421) O-acetyl-L-homoserine sulfhydrylase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pffa_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL2 [TaxId: 5722]} Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1e5ea_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL1 [TaxId: 5722]} Back     information, alignment and structure
>d1n8pa_ c.67.1.3 (A:) Cystathionine gamma-lyase (CYS3) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1o69a_ c.67.1.4 (A:) Aminotransferase homolog WlaK (PglE, Cj1121c) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2fnua1 c.67.1.4 (A:2-372) Spore coat polysaccharide biosynthesis protein C {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2gsaa_ c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase (aminotransferase) {Synechococcus sp., strain GR6 [TaxId: 1131]} Back     information, alignment and structure
>d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1vefa1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2byla1 c.67.1.4 (A:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bkwa1 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zoda1 c.67.1.4 (A:3-433) Dialkylglycine decarboxylase {Pseudomonas cepacia [TaxId: 292]} Back     information, alignment and structure
>d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sffa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kl1a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1s0aa_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z7da1 c.67.1.4 (A:7-410) Ornithine aminotransferase {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} Back     information, alignment and structure
>d1dfoa_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1iuga_ c.67.1.3 (A:) Subgroup IV putative aspartate aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]} Back     information, alignment and structure
>d2a7va1 c.67.1.4 (A:26-488) Serine hydroxymethyltransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1rv3a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1ohwa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Back     information, alignment and structure
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Back     information, alignment and structure
>d2c0ra1 c.67.1.4 (A:2-362) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d1bjna_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w23a_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]} Back     information, alignment and structure
>d1wyua1 c.67.1.7 (A:1-437) Glycine dehydrogenase (decarboxylating) subunit 1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]} Back     information, alignment and structure
>d1wyub1 c.67.1.7 (B:2-472) Glycine dehydrogenase subunit 2 (P-protein) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure