Psyllid ID: psy14436

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130---
MNEDFNHGYRELQLQVSVERFDPKLNRWTAMAPMSTRRKHLGCAVFNNVIYAVGGRDDSMELSSAEKYNPHTNTWLPIVAMTSRRSGLGPGSLQLTLPTLTSVKFTYIIPGDPAERLKFTREEKEPPHMYWYK
ccccccccccccccccEEEEEEccccEEEEEccccccccccEEEEEccEEEEEccccccccccEEEEEEcccccEEEcccccccccccEEEEEccccccccccccEEEEccccccccccEEEEEccccccEEc
ccEEEcccccccccccEEEEEccccccEEEEccccccccccEEEEEccEEEEEEcccccccccEEEEEccccccEEEEcccccccccEEEEEEccEEEEEEcccEEEEEEcccccccccEEEEEccccccccc
mnedfnhgyreLQLQVSverfdpklnrwtamapmstrrkhlgcavFNNVIyavggrddsmelssaekynphtntwlpivamtsrrsglgpgslqltlptltsvkftyiipgdpaerlkftreekepphmywyk
mnedfnhgyrelqlqvsverfdpklnrwtamapmstrrkhlgcAVFNNVIYAVGGRDDSMELSSAEKYNPHTNTWLPIVAMTSRRSGLGPGSLQLTLPTLTSVKFTyiipgdpaerlkftreekepphmywyk
MNEDFNHGYRELQLQVSVERFDPKLNRWTAMAPMSTRRKHLGCAVFNNVIYAVGGRDDSMELSSAEKYNPHTNTWLPIVAMTSRRSGLGPGSLQLTLPTLTSVKFTYIIPGDPAERLKFTREEKEPPHMYWYK
*********RELQLQVSVERFDPKLNRWTAMAPMSTRRKHLGCAVFNNVIYAVGGR***********YNPHTNTWLPIVAMTSRRSGLGPGSLQLTLPTLTSVKFTYIIPGD*********************
*NEDFNHGYRELQLQVSVERFDPKLNRWTAMAPMSTRRKHLGCAVFNNVIYAVGGRDDSMELSSAEKYNPHTNTWLPIVAMTSRRSGLGPGSLQLTLPTLTSVKFTYIIPGDPAERLKFTREEKEPPHMYWY*
MNEDFNHGYRELQLQVSVERFDPKLNRWTAMAPMSTRRKHLGCAVFNNVIYAVGGRDDSMELSSAEKYNPHTNTWLPIVAMTSRRSGLGPGSLQLTLPTLTSVKFTYIIPGDPAERLKFTREEK*********
MNEDFNHGYRELQLQVSVERFDPKLNRWTAMAPMSTRRKHLGCAVFNNVIYAVGGRDDSMELSSAEKYNPHTNTWLPIVAMTSRRSGLGPGSLQLTLPTLTSVKFTYIIPGDPAERLKFTREEKEPPHM****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNEDFNHGYRELQLQVSVERFDPKLNRWTAMAPMSTRRKHLGCAVFNNVIYAVGGRDDSMELSSAEKYNPHTNTWLPIVAMTSRRSGLGPGSLQLTLPTLTSVKFTYIIPGDPAERLKFTREEKEPPHMYWYK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query133 2.2.26 [Sep-21-2011]
Q16RL8589 Kelch-like protein diablo N/A N/A 0.473 0.106 0.808 4e-32
B0WWP2582 Kelch-like protein diablo N/A N/A 0.473 0.108 0.808 5e-32
Q7QGL0582 Kelch-like protein diablo yes N/A 0.473 0.108 0.808 5e-32
B4GRJ2628 Kelch-like protein diablo N/A N/A 0.473 0.100 0.808 4e-31
Q2M0J9628 Kelch-like protein diablo yes N/A 0.473 0.100 0.808 4e-31
B4QLQ2623 Kelch-like protein diablo N/A N/A 0.473 0.101 0.808 5e-31
B4PD06623 Kelch-like protein diablo N/A N/A 0.473 0.101 0.808 5e-31
B4HIK1623 Kelch-like protein diablo N/A N/A 0.473 0.101 0.808 5e-31
Q9VUU5623 Kelch-like protein diablo yes N/A 0.473 0.101 0.808 5e-31
B3NDN0623 Kelch-like protein diablo N/A N/A 0.473 0.101 0.808 5e-31
>sp|Q16RL8|KLHDB_AEDAE Kelch-like protein diablo OS=Aedes aegypti GN=dbo PE=3 SV=1 Back     alignment and function desciption
 Score =  136 bits (342), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 59/73 (80%), Positives = 68/73 (93%)

Query: 17  SVERFDPKLNRWTAMAPMSTRRKHLGCAVFNNVIYAVGGRDDSMELSSAEKYNPHTNTWL 76
           +VER+DP+ N+W A++PMSTRRKHLGCAVFNN IYAVGGRDD MELSSAE+YNPHTN+W 
Sbjct: 449 TVERYDPRQNKWCAVSPMSTRRKHLGCAVFNNFIYAVGGRDDCMELSSAERYNPHTNSWS 508

Query: 77  PIVAMTSRRSGLG 89
           PIVAMTSRRSG+G
Sbjct: 509 PIVAMTSRRSGVG 521
Probable substrate-specific adapter of an E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. May have a role in synapse differentiation and growth.
Aedes aegypti (taxid: 7159)
>sp|B0WWP2|KLHDB_CULQU Kelch-like protein diablo OS=Culex quinquefasciatus GN=dbo PE=3 SV=2 Back     alignment and function description
>sp|Q7QGL0|KLHDB_ANOGA Kelch-like protein diablo OS=Anopheles gambiae GN=dbo PE=3 SV=4 Back     alignment and function description
>sp|B4GRJ2|KLHDB_DROPE Kelch-like protein diablo OS=Drosophila persimilis GN=dbo PE=3 SV=1 Back     alignment and function description
>sp|Q2M0J9|KLHDB_DROPS Kelch-like protein diablo OS=Drosophila pseudoobscura pseudoobscura GN=dbo PE=3 SV=2 Back     alignment and function description
>sp|B4QLQ2|KLHDB_DROSI Kelch-like protein diablo OS=Drosophila simulans GN=dbo PE=3 SV=1 Back     alignment and function description
>sp|B4PD06|KLHDB_DROYA Kelch-like protein diablo OS=Drosophila yakuba GN=dbo PE=3 SV=1 Back     alignment and function description
>sp|B4HIK1|KLHDB_DROSE Kelch-like protein diablo OS=Drosophila sechellia GN=dbo PE=3 SV=1 Back     alignment and function description
>sp|Q9VUU5|KLHDB_DROME Kelch-like protein diablo OS=Drosophila melanogaster GN=dbo PE=1 SV=1 Back     alignment and function description
>sp|B3NDN0|KLHDB_DROER Kelch-like protein diablo OS=Drosophila erecta GN=dbo PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query133
312376627 907 hypothetical protein AND_12475 [Anophele 0.473 0.069 0.808 1e-30
307214700 519 Kelch-like protein 20 [Harpegnathos salt 0.466 0.119 0.808 2e-30
157127716 589 BACH1, putative [Aedes aegypti] gi|12210 0.473 0.106 0.808 3e-30
158288034 582 AGAP011587-PA [Anopheles gambiae str. PE 0.473 0.108 0.808 3e-30
254808001 582 RecName: Full=Kelch-like protein diablo 0.473 0.108 0.808 3e-30
254808003 582 RecName: Full=Kelch-like protein diablo 0.473 0.108 0.808 3e-30
193713763 579 PREDICTED: kelch-like protein diablo-lik 0.473 0.108 0.808 4e-30
189237009 582 PREDICTED: similar to BACH1, putative [T 0.473 0.108 0.808 5e-30
345492557 581 PREDICTED: kelch-like protein diablo-lik 0.473 0.108 0.794 5e-30
383852884 620 PREDICTED: kelch-like protein diablo-lik 0.473 0.101 0.794 6e-30
>gi|312376627|gb|EFR23654.1| hypothetical protein AND_12475 [Anopheles darlingi] Back     alignment and taxonomy information
 Score =  137 bits (346), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 59/73 (80%), Positives = 68/73 (93%)

Query: 17  SVERFDPKLNRWTAMAPMSTRRKHLGCAVFNNVIYAVGGRDDSMELSSAEKYNPHTNTWL 76
           +VER+DP+ N+W A++PMSTRRKHLGCAVFNN IYAVGGRDD MELSSAE+YNPHTN+W 
Sbjct: 449 TVERYDPRQNKWCAVSPMSTRRKHLGCAVFNNFIYAVGGRDDCMELSSAERYNPHTNSWS 508

Query: 77  PIVAMTSRRSGLG 89
           PIVAMTSRRSG+G
Sbjct: 509 PIVAMTSRRSGVG 521

Source: Anopheles darlingi

Species: Anopheles darlingi

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307214700|gb|EFN89629.1| Kelch-like protein 20 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|157127716|ref|XP_001661146.1| BACH1, putative [Aedes aegypti] gi|122105300|sp|Q16RL8.1|KLHDB_AEDAE RecName: Full=Kelch-like protein diablo gi|108872825|gb|EAT37050.1| AAEL010911-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|158288034|ref|XP_309921.3| AGAP011587-PA [Anopheles gambiae str. PEST] gi|157019279|gb|EAA05692.3| AGAP011587-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|254808001|sp|B0WWP2.2|KLHDB_CULQU RecName: Full=Kelch-like protein diablo Back     alignment and taxonomy information
>gi|254808003|sp|Q7QGL0.4|KLHDB_ANOGA RecName: Full=Kelch-like protein diablo Back     alignment and taxonomy information
>gi|193713763|ref|XP_001949122.1| PREDICTED: kelch-like protein diablo-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|189237009|ref|XP_967077.2| PREDICTED: similar to BACH1, putative [Tribolium castaneum] gi|270007324|gb|EFA03772.1| hypothetical protein TcasGA2_TC013883 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|345492557|ref|XP_001600980.2| PREDICTED: kelch-like protein diablo-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383852884|ref|XP_003701955.1| PREDICTED: kelch-like protein diablo-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query133
UNIPROTKB|B0WWP2582 dbo "Kelch-like protein diablo 0.548 0.125 0.808 1.9e-29
UNIPROTKB|Q7QGL0582 dbo "Kelch-like protein diablo 0.548 0.125 0.808 1.9e-29
UNIPROTKB|Q16RL8589 dbo "Kelch-like protein diablo 0.548 0.123 0.808 2e-29
UNIPROTKB|B4GRJ2628 dbo "Kelch-like protein diablo 0.548 0.116 0.808 1.2e-28
UNIPROTKB|Q2M0J9628 dbo "Kelch-like protein diablo 0.548 0.116 0.808 1.2e-28
UNIPROTKB|B4QLQ2623 dbo "Kelch-like protein diablo 0.548 0.117 0.808 1.5e-28
FB|FBgn0040230623 dbo "diablo" [Drosophila melan 0.548 0.117 0.808 1.5e-28
UNIPROTKB|B3NDN0623 dbo "Kelch-like protein diablo 0.548 0.117 0.808 1.5e-28
UNIPROTKB|B4HIK1623 dbo "Kelch-like protein diablo 0.548 0.117 0.808 1.5e-28
UNIPROTKB|B4PD06623 dbo "Kelch-like protein diablo 0.548 0.117 0.808 1.5e-28
UNIPROTKB|B0WWP2 dbo "Kelch-like protein diablo" [Culex quinquefasciatus (taxid:7176)] Back     alignment and assigned GO terms
 Score = 332 (121.9 bits), Expect = 1.9e-29, P = 1.9e-29
 Identities = 59/73 (80%), Positives = 68/73 (93%)

Query:    17 SVERFDPKLNRWTAMAPMSTRRKHLGCAVFNNVIYAVGGRDDSMELSSAEKYNPHTNTWL 76
             +VER+DP+ N+W A++PMSTRRKHLGCAVFNN IYAVGGRDD MELSSAE+YNPHTN+W 
Sbjct:   449 TVERYDPRQNKWCAVSPMSTRRKHLGCAVFNNFIYAVGGRDDCMELSSAERYNPHTNSWS 508

Query:    77 PIVAMTSRRSGLG 89
             PIVAMTSRRSG+G
Sbjct:   509 PIVAMTSRRSGVG 521
GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0016049 "cell growth" evidence=ISS
GO:0050807 "regulation of synapse organization" evidence=ISS
UNIPROTKB|Q7QGL0 dbo "Kelch-like protein diablo" [Anopheles gambiae (taxid:7165)] Back     alignment and assigned GO terms
UNIPROTKB|Q16RL8 dbo "Kelch-like protein diablo" [Aedes aegypti (taxid:7159)] Back     alignment and assigned GO terms
UNIPROTKB|B4GRJ2 dbo "Kelch-like protein diablo" [Drosophila persimilis (taxid:7234)] Back     alignment and assigned GO terms
UNIPROTKB|Q2M0J9 dbo "Kelch-like protein diablo" [Drosophila pseudoobscura pseudoobscura (taxid:46245)] Back     alignment and assigned GO terms
UNIPROTKB|B4QLQ2 dbo "Kelch-like protein diablo" [Drosophila simulans (taxid:7240)] Back     alignment and assigned GO terms
FB|FBgn0040230 dbo "diablo" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|B3NDN0 dbo "Kelch-like protein diablo" [Drosophila erecta (taxid:7220)] Back     alignment and assigned GO terms
UNIPROTKB|B4HIK1 dbo "Kelch-like protein diablo" [Drosophila sechellia (taxid:7238)] Back     alignment and assigned GO terms
UNIPROTKB|B4PD06 dbo "Kelch-like protein diablo" [Drosophila yakuba (taxid:7245)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q08DK3KLH20_BOVINNo assigned EC number0.71230.47360.1034yesN/A
Q9VUU5KLHDB_DROMENo assigned EC number0.80820.47360.1011yesN/A
Q5ZKD9KLH20_CHICKNo assigned EC number0.71230.54130.1180yesN/A
Q2M0J9KLHDB_DROPSNo assigned EC number0.80820.47360.1003yesN/A
Q7QGL0KLHDB_ANOGANo assigned EC number0.80820.47360.1082yesN/A
D3Z8N4KLH20_RATNo assigned EC number0.71230.47360.1034yesN/A
Q5R7B8KLH20_PONABNo assigned EC number0.71230.47360.1034yesN/A
Q8VCK5KLH20_MOUSENo assigned EC number0.71230.47360.1043yesN/A
Q9Y2M5KLH20_HUMANNo assigned EC number0.71230.47360.1034yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query133
pfam0134446 pfam01344, Kelch_1, Kelch motif 6e-12
smart0061247 smart00612, Kelch, Kelch domain 1e-10
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 5e-09
smart0061247 smart00612, Kelch, Kelch domain 2e-08
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 3e-08
PHA03098 534 PHA03098, PHA03098, kelch-like protein; Provisiona 2e-07
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 8e-06
pfam1396450 pfam13964, Kelch_6, Kelch motif 2e-05
PHA03098 534 PHA03098, PHA03098, kelch-like protein; Provisiona 3e-04
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 9e-04
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information 
 Score = 56.1 bits (136), Expect = 6e-12
 Identities = 19/46 (41%), Positives = 23/46 (50%)

Query: 37 RRKHLGCAVFNNVIYAVGGRDDSMELSSAEKYNPHTNTWLPIVAMT 82
           R   G  V    IY +GG D    LSS E Y+P TNTW  + +M 
Sbjct: 1  PRSGAGVVVLGGKIYVIGGYDGGQSLSSVEVYDPETNTWSKLPSMP 46

The kelch motif was initially discovered in Kelch. In this protein there are six copies of the motif. It has been shown that the Drosophila ring canal kelch protein is related to Galactose Oxidase, for which a structure has been solved. The kelch motif forms a beta sheet. Several of these sheets associate to form a beta propeller structure as found in pfam00064, pfam00400 and pfam00415. Length = 46
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 133
KOG4441|consensus571 99.96
KOG4441|consensus571 99.96
PHA02790480 Kelch-like protein; Provisional 99.94
PHA02713 557 hypothetical protein; Provisional 99.94
PHA02713557 hypothetical protein; Provisional 99.93
PLN02153 341 epithiospecifier protein 99.93
PHA03098534 kelch-like protein; Provisional 99.92
TIGR03548 323 mutarot_permut cyclically-permuted mutatrotase fam 99.91
PHA02790480 Kelch-like protein; Provisional 99.91
PHA03098 534 kelch-like protein; Provisional 99.91
PLN02193 470 nitrile-specifier protein 99.89
PLN02153 341 epithiospecifier protein 99.89
PLN02193 470 nitrile-specifier protein 99.88
TIGR03548 323 mutarot_permut cyclically-permuted mutatrotase fam 99.87
TIGR03547 346 muta_rot_YjhT mutatrotase, YjhT family. Members of 99.86
TIGR03547 346 muta_rot_YjhT mutatrotase, YjhT family. Members of 99.86
PRK14131 376 N-acetylneuraminic acid mutarotase; Provisional 99.84
KOG0379|consensus 482 99.82
PRK14131 376 N-acetylneuraminic acid mutarotase; Provisional 99.81
KOG4693|consensus 392 99.79
KOG1230|consensus 521 99.77
KOG0379|consensus 482 99.74
PF1396450 Kelch_6: Kelch motif 99.65
KOG4693|consensus 392 99.63
KOG1230|consensus 521 99.63
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 99.53
KOG4152|consensus 830 99.48
smart0061247 Kelch Kelch domain. 99.4
KOG4152|consensus 830 99.39
PF1341549 Kelch_3: Galactose oxidase, central domain 99.38
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 99.36
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 99.31
smart0061247 Kelch Kelch domain. 99.14
PF1341549 Kelch_3: Galactose oxidase, central domain 99.1
COG3055 381 Uncharacterized protein conserved in bacteria [Fun 99.07
PF1385442 Kelch_5: Kelch motif 98.94
PLN02772 398 guanylate kinase 98.94
KOG2437|consensus 723 98.75
PF1396450 Kelch_6: Kelch motif 98.75
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 98.74
COG3055 381 Uncharacterized protein conserved in bacteria [Fun 98.6
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.6
PF1385442 Kelch_5: Kelch motif 98.36
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.35
KOG2437|consensus 723 98.33
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.24
PLN02772 398 guanylate kinase 98.06
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 98.02
PF03089 337 RAG2: Recombination activating protein 2; InterPro 97.84
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 97.56
PF12768 281 Rax2: Cortical protein marker for cell polarity 97.34
PF07893 342 DUF1668: Protein of unknown function (DUF1668); In 97.19
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 96.35
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 95.94
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 95.31
PF03089337 RAG2: Recombination activating protein 2; InterPro 94.6
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 93.13
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 91.9
PF09910339 DUF2139: Uncharacterized protein conserved in arch 90.93
PF03178 321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 90.92
PF12768 281 Rax2: Cortical protein marker for cell polarity 90.67
PF07893 342 DUF1668: Protein of unknown function (DUF1668); In 90.15
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 89.44
PF08450 246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 89.14
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 87.45
TIGR03300 377 assembly_YfgL outer membrane assembly lipoprotein 86.56
PF05096 264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 86.38
KOG1036|consensus323 81.72
PF13360 238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 81.36
KOG0316|consensus 307 81.33
>KOG4441|consensus Back     alignment and domain information 
Probab=99.96  E-value=5.9e-29  Score=186.10  Aligned_cols=130  Identities=35%  Similarity=0.507  Sum_probs=119.1

Q ss_pred             ceecccccCCeeecEEEEEeCCCCceeecCCCcccccceEEEEECCEEEEEecCCCCC-ccCeEEEEeCCCCceeeCCCC
Q psy14436          3 EDFNHGYRELQLQVSVERFDPKLNRWTAMAPMSTRRKHLGCAVFNNVIYAVGGRDDSM-ELSSAEKYNPHTNTWLPIVAM   81 (133)
Q Consensus         3 ~~~~GG~~~~~~~~~~~~yd~~t~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~~-~~~~~~~yd~~~~~W~~~~~~   81 (133)
                      +...||.++...++++++|||.+++|..+++|+.+|.+|++++++++||++||.++.. .+.++++|||.+++|+.+++|
T Consensus       383 iYavGG~dg~~~l~svE~YDp~~~~W~~va~m~~~r~~~gv~~~~g~iYi~GG~~~~~~~l~sve~YDP~t~~W~~~~~M  462 (571)
T KOG4441|consen  383 LYAVGGFDGEKSLNSVECYDPVTNKWTPVAPMLTRRSGHGVAVLGGKLYIIGGGDGSSNCLNSVECYDPETNTWTLIAPM  462 (571)
T ss_pred             EEEEeccccccccccEEEecCCCCcccccCCCCcceeeeEEEEECCEEEEEcCcCCCccccceEEEEcCCCCceeecCCc
Confidence            3567999999999999999999999999999999999999999999999999988766 899999999999999999999


Q ss_pred             CCcccceeeEEeCCeeeeecCce--------------------------------------EEEEeCCCCccceeeeeee
Q psy14436         82 TSRRSGLGPGSLQLTLPTLTSVK--------------------------------------FTYIIPGDPAERLKFTREE  123 (133)
Q Consensus        82 ~~~r~~~~~~~~~~~iy~~gG~~--------------------------------------~~~v~gg~~~~~~~~~~~~  123 (133)
                      +.+|..+++++++++||++||..                                      .+|+.||..+..++..++.
T Consensus       463 ~~~R~~~g~a~~~~~iYvvGG~~~~~~~~~VE~ydp~~~~W~~v~~m~~~rs~~g~~~~~~~ly~vGG~~~~~~l~~ve~  542 (571)
T KOG4441|consen  463 NTRRSGFGVAVLNGKIYVVGGFDGTSALSSVERYDPETNQWTMVAPMTSPRSAVGVVVLGGKLYAVGGFDGNNNLNTVEC  542 (571)
T ss_pred             ccccccceEEEECCEEEEECCccCCCccceEEEEcCCCCceeEcccCccccccccEEEECCEEEEEecccCccccceeEE
Confidence            99999999999999999999842                                      5688888888888888888


Q ss_pred             ecCCCCCcc
Q psy14436        124 KEPPHMYWY  132 (133)
Q Consensus       124 ~~~~~~~W~  132 (133)
                      |||.++.|.
T Consensus       543 ydp~~d~W~  551 (571)
T KOG4441|consen  543 YDPETDTWT  551 (571)
T ss_pred             cCCCCCcee
Confidence            888888886

>KOG4441|consensus Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>KOG0379|consensus Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>KOG4693|consensus Back     alignment and domain information
>KOG1230|consensus Back     alignment and domain information
>KOG0379|consensus Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>KOG4693|consensus Back     alignment and domain information
>KOG1230|consensus Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>KOG2437|consensus Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>KOG2437|consensus Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF09910 DUF2139: Uncharacterized protein conserved in archaea (DUF2139); InterPro: IPR016675 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query133
2vpj_A301 Crystal Structure Of The Kelch Domain Of Human Klhl 4e-15
3vng_A309 Crystal Structure Of Keap1 In Complex With Syntheti 2e-14
1u6d_X308 Crystal Structure Of The Kelch Domain Of Human Keap 2e-14
2dyh_A318 Crystal Structure Of The Keap1 Protein In Complexed 1e-13
1x2j_A316 Structural Basis For The Defects Of Human Lung Canc 1e-13
2xn4_A302 Crystal Structure Of The Kelch Domain Of Human Klhl 1e-13
1zgk_A308 1.35 Angstrom Structure Of The Kelch Domain Of Keap 4e-13
4asc_A315 Crystal Structure Of The Kelch Domain Of Human Kbtb 2e-07
3ii7_A306 Crystal Structure Of The Kelch Domain Of Human Klhl 1e-05
2woz_A318 The Novel Beta-Propeller Of The Btb-Kelch Protein K 1e-04
>pdb|2VPJ|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl12 Length = 301 Back     alignment and structure 
Iteration: 1

 Score = 76.3 bits (186), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 62/124 (50%), Gaps = 9/124 (7%)
Query: 8   GYRELQLQVSVERFDPKLNRWTAMAPMSTRRKHLGCAVFNNVIYAVGGRDDSMELSSAEK 67
           GY  L +  SVE++DP    WT + PM+T+R   G A+ N+ IY VGG D +  LSS E 
Sbjct: 167 GYDGLNILNSVEKYDPHTGHWTNVTPMATKRSGAGVALLNDHIYVVGGFDGTAHLSSVEA 226
Query: 68  YNPHTNTWLPIVAMTSRRSGLGPGSLQLTLPTLTSVKFTYIIPGDPAERLKFTREEKEPP 127
           YN  T++W  + +MT+ R  +G   L+  L         Y I G     L  + E  +P 
Sbjct: 227 YNIRTDSWTTVTSMTTPRCYVGATVLRGRL---------YAIAGYDGNSLLSSIECYDPI 277
Query: 128 HMYW 131
              W
Sbjct: 278 IDSW 281
>pdb|3VNG|A Chain A, Crystal Structure Of Keap1 In Complex With Synthetic Small Molecular Based On A Co-crystallization Length = 309 Back     alignment and structure
>pdb|1U6D|X Chain X, Crystal Structure Of The Kelch Domain Of Human Keap1 Length = 308 Back     alignment and structure
>pdb|2DYH|A Chain A, Crystal Structure Of The Keap1 Protein In Complexed With The N-Terminal Region Of The Nrf2 Transcription Factor Length = 318 Back     alignment and structure
>pdb|1X2J|A Chain A, Structural Basis For The Defects Of Human Lung Cancer Somatic Mutations In The Repression Activity Of Keap1 On Nrf2 Length = 316 Back     alignment and structure
>pdb|2XN4|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl2 (mayven) Length = 302 Back     alignment and structure
>pdb|1ZGK|A Chain A, 1.35 Angstrom Structure Of The Kelch Domain Of Keap1 Length = 308 Back     alignment and structure
>pdb|4ASC|A Chain A, Crystal Structure Of The Kelch Domain Of Human Kbtbd5 Length = 315 Back     alignment and structure
>pdb|3II7|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl7 Length = 306 Back     alignment and structure
>pdb|2WOZ|A Chain A, The Novel Beta-Propeller Of The Btb-Kelch Protein Krp1 Provides The Binding Site For Lasp-1 That Is Necessary For Pseudopodia Extension Length = 318 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query133
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 2e-33
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 4e-30
2woz_A 318 Kelch repeat and BTB domain-containing protein 10; 2e-28
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 7e-24
2woz_A 318 Kelch repeat and BTB domain-containing protein 10; 5e-22
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 2e-06
2woz_A 318 Kelch repeat and BTB domain-containing protein 10; 4e-05
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 3e-33
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 6e-30
4asc_A 315 Kelch repeat and BTB domain-containing protein 5; 7e-29
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 1e-24
4asc_A 315 Kelch repeat and BTB domain-containing protein 5; 2e-22
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 5e-10
4asc_A 315 Kelch repeat and BTB domain-containing protein 5; 6e-06
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 3e-33
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 8e-32
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 2e-28
2vpj_A 301 Kelch-like protein 12; adaptor protein, WNT signal 2e-28
2vpj_A 301 Kelch-like protein 12; adaptor protein, WNT signal 5e-26
2vpj_A 301 Kelch-like protein 12; adaptor protein, WNT signal 2e-11
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 7e-09
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 7e-33
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 1e-30
1zgk_A 308 Kelch-like ECH-associated protein 1; beta-propelle 2e-30
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 7e-28
1zgk_A 308 Kelch-like ECH-associated protein 1; beta-propelle 1e-25
1zgk_A 308 Kelch-like ECH-associated protein 1; beta-propelle 1e-11
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 8e-08
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 7e-33
2xn4_A 302 Kelch-like protein 2; structural protein, cytoskel 3e-31
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 2e-30
2xn4_A 302 Kelch-like protein 2; structural protein, cytoskel 2e-29
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 2e-27
2xn4_A 302 Kelch-like protein 2; structural protein, cytoskel 4e-12
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 1e-07
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 4e-32
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 3e-30
3ii7_A 306 Kelch-like protein 7; protein-binding, kelch-repea 2e-29
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 1e-27
3ii7_A 306 Kelch-like protein 7; protein-binding, kelch-repea 7e-27
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 9e-09
3ii7_A 306 Kelch-like protein 7; protein-binding, kelch-repea 5e-07
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 3e-17
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 5e-14
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 3e-12
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 3e-10
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 2e-08
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 6e-07
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 1e-06
2zwa_A 695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 7e-09
2zwa_A 695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 2e-04
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 6e-08
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 4e-05
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 1e-04
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 5e-04
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
 Score =  117 bits (296), Expect = 2e-33
 Identities = 21/73 (28%), Positives = 31/73 (42%)

Query: 17  SVERFDPKLNRWTAMAPMSTRRKHLGCAVFNNVIYAVGGRDDSMELSSAEKYNPHTNTWL 76
            V  ++PK   W  +APM T R   G A+    I   GG  +    +S E ++  TN W 
Sbjct: 176 RVFIYNPKKGDWKDLAPMKTPRSMFGVAIHKGKIVIAGGVTEDGLSASVEAFDLKTNKWE 235

Query: 77  PIVAMTSRRSGLG 89
            +      RS + 
Sbjct: 236 VMTEFPQERSSIS 248
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query133
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 99.95
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 99.95
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 99.94
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 99.94
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 99.94
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 99.93
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 99.93
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 99.93
1zgk_A 308 Kelch-like ECH-associated protein 1; beta-propelle 99.93
2vpj_A 301 Kelch-like protein 12; adaptor protein, WNT signal 99.93
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 99.93
3ii7_A 306 Kelch-like protein 7; protein-binding, kelch-repea 99.93
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 99.9
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 99.89
2zwa_A 695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 99.89
2zwa_A 695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 99.86
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 99.81
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 99.79
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.17
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 96.81
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 96.41
2iwa_A 266 Glutamine cyclotransferase; pyroglutamate, acyltra 96.15
3mbr_X 243 Glutamine cyclotransferase; beta-propeller; 1.44A 95.2
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 94.17
3nol_A 262 Glutamine cyclotransferase; beta-propeller, glutam 94.14
3dsm_A 328 Uncharacterized protein bacuni_02894; seven_blated 93.39
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 93.02
2iwa_A 266 Glutamine cyclotransferase; pyroglutamate, acyltra 88.52
3hfq_A 347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 87.78
3q7m_A 376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 87.64
3jrp_A 379 Fusion protein of protein transport protein SEC13 87.42
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 87.37
4gga_A 420 P55CDC, cell division cycle protein 20 homolog; ce 86.33
3nok_A 268 Glutaminyl cyclase; beta-propeller, cyclotransfera 85.39
3jro_A 753 Fusion protein of protein transport protein SEC13 84.64
3scy_A 361 Hypothetical bacterial 6-phosphogluconolactonase; 82.94
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 82.89
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 82.71
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 82.31
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 82.24
1gxr_A 337 ESG1, transducin-like enhancer protein 1; transcri 81.45
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
Probab=99.95  E-value=3.3e-27  Score=163.54  Aligned_cols=130  Identities=32%  Similarity=0.538  Sum_probs=111.4

Q ss_pred             ceecccccCCeeecEEEEEeCCCCceeecCCCcccccceEEEEECCEEEEEecCCCCCccCeEEEEeCCCCceeeCCCCC
Q psy14436          3 EDFNHGYRELQLQVSVERFDPKLNRWTAMAPMSTRRKHLGCAVFNNVIYAVGGRDDSMELSSAEKYNPHTNTWLPIVAMT   82 (133)
Q Consensus         3 ~~~~GG~~~~~~~~~~~~yd~~t~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~yd~~~~~W~~~~~~~   82 (133)
                      .+++||..+...++++++||+.+++|.++++||.+|..|++++++++||++||.+.....+++++||+.+++|++++++|
T Consensus        64 lyv~GG~~~~~~~~~~~~~d~~~~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~d~~~~~W~~~~~~p  143 (302)
T 2xn4_A           64 VFAVGGFNGSLRVRTVDSYDPVKDQWTSVANMRDRRSTLGAAVLNGLLYAVGGFDGSTGLSSVEAYNIKSNEWFHVAPMN  143 (302)
T ss_dssp             EEEESCBCSSSBCCCEEEEETTTTEEEEECCCSSCCBSCEEEEETTEEEEEEEECSSCEEEEEEEEETTTTEEEEECCCS
T ss_pred             EEEEeCcCCCccccceEEECCCCCceeeCCCCCccccceEEEEECCEEEEEcCCCCCccCceEEEEeCCCCeEeecCCCC
Confidence            45678888777789999999999999999999999999999999999999999887667889999999999999999999


Q ss_pred             CcccceeeEEeCCeeeeecCce----------------------------------------EEEEeCCCCccceeeeee
Q psy14436         83 SRRSGLGPGSLQLTLPTLTSVK----------------------------------------FTYIIPGDPAERLKFTRE  122 (133)
Q Consensus        83 ~~r~~~~~~~~~~~iy~~gG~~----------------------------------------~~~v~gg~~~~~~~~~~~  122 (133)
                      .+|..+++++++++||++||..                                        .+|++||........+++
T Consensus       144 ~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~yd~~~~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~  223 (302)
T 2xn4_A          144 TRRSSVGVGVVGGLLYAVGGYDVASRQCLSTVECYNATTNEWTYIAEMSTRRSGAGVGVLNNLLYAVGGHDGPLVRKSVE  223 (302)
T ss_dssp             SCCBSCEEEEETTEEEEECCEETTTTEECCCEEEEETTTTEEEEECCCSSCCBSCEEEEETTEEEEECCBSSSSBCCCEE
T ss_pred             CcccCceEEEECCEEEEEeCCCCCCCccccEEEEEeCCCCcEEECCCCccccccccEEEECCEEEEECCCCCCcccceEE
Confidence            9999999999999998888752                                        456666655555555667


Q ss_pred             eecCCCCCcc
Q psy14436        123 EKEPPHMYWY  132 (133)
Q Consensus       123 ~~~~~~~~W~  132 (133)
                      .||+.++.|.
T Consensus       224 ~yd~~~~~W~  233 (302)
T 2xn4_A          224 VYDPTTNAWR  233 (302)
T ss_dssp             EEETTTTEEE
T ss_pred             EEeCCCCCEe
Confidence            7777776664
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 133
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 4e-14
d1zgka1 288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 1e-09
d1zgka1 288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 7e-06
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 7e-06
d1k3ia3 387 b.69.1.1 (A:151-537) Galactose oxidase, central do 3e-10
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 1e-08
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 2e-05
d1k3ia3 387 b.69.1.1 (A:151-537) Galactose oxidase, central do 2e-05
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure

class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 64.9 bits (156), Expect = 4e-14
 Identities = 37/83 (44%), Positives = 45/83 (54%)

Query: 7   HGYRELQLQVSVERFDPKLNRWTAMAPMSTRRKHLGCAVFNNVIYAVGGRDDSMELSSAE 66
            GY       SVER+D +   WT +APM  RR  LG  V    IY +GG D    L S E
Sbjct: 202 GGYDGQDQLNSVERYDVETETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVE 261

Query: 67  KYNPHTNTWLPIVAMTSRRSGLG 89
            Y+P T+TW  +  MTS RSG+G
Sbjct: 262 CYDPDTDTWSEVTRMTSGRSGVG 284
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query133
d1zgka1 288 Kelch-like ECH-associated protein 1, KEAP1 {Human 99.91
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 99.86
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.75
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 99.73
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 86.61
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 84.48
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 81.14
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.91  E-value=2.2e-24  Score=146.14  Aligned_cols=120  Identities=28%  Similarity=0.499  Sum_probs=103.1

Q ss_pred             ceecccccCCeeecEEEEEeCCCCceeecCCCcccccceEEEEECCEEEEEecCCC----CCccCeEEEEeCCCCceeeC
Q psy14436          3 EDFNHGYRELQLQVSVERFDPKLNRWTAMAPMSTRRKHLGCAVFNNVIYAVGGRDD----SMELSSAEKYNPHTNTWLPI   78 (133)
Q Consensus         3 ~~~~GG~~~~~~~~~~~~yd~~t~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~----~~~~~~~~~yd~~~~~W~~~   78 (133)
                      +.+.||... ..++++++||+++++|+++++||.+|..|++++++++||++||...    ....+++++||+.+++|+++
T Consensus         7 iyv~GG~~~-~~~~~~~~yd~~t~~W~~~~~~p~~R~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~yd~~~~~w~~~   85 (288)
T d1zgka1           7 IYTAGGYFR-QSLSYLEAYNPSNGTWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPC   85 (288)
T ss_dssp             EEEECCBSS-SBCCCEEEEETTTTEEEECCCCSSCCBSCEEEEETTEEEEECCEEEETTEEEECCCEEEEETTTTEEEEC
T ss_pred             EEEECCcCC-CCCceEEEEECCCCeEEECCCCCCccceeEEEEECCEEEEEeCcccCCCCccccchhhhccccccccccc
Confidence            457788764 4689999999999999999999999999999999999999999642    33467899999999999999


Q ss_pred             CCCCCcccceeeEEeCCeeeeecCceEEEEeCCCCccceeeeeeeecCCCCCcc
Q psy14436         79 VAMTSRRSGLGPGSLQLTLPTLTSVKFTYIIPGDPAERLKFTREEKEPPHMYWY  132 (133)
Q Consensus        79 ~~~~~~r~~~~~~~~~~~iy~~gG~~~~~v~gg~~~~~~~~~~~~~~~~~~~W~  132 (133)
                      ++||.+|..|+++++++++         |++||..........+.|++.+..|.
T Consensus        86 ~~~p~~r~~~~~~~~~~~i---------~~~gg~~~~~~~~~~~~~~~~~~~~~  130 (288)
T d1zgka1          86 APMSVPRNRIGVGVIDGHI---------YAVGGSHGCIHHNSVERYEPERDEWH  130 (288)
T ss_dssp             CCCSSCCBTCEEEEETTEE---------EEECCEETTEECCCEEEEETTTTEEE
T ss_pred             ccccceecceeccccceee---------EEecceecccccceeeeeccccCccc
Confidence            9999999999999999999         55666555566677888888888775
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure