Psyllid ID: psy14456


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90---
MHDGTVRDVCFIEDTSNKSSLLISGGAGDCKIYVTDCATGQAFQALSGHSGHVLSLYNWGGATVLSGSHDRTVRFWDLRTRGCTNVLTPITVP
cccccEEEEEEccccccccccEEEEccccccEEEEEcccccEEEccccccccEEEEEcccccEEEEccccccEEEEEcccccEEEEccccccc
cccccEEEEEEEcccccccEEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEcccccEEEEcccccEEEEEEcccccEEEEEcccccc
mhdgtvrdvcfiedtsnkssllisggagdckiyVTDCATGQafqalsghsghvlslynwggatvlsgshdrtvrfwdlrtrgctnvltpitvp
MHDGTVRDVCFIEDTSNKSSLLISGGAGDCKIYVTDCATGQAFQALSGHSGHVLSLYNWGGATVLSGSHDRTVRfwdlrtrgctnvltpitvp
MHDGTVRDVCFIEDTSNKSSLLISGGAGDCKIYVTDCATGQAFQALSGHSGHVLSLYNWGGATVLSGSHDRTVRFWDLRTRGCTNVLTPITVP
******RDVCFIEDTSNKSSLLISGGAGDCKIYVTDCATGQAFQALSGHSGHVLSLYNWGGATVLSGSHDRTVRFWDLRTRGCTNVLTPI***
MHDGTVRDVCFIEDTSNKSSLLISGGAGDCKIYVTDCATGQAFQALSGHSGHVLSLYNWGGATVLSGSHDRTVRFWDLRTRGCTNVLTP****
MHDGTVRDVCFIEDTSNKSSLLISGGAGDCKIYVTDCATGQAFQALSGHSGHVLSLYNWGGATVLSGSHDRTVRFWDLRTRGCTNVLTPITVP
****TVRDVCFIEDTSNKSSLLISGGAGDCKIYVTDCATGQAFQALSGHSGHVLSLYNWGGATVLSGSHDRTVRFWDLRTRGCTNVLTP****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHDGTVRDVCFIEDTSNKSSLLISGGAGDCKIYVTDCATGQAFQALSGHSGHVLSLYNWGGATVLSGSHDRTVRFWDLRTRGCTNVLTPITVP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query93 2.2.26 [Sep-21-2011]
Q8CGF6 920 WD repeat-containing prot yes N/A 0.935 0.094 0.574 7e-28
O94967 919 WD repeat-containing prot yes N/A 0.935 0.094 0.574 9e-28
Q8MY12780 Myosin heavy chain kinase yes N/A 0.838 0.1 0.360 2e-08
C4YFX2 511 Transcriptional repressor N/A N/A 0.870 0.158 0.379 5e-07
P0CY34 512 Transcriptional repressor N/A N/A 0.870 0.158 0.379 5e-07
Q3Y8L7 446 Outer row dynein assembly N/A N/A 0.774 0.161 0.383 6e-07
P16649 713 General transcriptional c yes N/A 0.870 0.113 0.379 2e-06
P56094 682 General transcriptional c yes N/A 0.870 0.118 0.379 2e-06
Q9V3J8 361 Protein will die slowly O no N/A 0.870 0.224 0.356 7e-06
Q00808 1356 Vegetative incompatibilit no N/A 0.870 0.059 0.356 7e-06
>sp|Q8CGF6|WDR47_MOUSE WD repeat-containing protein 47 OS=Mus musculus GN=Wdr47 PE=1 SV=2 Back     alignment and function desciption
 Score =  122 bits (306), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 50/87 (57%), Positives = 62/87 (71%)

Query: 1   MHDGTVRDVCFIEDTSNKSSLLISGGAGDCKIYVTDCATGQAFQALSGHSGHVLSLYNWG 60
           MHDGT+RD+ F+E   +  ++LIS GAGDC IY TDC  GQ   ALSGH+GH+L+LY W 
Sbjct: 707 MHDGTIRDLAFMEGPESGGAILISAGAGDCNIYTTDCQRGQGLHALSGHTGHILALYTWS 766

Query: 61  GATVLSGSHDRTVRFWDLRTRGCTNVL 87
           G  + SGS D+TVRFWDLR   C  V+
Sbjct: 767 GWMIASGSQDKTVRFWDLRVPSCVRVV 793





Mus musculus (taxid: 10090)
>sp|O94967|WDR47_HUMAN WD repeat-containing protein 47 OS=Homo sapiens GN=WDR47 PE=1 SV=1 Back     alignment and function description
>sp|Q8MY12|MHCKC_DICDI Myosin heavy chain kinase C OS=Dictyostelium discoideum GN=mhkC PE=1 SV=1 Back     alignment and function description
>sp|C4YFX2|TUP1_CANAW Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=4 SV=1 Back     alignment and function description
>sp|P0CY34|TUP1_CANAL Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=1 SV=1 Back     alignment and function description
>sp|Q3Y8L7|WDR69_CHLRE Outer row dynein assembly protein 16 OS=Chlamydomonas reinhardtii GN=ODA16 PE=1 SV=1 Back     alignment and function description
>sp|P16649|TUP1_YEAST General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2 Back     alignment and function description
>sp|P56094|TUP1_KLULA General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2 Back     alignment and function description
>sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=2 SV=1 Back     alignment and function description
>sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query93
383858427 955 PREDICTED: WD repeat-containing protein 1.0 0.097 0.849 2e-44
380013168 956 PREDICTED: LOW QUALITY PROTEIN: WD repea 1.0 0.097 0.849 2e-44
328776065 955 PREDICTED: WD repeat-containing protein 1.0 0.097 0.849 2e-44
340716254 955 PREDICTED: WD repeat-containing protein 1.0 0.097 0.849 2e-44
350406409 955 PREDICTED: WD repeat-containing protein 1.0 0.097 0.849 2e-44
270003148 490 hypothetical protein TcasGA2_TC001582 [T 1.0 0.189 0.817 8e-44
328704358 903 PREDICTED: WD repeat-containing protein 0.978 0.100 0.846 1e-43
332022047 966 WD repeat-containing protein 47 [Acromyr 1.0 0.096 0.827 3e-43
189235180 473 PREDICTED: similar to AGAP006113-PA, par 1.0 0.196 0.817 2e-41
307201082 330 WD repeat-containing protein 47 [Harpegn 1.0 0.281 0.849 2e-41
>gi|383858427|ref|XP_003704703.1| PREDICTED: WD repeat-containing protein 47-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  182 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 79/93 (84%), Positives = 86/93 (92%)

Query: 1   MHDGTVRDVCFIEDTSNKSSLLISGGAGDCKIYVTDCATGQAFQALSGHSGHVLSLYNWG 60
           MHDGTVRD+CF+EDTSNKSSLLISGGAGDCKIYVTDCATG  FQALSGHSGHVL+LYNWG
Sbjct: 738 MHDGTVRDLCFLEDTSNKSSLLISGGAGDCKIYVTDCATGTPFQALSGHSGHVLTLYNWG 797

Query: 61  GATVLSGSHDRTVRFWDLRTRGCTNVLTPITVP 93
           GA  +SGS D+TVRFWDLRTRGC N++TP TVP
Sbjct: 798 GAMFVSGSQDKTVRFWDLRTRGCVNMVTPATVP 830




Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|380013168|ref|XP_003690639.1| PREDICTED: LOW QUALITY PROTEIN: WD repeat-containing protein 47-like [Apis florea] Back     alignment and taxonomy information
>gi|328776065|ref|XP_394247.4| PREDICTED: WD repeat-containing protein 47-like [Apis mellifera] Back     alignment and taxonomy information
>gi|340716254|ref|XP_003396614.1| PREDICTED: WD repeat-containing protein 47-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350406409|ref|XP_003487763.1| PREDICTED: WD repeat-containing protein 47-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|270003148|gb|EEZ99595.1| hypothetical protein TcasGA2_TC001582 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|328704358|ref|XP_001949932.2| PREDICTED: WD repeat-containing protein 47-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|332022047|gb|EGI62373.1| WD repeat-containing protein 47 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|189235180|ref|XP_001810207.1| PREDICTED: similar to AGAP006113-PA, partial [Tribolium castaneum] Back     alignment and taxonomy information
>gi|307201082|gb|EFN81014.1| WD repeat-containing protein 47 [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query93
FB|FBgn0034931 348 CG2812 [Drosophila melanogaste 0.935 0.25 0.666 1.8e-30
UNIPROTKB|O94967 919 WDR47 "WD repeat-containing pr 0.935 0.094 0.574 6.3e-25
MGI|MGI:2139593 920 Wdr47 "WD repeat domain 47" [M 0.935 0.094 0.574 6.3e-25
WB|WBGene00019434 942 nmtn-1 [Caenorhabditis elegans 0.946 0.093 0.522 8.3e-22
DICTYBASE|DDB_G0290687780 mhkC "myosin heavy chain kinas 0.838 0.1 0.383 1.2e-08
POMBASE|SPBC713.04c 854 SPBC713.04c "U3 snoRNP-associa 0.860 0.093 0.341 7.3e-08
ASPGD|ASPL0000008575 618 AN6217 [Emericella nidulans (t 0.720 0.108 0.426 1.6e-07
FB|FBgn0040066 361 wds "will die slowly" [Drosoph 0.763 0.196 0.383 2.4e-07
CGD|CAL0005939 512 TUP1 [Candida albicans (taxid: 0.838 0.152 0.380 4.3e-07
UNIPROTKB|P0CY34 512 TUP1 "Transcriptional represso 0.838 0.152 0.380 4.3e-07
FB|FBgn0034931 CG2812 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 336 (123.3 bits), Expect = 1.8e-30, P = 1.8e-30
 Identities = 58/87 (66%), Positives = 69/87 (79%)

Query:     1 MHDGTVRDVCFIEDTSNKSSLLISGGAGDCKIYVTDCATGQAFQALSGHSGHVLSLYNWG 60
             MHDGTVRD+CF++D+S KS LL SGGAGDCKIY+TDC TG  FQA SGH+GH+LSLY+W 
Sbjct:   131 MHDGTVRDMCFLDDSSTKSRLLASGGAGDCKIYITDCGTGTPFQAYSGHTGHILSLYSWN 190

Query:    61 GATVLSGSHDRTVRFWDLRTRGCTNVL 87
              A  +SGS D+T+RFWDLR     N L
Sbjct:   191 NAMFVSGSQDQTIRFWDLRVNVSVNTL 217




GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0003674 "molecular_function" evidence=ND
UNIPROTKB|O94967 WDR47 "WD repeat-containing protein 47" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2139593 Wdr47 "WD repeat domain 47" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
WB|WBGene00019434 nmtn-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0290687 mhkC "myosin heavy chain kinase C" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
POMBASE|SPBC713.04c SPBC713.04c "U3 snoRNP-associated protein Utp1 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
ASPGD|ASPL0000008575 AN6217 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
FB|FBgn0040066 wds "will die slowly" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
CGD|CAL0005939 TUP1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|P0CY34 TUP1 "Transcriptional repressor TUP1" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8CGF6WDR47_MOUSENo assigned EC number0.57470.93540.0945yesN/A
O94967WDR47_HUMANNo assigned EC number0.57470.93540.0946yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query93
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 6e-11
cd00200 289 cd00200, WD40, WD40 domain, found in a number of e 8e-10
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 5e-09
cd00200 289 cd00200, WD40, WD40 domain, found in a number of e 2e-08
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 6e-08
cd00200 289 cd00200, WD40, WD40 domain, found in a number of e 1e-07
COG2319 466 COG2319, COG2319, FOG: WD40 repeat [General functi 3e-07
COG2319 466 COG2319, COG2319, FOG: WD40 repeat [General functi 1e-05
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-04
COG2319 466 COG2319, COG2319, FOG: WD40 repeat [General functi 8e-04
smart0032040 smart00320, WD40, WD40 repeats 0.001
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 0.002
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 0.004
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
 Score = 56.2 bits (136), Expect = 6e-11
 Identities = 33/88 (37%), Positives = 43/88 (48%), Gaps = 6/88 (6%)

Query: 2   HDGTVRDVCFIEDTSNKSSLLISGGAGDCKIYVTDCATGQAFQALSGHSGHVLSL-YNWG 60
           H G V  V F  D      LL S   G  K++  D +TG+    L GH   V S+ ++  
Sbjct: 176 HTGEVNSVAFSPD---GEKLLSSSSDGTIKLW--DLSTGKCLGTLRGHENGVNSVAFSPD 230

Query: 61  GATVLSGSHDRTVRFWDLRTRGCTNVLT 88
           G  + SGS D T+R WDLRT  C   L+
Sbjct: 231 GYLLASGSEDGTIRVWDLRTGECVQTLS 258


Length = 289

>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 93
KOG0272|consensus459 99.83
KOG0271|consensus 480 99.82
KOG0263|consensus707 99.8
KOG0295|consensus406 99.8
KOG0266|consensus 456 99.78
PTZ00421 493 coronin; Provisional 99.77
KOG0266|consensus 456 99.76
KOG0279|consensus315 99.75
KOG0271|consensus 480 99.75
KOG0286|consensus343 99.75
KOG0286|consensus 343 99.73
KOG0285|consensus 460 99.73
KOG0272|consensus459 99.72
PTZ00421 493 coronin; Provisional 99.71
KOG0284|consensus 464 99.71
PTZ00420 568 coronin; Provisional 99.71
KOG0316|consensus 307 99.7
KOG0319|consensus 775 99.7
KOG0285|consensus 460 99.7
KOG0291|consensus 893 99.7
KOG0319|consensus 775 99.69
KOG0263|consensus 707 99.69
KOG0302|consensus440 99.69
KOG0284|consensus 464 99.68
KOG0265|consensus 338 99.68
KOG0282|consensus 503 99.68
KOG0292|consensus 1202 99.68
KOG0273|consensus524 99.68
KOG0318|consensus 603 99.67
KOG0315|consensus311 99.67
KOG0265|consensus 338 99.65
KOG0273|consensus524 99.62
KOG0283|consensus 712 99.62
PTZ00420 568 coronin; Provisional 99.61
KOG0264|consensus422 99.61
KOG0264|consensus 422 99.6
KOG0276|consensus 794 99.6
KOG0289|consensus506 99.6
KOG0303|consensus 472 99.59
KOG0296|consensus 399 99.59
KOG0275|consensus 508 99.59
KOG0281|consensus 499 99.58
KOG0647|consensus 347 99.58
KOG0279|consensus 315 99.58
KOG0275|consensus 508 99.58
KOG0295|consensus 406 99.57
KOG1273|consensus 405 99.56
KOG1034|consensus 385 99.56
KOG0643|consensus 327 99.56
KOG0315|consensus 311 99.55
KOG0277|consensus 311 99.55
KOG0308|consensus 735 99.54
KOG0645|consensus 312 99.54
KOG0281|consensus499 99.54
cd00200 289 WD40 WD40 domain, found in a number of eukaryotic 99.54
KOG0647|consensus 347 99.52
PLN00181 793 protein SPA1-RELATED; Provisional 99.52
KOG0316|consensus 307 99.51
KOG1407|consensus313 99.51
KOG0310|consensus 487 99.51
KOG0269|consensus 839 99.51
KOG0313|consensus423 99.51
KOG0274|consensus 537 99.51
KOG0274|consensus 537 99.5
KOG0282|consensus 503 99.5
KOG0641|consensus 350 99.5
KOG0291|consensus 893 99.49
KOG0277|consensus311 99.49
KOG0276|consensus 794 99.49
KOG0640|consensus430 99.49
KOG0294|consensus 362 99.48
KOG0283|consensus 712 99.48
KOG0973|consensus 942 99.47
KOG0292|consensus 1202 99.47
KOG0306|consensus 888 99.47
KOG0294|consensus 362 99.46
PLN00181 793 protein SPA1-RELATED; Provisional 99.45
KOG0645|consensus 312 99.45
KOG0305|consensus484 99.45
KOG0303|consensus 472 99.45
KOG0649|consensus 325 99.44
KOG0639|consensus 705 99.43
KOG0278|consensus334 99.43
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.43
KOG1407|consensus313 99.42
KOG2394|consensus 636 99.42
KOG0296|consensus 399 99.42
KOG0299|consensus 479 99.41
KOG0302|consensus440 99.41
KOG1539|consensus 910 99.41
KOG1445|consensus 1012 99.41
KOG0973|consensus 942 99.41
KOG1034|consensus 385 99.4
KOG0289|consensus 506 99.39
KOG0270|consensus 463 99.39
KOG0267|consensus 825 99.39
KOG0640|consensus 430 99.39
KOG1446|consensus 311 99.39
KOG0772|consensus 641 99.38
KOG0318|consensus603 99.38
KOG1009|consensus 434 99.38
KOG0293|consensus519 99.37
KOG0269|consensus 839 99.35
KOG0293|consensus 519 99.35
KOG0305|consensus 484 99.33
KOG0290|consensus364 99.33
KOG4283|consensus 397 99.33
KOG4283|consensus 397 99.32
KOG0646|consensus 476 99.3
KOG0267|consensus 825 99.3
KOG0278|consensus 334 99.29
KOG0306|consensus 888 99.28
KOG0313|consensus423 99.27
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.27
KOG1036|consensus 323 99.25
KOG1007|consensus370 99.24
KOG0288|consensus 459 99.24
KOG0643|consensus327 99.23
KOG0301|consensus 745 99.23
KOG0310|consensus 487 99.22
KOG2111|consensus346 99.22
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 99.22
KOG4328|consensus 498 99.19
KOG3914|consensus 390 99.17
KOG0771|consensus 398 99.16
KOG1445|consensus 1012 99.16
KOG0308|consensus 735 99.15
KOG1274|consensus 933 99.15
KOG0321|consensus 720 99.15
KOG0646|consensus 476 99.14
KOG1007|consensus 370 99.14
KOG1446|consensus311 99.14
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.14
KOG1539|consensus 910 99.14
KOG1538|consensus 1081 99.13
KOG0772|consensus 641 99.13
KOG0301|consensus 745 99.13
KOG0322|consensus323 99.13
KOG0300|consensus481 99.13
KOG2110|consensus 391 99.1
KOG0288|consensus459 99.1
KOG0641|consensus350 99.09
KOG1332|consensus 299 99.09
KOG1272|consensus 545 99.08
KOG0300|consensus 481 99.08
KOG1310|consensus 758 99.08
KOG2110|consensus 391 99.07
KOG0644|consensus 1113 99.06
KOG0290|consensus 364 99.05
KOG2394|consensus 636 99.05
KOG0299|consensus 479 99.04
KOG2445|consensus 361 99.02
KOG0268|consensus 433 99.02
KOG0321|consensus 720 99.01
KOG0642|consensus 577 99.0
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 98.99
KOG1332|consensus299 98.98
KOG0268|consensus433 98.98
KOG4378|consensus 673 98.97
KOG1063|consensus 764 98.97
KOG2919|consensus406 98.96
KOG0639|consensus 705 98.94
KOG1408|consensus 1080 98.94
KOG4328|consensus498 98.93
KOG2096|consensus 420 98.93
KOG1274|consensus 933 98.92
KOG0307|consensus 1049 98.91
KOG0307|consensus 1049 98.91
KOG1009|consensus 434 98.91
COG2319 466 FOG: WD40 repeat [General function prediction only 98.9
KOG0642|consensus 577 98.89
KOG2445|consensus361 98.89
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.89
KOG1188|consensus 376 98.88
TIGR03866 300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 98.88
KOG1408|consensus 1080 98.87
KOG2048|consensus 691 98.85
KOG1188|consensus 376 98.85
KOG1524|consensus 737 98.83
KOG1063|consensus 764 98.83
KOG4227|consensus 609 98.83
KOG2919|consensus 406 98.82
KOG4714|consensus319 98.82
KOG1273|consensus 405 98.82
KOG4378|consensus 673 98.8
KOG2055|consensus514 98.8
KOG4547|consensus 541 98.8
KOG0270|consensus463 98.77
KOG0650|consensus 733 98.76
KOG1036|consensus323 98.75
KOG3881|consensus412 98.75
KOG0280|consensus339 98.72
KOG2048|consensus 691 98.69
KOG1963|consensus 792 98.69
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 98.69
KOG0974|consensus 967 98.68
KOG2139|consensus 445 98.68
KOG2695|consensus425 98.67
KOG1587|consensus555 98.66
KOG0649|consensus 325 98.65
KOG2096|consensus420 98.64
KOG2106|consensus 626 98.61
KOG1310|consensus 758 98.61
KOG1587|consensus 555 98.6
KOG0644|consensus 1113 98.57
KOG1963|consensus 792 98.57
KOG2055|consensus 514 98.57
KOG2111|consensus 346 98.56
KOG1523|consensus 361 98.55
COG2319 466 FOG: WD40 repeat [General function prediction only 98.55
KOG4227|consensus 609 98.51
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.51
KOG0771|consensus398 98.49
KOG2321|consensus 703 98.49
KOG2139|consensus 445 98.46
KOG0650|consensus 733 98.44
KOG1409|consensus 404 98.42
KOG0974|consensus 967 98.36
KOG1272|consensus 545 98.34
KOG1523|consensus 361 98.33
smart0032040 WD40 WD40 repeats. Note that these repeats are per 98.33
KOG2106|consensus 626 98.32
KOG1240|consensus 1431 98.3
KOG1538|consensus 1081 98.23
KOG2695|consensus425 98.21
KOG0322|consensus323 98.2
KOG1334|consensus559 98.13
KOG1524|consensus 737 98.13
KOG2315|consensus 566 98.11
KOG1064|consensus2439 98.09
KOG0280|consensus 339 98.09
PRK01742 429 tolB translocation protein TolB; Provisional 98.06
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.05
KOG4640|consensus 665 98.04
PRK05137 435 tolB translocation protein TolB; Provisional 98.04
KOG1645|consensus 463 98.04
KOG3881|consensus 412 98.04
KOG4497|consensus 447 98.0
KOG2315|consensus 566 97.99
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 97.97
KOG1517|consensus1387 97.97
PRK11028 330 6-phosphogluconolactonase; Provisional 97.97
PRK01742429 tolB translocation protein TolB; Provisional 97.95
KOG1064|consensus2439 97.94
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.94
KOG2041|consensus 1189 97.9
KOG1275|consensus 1118 97.87
KOG4190|consensus 1034 97.86
KOG1240|consensus 1431 97.79
KOG1517|consensus 1387 97.78
KOG1912|consensus 1062 97.77
KOG4547|consensus 541 97.76
KOG4532|consensus344 97.71
PRK02889 427 tolB translocation protein TolB; Provisional 97.7
PRK11028330 6-phosphogluconolactonase; Provisional 97.69
PRK05137435 tolB translocation protein TolB; Provisional 97.67
PRK03629429 tolB translocation protein TolB; Provisional 97.66
PRK04922 433 tolB translocation protein TolB; Provisional 97.65
PRK00178 430 tolB translocation protein TolB; Provisional 97.65
KOG1409|consensus 404 97.65
PRK03629 429 tolB translocation protein TolB; Provisional 97.65
PRK02889427 tolB translocation protein TolB; Provisional 97.59
KOG0882|consensus 558 97.55
TIGR02658 352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 97.53
PRK04922433 tolB translocation protein TolB; Provisional 97.5
TIGR02800 417 propeller_TolB tol-pal system beta propeller repea 97.49
PRK01029428 tolB translocation protein TolB; Provisional 97.4
KOG2079|consensus 1206 97.38
COG4946 668 Uncharacterized protein related to the periplasmic 97.35
KOG0309|consensus 1081 97.33
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 97.3
PRK01029428 tolB translocation protein TolB; Provisional 97.29
KOG4532|consensus344 97.29
KOG1912|consensus 1062 97.28
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 97.28
PRK04792 448 tolB translocation protein TolB; Provisional 97.27
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 97.23
KOG2321|consensus 703 97.22
KOG3617|consensus 1416 97.21
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 97.17
PRK00178430 tolB translocation protein TolB; Provisional 97.16
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 97.15
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 97.11
PRK04792448 tolB translocation protein TolB; Provisional 97.11
KOG4190|consensus 1034 97.07
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 97.05
KOG1832|consensus 1516 97.04
KOG2079|consensus 1206 97.01
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 96.9
KOG4497|consensus 447 96.88
KOG1334|consensus 559 96.85
KOG4714|consensus319 96.81
KOG1354|consensus 433 96.8
KOG2314|consensus 698 96.8
PRK02888 635 nitrous-oxide reductase; Validated 96.73
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 96.67
KOG0309|consensus 1081 96.67
COG2706 346 3-carboxymuconate cyclase [Carbohydrate transport 96.62
KOG0882|consensus 558 96.58
KOG2041|consensus 1189 96.58
KOG3621|consensus 726 96.57
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 96.38
KOG4640|consensus 665 96.33
KOG1354|consensus 433 96.32
KOG4649|consensus 354 96.27
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 95.94
PF15492 282 Nbas_N: Neuroblastoma-amplified sequence, N termin 95.87
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 95.85
KOG3914|consensus 390 95.81
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 95.76
COG4946 668 Uncharacterized protein related to the periplasmic 95.69
COG5170 460 CDC55 Serine/threonine protein phosphatase 2A, reg 95.63
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 95.51
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 95.47
KOG2444|consensus238 95.29
PF10282 345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 95.21
KOG2314|consensus 698 94.86
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 94.78
PRK04043419 tolB translocation protein TolB; Provisional 94.58
PF11715 547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 94.53
PF08553 794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 94.32
PF08596 395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 94.22
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 94.21
PRK04043 419 tolB translocation protein TolB; Provisional 94.21
PF13360 238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 94.08
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.08
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 93.85
COG5170 460 CDC55 Serine/threonine protein phosphatase 2A, reg 93.66
PF11715 547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 93.56
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 93.29
COG0823425 TolB Periplasmic component of the Tol biopolymer t 93.19
PF13360 238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 93.16
KOG1832|consensus 1516 93.16
TIGR03300 377 assembly_YfgL outer membrane assembly lipoprotein 93.12
KOG1645|consensus 463 92.86
KOG2066|consensus 846 92.69
PF07433 305 DUF1513: Protein of unknown function (DUF1513); In 92.05
KOG1275|consensus 1118 91.97
KOG2066|consensus 846 91.92
KOG2444|consensus238 91.76
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 91.63
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 91.55
PF00930 353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 91.43
COG2706 346 3-carboxymuconate cyclase [Carbohydrate transport 91.04
KOG2114|consensus 933 90.69
PF07569 219 Hira: TUP1-like enhancer of split; InterPro: IPR01 90.5
KOG3621|consensus 726 89.7
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 89.65
PF14583 386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 89.19
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 88.94
KOG2395|consensus 644 88.92
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 88.61
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 88.52
KOG4499|consensus310 87.93
COG0823425 TolB Periplasmic component of the Tol biopolymer t 87.37
PF07569 219 Hira: TUP1-like enhancer of split; InterPro: IPR01 86.98
PF02897 414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 86.97
smart0056433 PQQ beta-propeller repeat. Beta-propeller repeat o 86.14
PF00930 353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 85.74
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 85.3
COG3204 316 Uncharacterized protein conserved in bacteria [Fun 85.01
PF12768 281 Rax2: Cortical protein marker for cell polarity 83.89
PRK02888 635 nitrous-oxide reductase; Validated 83.87
COG3386307 Gluconolactonase [Carbohydrate transport and metab 83.31
KOG1008|consensus 783 83.16
cd00216 488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 82.34
PF0101138 PQQ: PQQ enzyme repeat family.; InterPro: IPR00237 82.34
KOG1008|consensus 783 82.02
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 81.95
PF06977 248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 81.43
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 80.8
KOG1920|consensus 1265 80.24
PF03178 321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 80.2
>KOG0272|consensus Back     alignment and domain information
Probab=99.83  E-value=3.6e-20  Score=106.95  Aligned_cols=85  Identities=33%  Similarity=0.493  Sum_probs=80.0

Q ss_pred             CccceeEEEEEecCCCCcceEEEeeeCCCeEEEEeCCCCceeEEeeccccceEEE-EecCCCEEEEecCCCcEEEEeCCC
Q psy14456          2 HDGTVRDVCFIEDTSNKSSLLISGGAGDCKIYVTDCATGQAFQALSGHSGHVLSL-YNWGGATVLSGSHDRTVRFWDLRT   80 (93)
Q Consensus         2 h~~~v~~~~~~~~~~~~~~~~~~~g~~~~~v~~~~~~~~~~~~~~~~~~~~v~~~-~~~~~~~~~s~~~~~~i~~~d~~~   80 (93)
                      |...|.+++|+|+    ++.++++|. |..-++||++++.++-.+.+|..+|..+ |+|.|..++||+.|.++++||++.
T Consensus       302 Hs~~v~~iaf~~D----GSL~~tGGl-D~~~RvWDlRtgr~im~L~gH~k~I~~V~fsPNGy~lATgs~Dnt~kVWDLR~  376 (459)
T KOG0272|consen  302 HSKGVFSIAFQPD----GSLAATGGL-DSLGRVWDLRTGRCIMFLAGHIKEILSVAFSPNGYHLATGSSDNTCKVWDLRM  376 (459)
T ss_pred             cccccceeEecCC----CceeeccCc-cchhheeecccCcEEEEecccccceeeEeECCCceEEeecCCCCcEEEeeecc
Confidence            7789999999999    788888885 9999999999999999999999999999 999999999999999999999999


Q ss_pred             CceeeEecCcc
Q psy14456         81 RGCTNVLTPIT   91 (93)
Q Consensus        81 ~~~~~~~~~~~   91 (93)
                      ..++..+.+|.
T Consensus       377 r~~ly~ipAH~  387 (459)
T KOG0272|consen  377 RSELYTIPAHS  387 (459)
T ss_pred             cccceeccccc
Confidence            99998888874



>KOG0271|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>smart00564 PQQ beta-propeller repeat Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF01011 PQQ: PQQ enzyme repeat family Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query93
1erj_A 393 Crystal Structure Of The C-Terminal Wd40 Domain Of 1e-07
1nex_B 464 Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Comp 1e-06
3mks_B 464 Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH 1e-06
2gnq_A 336 Structure Of Wdr5 Length = 336 4e-06
2h13_A 317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 4e-06
2h68_A 312 Histone H3 Recognition And Presentation By The Wdr5 5e-06
4a7j_A 318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 5e-06
2h9l_A 329 Wdr5delta23 Length = 329 5e-06
3psl_A 318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 5e-06
2h9m_A 313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 5e-06
3emh_A 318 Structural Basis Of Wdr5-Mll Interaction Length = 3 5e-06
3smr_A 312 Crystal Structure Of Human Wd Repeat Domain 5 With 5e-06
2g99_A 308 Structural Basis For The Specific Recognition Of Me 5e-06
3mxx_A 315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 5e-06
2g9a_A 311 Structural Basis For The Specific Recognition Of Me 5e-06
3n0e_A 315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 5e-06
3n0d_A 315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 5e-06
2xl2_A 334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 6e-06
2co0_A 315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 7e-06
2cnx_A 315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 7e-06
1vyh_C410 Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 3e-05
2ovp_B 445 Structure Of The Skp1-Fbw7 Complex Length = 445 5e-05
3mmy_A 368 Structural And Functional Analysis Of The Interacti 2e-04
1p22_A 435 Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex 8e-04
>pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393 Back     alignment and structure

Iteration: 1

Score = 51.2 bits (121), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 33/87 (37%), Positives = 43/87 (49%), Gaps = 6/87 (6%) Query: 3 DGTVRDVCFIEDTSNKSSLLISGGAGDCKIYVTDCATGQAFQALSGHSGHVLSL-YNWGG 61 D +R VCF D ++ GA D I + D + L GH + SL Y G Sbjct: 123 DLYIRSVCFSPDGK-----FLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSG 177 Query: 62 ATVLSGSHDRTVRFWDLRTRGCTNVLT 88 ++SGS DRTVR WDLRT C+ L+ Sbjct: 178 DKLVSGSGDRTVRIWDLRTGQCSLTLS 204
>pdb|1NEX|B Chain B, Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Complex Length = 464 Back     alignment and structure
>pdb|3MKS|B Chain B, Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH AN ALLOSTERIC Inhibitor Scf-I2 Length = 464 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|1VYH|C Chain C, Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 Back     alignment and structure
>pdb|2OVP|B Chain B, Structure Of The Skp1-Fbw7 Complex Length = 445 Back     alignment and structure
>pdb|3MMY|A Chain A, Structural And Functional Analysis Of The Interaction Between The Nucleoporin Nup98 And The Mrna Export Factor Rae1 Length = 368 Back     alignment and structure
>pdb|1P22|A Chain A, Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex: Destruction Motif Binding And Lysine Specificity On The Scfbeta-Trcp1 Ubiquitin Ligase Length = 435 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query93
2ynn_A 304 Coatomer subunit beta'; protein transport, peptide 99.82
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.81
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.8
1vyh_C 410 Platelet-activating factor acetylhydrolase IB alph 99.8
2ymu_A 577 WD-40 repeat protein; unknown function, two domain 99.8
4gqb_B 344 Methylosome protein 50; TIM barrel, beta-propeller 99.79
1vyh_C 410 Platelet-activating factor acetylhydrolase IB alph 99.78
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 99.78
2ynn_A 304 Coatomer subunit beta'; protein transport, peptide 99.78
4gqb_B 344 Methylosome protein 50; TIM barrel, beta-propeller 99.78
3frx_A 319 Guanine nucleotide-binding protein subunit beta- l 99.78
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 99.78
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.77
3frx_A 319 Guanine nucleotide-binding protein subunit beta- l 99.77
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.76
2pbi_B 354 Guanine nucleotide-binding protein subunit beta 5; 99.75
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 99.75
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 99.75
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.74
2xzm_R 343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.74
2pm7_B 297 Protein transport protein SEC13, protein transport 99.74
2hes_X 330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.74
3bg1_A 316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.74
1got_B 340 GT-beta; complex (GTP-binding/transducer), G prote 99.74
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 99.73
4aow_A 340 Guanine nucleotide-binding protein subunit beta-2; 99.73
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 99.73
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 99.73
2xzm_R 343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.73
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 99.73
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.73
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 99.72
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.72
2hes_X 330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.72
3dm0_A 694 Maltose-binding periplasmic protein fused with RAC 99.72
4ggc_A 318 P55CDC, cell division cycle protein 20 homolog; ce 99.72
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.72
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.72
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.72
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 99.71
4gq1_A 393 NUP37; propeller, transport protein; 2.40A {Schizo 99.71
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.71
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.71
4g56_B 357 MGC81050 protein; protein arginine methyltransfera 99.71
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.7
4g56_B 357 MGC81050 protein; protein arginine methyltransfera 99.7
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.7
3jrp_A 379 Fusion protein of protein transport protein SEC13 99.7
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.69
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.69
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.69
3iz6_a 380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.69
3lrv_A 343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.69
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 99.68
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.68
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.67
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 99.66
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.66
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.66
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.66
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.66
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.65
4gga_A 420 P55CDC, cell division cycle protein 20 homolog; ce 99.65
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.65
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 99.65
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.65
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.65
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 99.65
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.64
3i2n_A 357 WD repeat-containing protein 92; WD40 repeats, str 99.64
1r5m_A 425 SIR4-interacting protein SIF2; transcription corep 99.63
1gxr_A 337 ESG1, transducin-like enhancer protein 1; transcri 99.63
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 99.63
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.63
3odt_A 313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.63
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.63
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.63
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.63
3jro_A 753 Fusion protein of protein transport protein SEC13 99.62
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 99.62
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 99.62
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.62
1gxr_A 337 ESG1, transducin-like enhancer protein 1; transcri 99.61
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 99.61
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.61
2pm7_B 297 Protein transport protein SEC13, protein transport 99.61
1yfq_A 342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.61
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.61
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 99.61
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.61
3v7d_B 464 Cell division control protein 4; WD 40 domain, pho 99.6
3v7d_B 464 Cell division control protein 4; WD 40 domain, pho 99.6
2xyi_A 430 Probable histone-binding protein CAF1; transcripti 99.6
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.6
3bg1_A 316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.6
2pm9_A 416 Protein WEB1, protein transport protein SEC31; bet 99.6
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.6
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.59
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.59
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 99.59
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 99.58
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.58
4aez_A 401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.58
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.57
2j04_B 524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.57
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.57
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.57
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 99.56
4aez_A 401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.56
3jrp_A 379 Fusion protein of protein transport protein SEC13 99.55
2j04_B 524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.55
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.55
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.54
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.54
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.53
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.53
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.53
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.52
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.52
4gq1_A 393 NUP37; propeller, transport protein; 2.40A {Schizo 99.52
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.51
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.5
3vu4_A 355 KMHSV2; beta-propeller fold, protein transport; 2. 99.48
3jro_A 753 Fusion protein of protein transport protein SEC13 99.47
3bws_A 433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.39
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.36
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.33
3bws_A 433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.26
2hqs_A 415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.21
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.05
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.03
2hqs_A 415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.02
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 99.0
3u4y_A 331 Uncharacterized protein; structural genomics, PSI- 98.98
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 98.98
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 98.89
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 98.88
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 98.88
3vgz_A 353 Uncharacterized protein YNCE; beta-propeller, prot 98.88
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 98.87
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 98.85
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 98.84
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 98.84
1pby_B 337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 98.82
2ojh_A 297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 98.79
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 98.76
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 98.75
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 98.73
3pe7_A 388 Oligogalacturonate lyase; seven-bladed beta-propel 98.73
3u4y_A 331 Uncharacterized protein; structural genomics, PSI- 98.72
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 98.69
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 98.69
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 98.63
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 98.63
3hfq_A 347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 98.62
3scy_A 361 Hypothetical bacterial 6-phosphogluconolactonase; 98.61
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 98.61
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 98.61
1k32_A 1045 Tricorn protease; protein degradation, substrate g 98.6
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 98.54
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 98.53
3e5z_A 296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 98.48
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 98.42
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 98.4
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 98.38
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 98.36
3c5m_A 396 Oligogalacturonate lyase; blade-shaped beta-propel 98.36
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 98.35
1jof_A 365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 98.35
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 98.34
2gop_A 347 Trilobed protease; beta propeller, open velcro, hy 98.33
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 98.3
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 98.26
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 98.23
2oiz_A 361 Aromatic amine dehydrogenase, large subunit; oxido 98.23
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 98.2
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 98.18
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 98.17
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 98.16
3fvz_A 329 Peptidyl-glycine alpha-amidating monooxygenase; be 98.14
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 98.11
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 98.06
3no2_A 276 Uncharacterized protein; six-bladed beta-propeller 97.98
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 97.97
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 97.95
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 97.91
3pe7_A 388 Oligogalacturonate lyase; seven-bladed beta-propel 97.91
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 97.9
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 97.89
3sjl_D 386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 97.88
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 97.84
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 97.83
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 97.81
3dsm_A 328 Uncharacterized protein bacuni_02894; seven_blated 97.78
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 97.75
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 97.74
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 97.73
2mad_H 373 Methylamine dehydrogenase (heavy subunit); oxidore 97.72
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 97.72
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 97.72
3c5m_A 396 Oligogalacturonate lyase; blade-shaped beta-propel 97.71
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 97.62
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 97.61
2gop_A 347 Trilobed protease; beta propeller, open velcro, hy 97.54
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 97.54
3c75_H 426 MADH, methylamine dehydrogenase heavy chain; coppe 97.47
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 97.4
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 97.37
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 97.31
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 97.28
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 97.27
3dsm_A 328 Uncharacterized protein bacuni_02894; seven_blated 97.26
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 97.25
2qe8_A 343 Uncharacterized protein; structural genomics, join 97.17
3hrp_A 409 Uncharacterized protein; NP_812590.1, structural g 97.11
1mda_H 368 Methylamine dehydrogenase (heavy subunit); electro 97.05
3dr2_A 305 Exported gluconolactonase; gluconolactonase SMP-30 96.96
3g4e_A 297 Regucalcin; six bladed beta-propeller, gluconolcat 96.88
3nok_A 268 Glutaminyl cyclase; beta-propeller, cyclotransfera 96.87
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 96.78
2z2n_A 299 Virginiamycin B lyase; seven-bladed beta-propeller 96.75
2ghs_A 326 AGR_C_1268P; regucalcin, structural genomics, join 96.59
2z2n_A 299 Virginiamycin B lyase; seven-bladed beta-propeller 96.58
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 96.56
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 96.48
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 96.39
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 96.37
3nol_A 262 Glutamine cyclotransferase; beta-propeller, glutam 96.36
2ece_A 462 462AA long hypothetical selenium-binding protein; 96.33
2qe8_A 343 Uncharacterized protein; structural genomics, join 96.32
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 96.29
2iwa_A 266 Glutamine cyclotransferase; pyroglutamate, acyltra 96.25
2ece_A 462 462AA long hypothetical selenium-binding protein; 96.1
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 95.94
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 95.82
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 95.71
2qc5_A 300 Streptogramin B lactonase; beta propeller, lyase; 95.67
2qc5_A 300 Streptogramin B lactonase; beta propeller, lyase; 95.6
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 95.42
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 95.32
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 95.28
3qqz_A 255 Putative uncharacterized protein YJIK; MCSG, PSI-2 94.84
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 94.58
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 94.45
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 94.27
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 94.26
4gq2_M 950 Nucleoporin NUP120; beta propeller alpha helical, 93.98
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 93.92
3mbr_X 243 Glutamine cyclotransferase; beta-propeller; 1.44A 93.87
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 93.75
3sbq_A 638 Nitrous-oxide reductase; beta-propeller, cupredoxi 93.64
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 93.58
3q7m_A 376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 93.05
1npe_A 267 Nidogen, entactin; glycoprotein, basement membrane 92.9
4gq2_M 950 Nucleoporin NUP120; beta propeller alpha helical, 92.54
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 92.34
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 92.1
2p9w_A 334 MAL S 1 allergenic protein; beta propeller; 1.35A 91.44
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 90.73
3tc9_A 430 Hypothetical hydrolase; 6-bladed beta-propeller, i 90.41
3hxj_A 330 Pyrrolo-quinoline quinone; all beta protein. incom 90.37
3f7f_A 729 Nucleoporin NUP120; nuclear pore complex, macromol 90.18
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 90.06
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 89.02
1tl2_A 236 L10, protein (tachylectin-2); animal lectin, horse 88.18
3v65_B386 Low-density lipoprotein receptor-related protein; 87.67
2p4o_A 306 Hypothetical protein; putative lactonase, structur 87.14
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 86.23
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 85.94
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 85.71
3f7f_A 729 Nucleoporin NUP120; nuclear pore complex, macromol 85.67
2fp8_A322 Strictosidine synthase; six bladed beta propeller 85.01
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 84.0
3v65_B 386 Low-density lipoprotein receptor-related protein; 82.03
3hxj_A 330 Pyrrolo-quinoline quinone; all beta protein. incom 81.49
3kya_A 496 Putative phosphatase; structural genomics, joint c 80.1
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
Probab=99.82  E-value=5.9e-19  Score=99.66  Aligned_cols=86  Identities=10%  Similarity=0.079  Sum_probs=79.3

Q ss_pred             CccceeEEEEEecCCCCcceEEEeeeCCCeEEEEeCCCCceeEEeeccccceEEE-EecCCCEEEEecCCCcEEEEeCCC
Q psy14456          2 HDGTVRDVCFIEDTSNKSSLLISGGAGDCKIYVTDCATGQAFQALSGHSGHVLSL-YNWGGATVLSGSHDRTVRFWDLRT   80 (93)
Q Consensus         2 h~~~v~~~~~~~~~~~~~~~~~~~g~~~~~v~~~~~~~~~~~~~~~~~~~~v~~~-~~~~~~~~~s~~~~~~i~~~d~~~   80 (93)
                      |++.|.+++|+|+    ++.+++++ .|+.|++||+.++..+..+..|...+.++ |+++++.+++++.|+.+++||+++
T Consensus        12 h~~~V~~~~fsp~----~~~l~s~~-~dg~v~lWd~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~s~s~d~~i~vwd~~~   86 (304)
T 2ynn_A           12 RSDRVKGIDFHPT----EPWVLTTL-YSGRVELWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNT   86 (304)
T ss_dssp             ECSCEEEEEECSS----SSEEEEEE-TTSEEEEEETTTTEEEEEEECCSSCEEEEEEEGGGTEEEEEETTSEEEEEETTT
T ss_pred             CCCceEEEEECCC----CCEEEEEc-CCCcEEEEECCCCceeEEeeccCCcEEEEEEeCCCCEEEEECCCCEEEEEECCC
Confidence            7889999999999    78888877 69999999999999999999999999999 999999999999999999999999


Q ss_pred             CceeeEecCccC
Q psy14456         81 RGCTNVLTPITV   92 (93)
Q Consensus        81 ~~~~~~~~~~~~   92 (93)
                      ++++..+..|..
T Consensus        87 ~~~~~~~~~h~~   98 (304)
T 2ynn_A           87 GEKVVDFEAHPD   98 (304)
T ss_dssp             CCEEEEEECCSS
T ss_pred             CcEEEEEeCCCC
Confidence            999988887753



>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3f7f_A Nucleoporin NUP120; nuclear pore complex, macromolecular assembly, membrane coat, nucleocytoplasmic transport, beta-propeller; 2.60A {Saccharomyces cerevisiae} PDB: 3h7n_A 3hxr_A Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3f7f_A Nucleoporin NUP120; nuclear pore complex, macromolecular assembly, membrane coat, nucleocytoplasmic transport, beta-propeller; 2.60A {Saccharomyces cerevisiae} PDB: 3h7n_A 3hxr_A Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 93
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 9e-10
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 2e-06
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-09
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 3e-08
d1vyhc1 317 b.69.4.1 (C:92-408) Platelet-activating factor ace 4e-05
d1vyhc1 317 b.69.4.1 (C:92-408) Platelet-activating factor ace 7e-04
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 8e-09
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 3e-05
d2ovrb2 342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 4e-08
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 9e-07
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 4e-06
d1nexb2 355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 5e-06
d1nexb2 355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 9e-04
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 0.002
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 6e-06
d1p22a2 293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 1e-05
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 0.002
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 9e-06
d1nr0a2 299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 2e-05
d1nr0a2 299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 4e-04
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 5e-04
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 2e-05
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 3e-05
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 3e-05
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 7e-05
d1mdah_ 368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 2e-04
d1sq9a_ 393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 9e-04
d1sq9a_ 393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 0.001
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: beta1-subunit of the signal-transducing G protein heterotrimer
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 51.3 bits (121), Expect = 9e-10
 Identities = 20/78 (25%), Positives = 28/78 (35%), Gaps = 6/78 (7%)

Query: 1   MHDGTVRDVCFIEDTSNKSSLLISGGAGDCKIYVTDCATGQAFQALSGHSGHVLSL-YNW 59
                +  V F    S    LL++G   D    V D         L+GH   V  L    
Sbjct: 268 NIICGITSVSF----SKSGRLLLAGYD-DFNCNVWDALKADRAGVLAGHDNRVSCLGVTD 322

Query: 60  GGATVLSGSHDRTVRFWD 77
            G  V +GS D  ++ W+
Sbjct: 323 DGMAVATGSWDSFLKIWN 340


>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query93
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.84
d1erja_ 388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.72
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.72
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.72
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.72
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.72
d1tbga_ 340 beta1-subunit of the signal-transducing G protein 99.71
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.69
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.69
d1vyhc1 317 Platelet-activating factor acetylhydrolase IB subu 99.68
d1p22a2 293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.68
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.68
d1yfqa_ 342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.68
d1gxra_ 337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.67
d1nexb2 355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.66
d1nr0a2 299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.62
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.61
d2ovrb2 342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.61
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.6
d1gxra_ 337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.6
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.59
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.58
d1sq9a_ 393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.58
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.54
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.52
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.44
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.33
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.24
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.22
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.21
d1yfqa_ 342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.21
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.2
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.17
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.14
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.13
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.1
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.08
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 99.05
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.05
d1l0qa2 301 Surface layer protein {Archaeon Methanosarcina maz 99.0
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 98.81
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 98.8
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 98.79
d2madh_ 373 Methylamine dehydrogenase, H-chain {Gram negative 98.78
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 98.69
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.5
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 98.42
d2bbkh_ 355 Methylamine dehydrogenase, H-chain {Paracoccus den 98.41
d1mdah_ 368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.35
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 97.77
d1jofa_ 365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 97.2
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 97.16
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 97.03
d2p4oa1 302 Hypothetical protein All0351 homologue {Nostoc pun 96.95
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 96.03
d1qnia2 441 Nitrous oxide reductase, N-terminal domain {Pseudo 95.9
d1rwia_ 260 Serine/threonine-protein kinase PknD {Mycobacteriu 95.85
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 95.58
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 95.37
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 95.14
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 94.89
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 94.65
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 94.51
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 94.37
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 94.17
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 93.94
d1k32a2 281 Tricorn protease N-terminal domain {Archaeon Therm 93.35
d2hqsa1 269 TolB, C-terminal domain {Escherichia coli [TaxId: 93.29
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 92.31
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 92.25
d2p4oa1 302 Hypothetical protein All0351 homologue {Nostoc pun 92.17
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 92.06
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 91.24
d2dg1a1 319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 90.63
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 90.38
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 85.89
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Antiviral protein Ski8 (Ski8p)
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.84  E-value=4e-20  Score=105.87  Aligned_cols=85  Identities=31%  Similarity=0.458  Sum_probs=75.3

Q ss_pred             CccceeEEEEEecCCCCcceEEEeeeCCC---eEEEEeCCCCceeEEee-------------ccccceEEE-EecCCCEE
Q psy14456          2 HDGTVRDVCFIEDTSNKSSLLISGGAGDC---KIYVTDCATGQAFQALS-------------GHSGHVLSL-YNWGGATV   64 (93)
Q Consensus         2 h~~~v~~~~~~~~~~~~~~~~~~~g~~~~---~v~~~~~~~~~~~~~~~-------------~~~~~v~~~-~~~~~~~~   64 (93)
                      |+.+|.+++|+|+    ++++++++. |+   .+++||+++++.+..+.             +|.+.|.++ |+|+++++
T Consensus       230 h~~~V~~l~~spd----g~~l~sgs~-D~t~~~i~lwd~~~g~~~~~l~~~~~~~~~~~~~~gH~~~V~~l~fspd~~~l  304 (393)
T d1sq9a_         230 NSNSIRSVKFSPQ----GSLLAIAHD-SNSFGCITLYETEFGERIGSLSVPTHSSQASLGEFAHSSWVMSLSFNDSGETL  304 (393)
T ss_dssp             CCCCEEEEEECSS----TTEEEEEEE-ETTEEEEEEEETTTCCEEEEECBC--------CCBSBSSCEEEEEECSSSSEE
T ss_pred             ccceEEEcccccc----cceeeeecC-CCCcceeeecccccceeeeeeccccccccceeeeecccCceeeeccCCCCCee
Confidence            7889999999999    788888764 65   58999999987766653             799999999 99999999


Q ss_pred             EEecCCCcEEEEeCCCCceeeEecCcc
Q psy14456         65 LSGSHDRTVRFWDLRTRGCTNVLTPIT   91 (93)
Q Consensus        65 ~s~~~~~~i~~~d~~~~~~~~~~~~~~   91 (93)
                      ++++.|+.|++||++++++++++.+|.
T Consensus       305 ~S~s~D~~v~vWd~~~g~~~~~l~gH~  331 (393)
T d1sq9a_         305 CSAGWDGKLRFWDVKTKERITTLNMHC  331 (393)
T ss_dssp             EEEETTSEEEEEETTTTEEEEEEECCG
T ss_pred             EEECCCCEEEEEECCCCCEEEEECCcC
Confidence            999999999999999999999998875



>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure