Psyllid ID: psy14505
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 1619 | 2.2.26 [Sep-21-2011] | |||||||
| P37411 | 878 | DNA gyrase subunit A OS=S | yes | N/A | 0.533 | 0.982 | 0.534 | 0.0 | |
| P41513 | 878 | DNA gyrase subunit A OS=E | yes | N/A | 0.528 | 0.973 | 0.528 | 0.0 | |
| P0AES5 | 875 | DNA gyrase subunit A OS=S | yes | N/A | 0.531 | 0.984 | 0.526 | 0.0 | |
| P0AES4 | 875 | DNA gyrase subunit A OS=E | N/A | N/A | 0.531 | 0.984 | 0.526 | 0.0 | |
| P14829 | 876 | DNA gyrase subunit A OS=K | yes | N/A | 0.531 | 0.981 | 0.523 | 0.0 | |
| P48372 | 923 | DNA gyrase subunit A OS=P | yes | N/A | 0.520 | 0.913 | 0.502 | 0.0 | |
| P48371 | 916 | DNA gyrase subunit A OS=N | yes | N/A | 0.518 | 0.917 | 0.521 | 0.0 | |
| P48369 | 922 | DNA gyrase subunit A OS=A | yes | N/A | 0.529 | 0.930 | 0.505 | 0.0 | |
| P43700 | 880 | DNA gyrase subunit A OS=H | yes | N/A | 0.505 | 0.930 | 0.523 | 0.0 | |
| Q8K9W2 | 825 | DNA gyrase subunit A OS=B | yes | N/A | 0.508 | 0.997 | 0.529 | 0.0 |
| >sp|P37411|GYRA_SALTY DNA gyrase subunit A OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gyrA PE=3 SV=3 | Back alignment and function desciption |
|---|
Score = 973 bits (2516), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 468/876 (53%), Positives = 646/876 (73%), Gaps = 13/876 (1%)
Query: 1 MNQFAKEVISILLEEEMCKSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMHEMNNLWN 60
M+ A+E+ + +EEE+ SYLDYAMSVIVGRALPDVRDGLKPVHRRVL+AM+ + N WN
Sbjct: 1 MSDLAREITPVNIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLYAMNVLGNDWN 60
Query: 61 RPFVKCARVVGETMGKYHPHGDVSIYDALVRMAQSFSLRCTLVDGQGNFGSIDGDSAAAM 120
+ + K ARVVG+ +GKYHPHGD ++YD +VRMAQ FSLR LVDGQGNFGSIDGDSAAAM
Sbjct: 61 KAYKKSARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVDGQGNFGSIDGDSAAAM 120
Query: 121 RYTECRLNKISNELLIDLDKETIDFISNYDGKEKEPSVLPTRIPNLLINGSSGIAVGMAT 180
RYTE RL KI++EL+ DL+KET+DF+ NYDG EK P V+PT+IPNLL+NGSSGIAVGMAT
Sbjct: 121 RYTEIRLAKIAHELMADLEKETVDFVDNYDGTEKIPDVMPTKIPNLLVNGSSGIAVGMAT 180
Query: 181 NIPPHNLTEVIDGVLYVLHNPECSINDLIKIIPAPDFPTAGIIYGLSSVHDGYYTGKGRV 240
NIPPHNLTEVI+G L + N + SI L++ IP PDFPTA II G + + Y TG+G+V
Sbjct: 181 NIPPHNLTEVINGCLAYIDNEDISIEGLMEHIPGPDFPTAAIINGRRGIEEAYRTGRGKV 240
Query: 241 IIRAKTHIEEFNRENRTAIIIDELPYQVNKKSLLEKISQLVKEKKLECISNLRDESDKSG 300
IRA+ +E + R II+ E+PYQVNK L+EKI++LVK+K++E IS LRDESDK G
Sbjct: 241 YIRARAEVEADAKTGRETIIVHEIPYQVNKARLIEKIAELVKDKRVEGISALRDESDKDG 300
Query: 301 MRIVIELKRNEIPEIVLNKLYKQTQLQNTFGMNMLALVNGQPKLLNLKEILYYFILHRKE 360
MRIVIE+KR+ + E+VLN LY QTQLQ +FG+NM+AL +GQPK++NLK+I+ F+ HR+E
Sbjct: 301 MRIVIEVKRDAVGEVVLNNLYSQTQLQVSFGINMVALHHGQPKIMNLKDIISAFVRHRRE 360
Query: 361 VIKRRTIFELRKAREYAHILEGLTIALTNIDNFIQIIRSTSTPQEAKNKIIESTWNLPDV 420
V+ RRTIFELRKAR+ AHILE L IAL NID I++IR TP EAK +I W+L +V
Sbjct: 361 VVTRRTIFELRKARDRAHILEALAIALANIDPIIELIRRAPTPAEAKAALISRPWDLGNV 420
Query: 421 SKIIGFNKKNYNTISKINNISKLQNNDMYKLSDIQAQEILKMPLQRLTNMEQKKIINKYE 480
+ ++ + + +++ Y L++ QAQ IL + LQ+LT +E +K++++Y+
Sbjct: 421 AAMLERAGDDAARPEWLEPEFGVRDGQYY-LTEQQAQAILDLRLQKLTGLEHEKLLDEYK 479
Query: 481 NVIKKVIDLTDILSNSKRIIEIITDELNIIKNKYGSHKKNIRRSEIILNAINPSTEDLIA 540
+++++ +L IL ++ R++E+I +E+ +I++++G RR+EI N+ + + EDLI+
Sbjct: 480 ELLEQIAELLHILGSADRLMEVIREEMELIRDQFGDE----RRTEITANSADINIEDLIS 535
Query: 541 SQDMVITLSNLGYIKSQPISEYRAQKRGGRGKKAMMTKDEDWINQLFIANTHDYILCFSN 600
+D+V+TLS+ GY+K QP+++Y AQ+RGG+GK A K+ED+I++L +ANTHD ILCFS+
Sbjct: 536 QEDVVVTLSHQGYVKYQPLTDYEAQRRGGKGKSAARIKEEDFIDRLLVANTHDTILCFSS 595
Query: 601 YGRLYWLKVWQIPQGSRNSRGKPIINMFSLKNKEKITVILPLSNNKRDFPKNNYVFMSTS 660
GRLYW+KV+Q+P+ SR +RG+PI+N+ L+ E+IT ILP+ R++ + VFM+T+
Sbjct: 596 RGRLYWMKVYQLPEASRGARGRPIVNLLPLEANERITAILPV----REYEEGVNVFMATA 651
Query: 661 LGIVKKTLLSNFSNPRKSGIIAVNLSNEDFLIGAALTDGSYDIMLFSDSGKAVRFNENSV 720
G VKKT L+ FS PR +GIIAVNL++ D LIG LT GS ++MLFS +GK VRF E++V
Sbjct: 652 SGTVKKTALTEFSRPRSAGIIAVNLNDGDELIGVDLTSGSDEVMLFSAAGKVVRFKEDAV 711
Query: 721 RAMGRSARGVIGMRLEKKQKVIALLVSNNQKQSVLTATENGYGKRTLIKEYTKHNRGTKG 780
RAMGR+A GV G++L KV++L++ + ++LT T+NGYGKRT EY +R T+G
Sbjct: 712 RAMGRTATGVRGIKLAGDDKVVSLIIPRGEG-AILTVTQNGYGKRTAADEYPTKSRATQG 770
Query: 781 IISIKTNKRNGKVVAATLVNRYHEIMLITTGGILIRTRVSEIRKMGRSTQGVILITVENK 840
+ISIK +RNG VV A V+ +IM+IT G L+RTRVSEI +GR+TQGVILI
Sbjct: 771 VISIKVTERNGSVVGAVQVDDCDQIMMITDAGTLVRTRVSEISVVGRNTQGVILIRTAED 830
Query: 841 SKLCGVQRLCKITMIKKYIPVITIDGPTASGKGTVA 876
+ G+QR+ + ++ + IDG A G +A
Sbjct: 831 ENVVGLQRVAEPVDDEE---LDAIDGSVAEGDEDIA 863
|
DNA gyrase negatively supercoils closed circular double-stranded DNA in an ATP-dependent manner and also catalyzes the interconversion of other topological isomers of double-stranded DNA rings, including catenanes and knotted rings. Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (taxid: 99287) EC: 5EC: .EC: 9EC: 9EC: .EC: 1EC: .EC: 3 |
| >sp|P41513|GYRA_ERWCA DNA gyrase subunit A OS=Erwinia carotovora GN=gyrA PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|P0AES5|GYRA_SHIFL DNA gyrase subunit A OS=Shigella flexneri GN=gyrA PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P0AES4|GYRA_ECOLI DNA gyrase subunit A OS=Escherichia coli (strain K12) GN=gyrA PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P14829|GYRA_KLEOX DNA gyrase subunit A OS=Klebsiella oxytoca GN=gyrA PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|P48372|GYRA_PSEAE DNA gyrase subunit A OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gyrA PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|P48371|GYRA_NEIGO DNA gyrase subunit A OS=Neisseria gonorrhoeae GN=gyrA PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|P48369|GYRA_AERSA DNA gyrase subunit A OS=Aeromonas salmonicida GN=gyrA PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|P43700|GYRA_HAEIN DNA gyrase subunit A OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=gyrA PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q8K9W2|GYRA_BUCAP DNA gyrase subunit A OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=gyrA PE=3 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1619 | ||||||
| 152980640 | 873 | DNA gyrase subunit A [Janthinobacterium | 0.524 | 0.972 | 0.714 | 0.0 | |
| 134095749 | 871 | DNA gyrase subunit A [Herminiimonas arse | 0.524 | 0.974 | 0.714 | 0.0 | |
| 398833820 | 887 | DNA gyrase, A subunit [Herbaspirillum sp | 0.525 | 0.959 | 0.711 | 0.0 | |
| 340788938 | 888 | topoisomerase type IIAa [Collimonas fung | 0.525 | 0.958 | 0.711 | 0.0 | |
| 300312989 | 881 | DNA gyrase subunit A protein [Herbaspiri | 0.537 | 0.987 | 0.695 | 0.0 | |
| 409407455 | 881 | DNA gyrase subunit A protein [Herbaspiri | 0.525 | 0.965 | 0.710 | 0.0 | |
| 399017566 | 891 | DNA gyrase, A subunit [Herbaspirillum sp | 0.525 | 0.955 | 0.715 | 0.0 | |
| 329900831 | 884 | DNA gyrase subunit A [Oxalobacteraceae b | 0.534 | 0.979 | 0.694 | 0.0 | |
| 445495472 | 881 | DNA gyrase subunit A [Janthinobacterium | 0.525 | 0.964 | 0.697 | 0.0 | |
| 415941470 | 865 | DNA gyrase subunit A [Herbaspirillum fri | 0.526 | 0.984 | 0.697 | 0.0 |
| >gi|152980640|ref|YP_001354365.1| DNA gyrase subunit A [Janthinobacterium sp. Marseille] gi|151280717|gb|ABR89127.1| DNA gyrase subunit A [Janthinobacterium sp. Marseille] | Back alignment and taxonomy information |
|---|
Score = 1300 bits (3365), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 614/859 (71%), Positives = 736/859 (85%), Gaps = 10/859 (1%)
Query: 1 MNQFAKEVISILLEEEMCKSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMHEMNNLWN 60
M+QFAKE I I LEEEM KSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMHEMNN+WN
Sbjct: 1 MDQFAKETIPISLEEEMRKSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMHEMNNVWN 60
Query: 61 RPFVKCARVVGETMGKYHPHGDVSIYDALVRMAQSFSLRCTLVDGQGNFGSIDGDSAAAM 120
RPFVKCARVVGETMGKYHPHGD SIYD LVRMAQ FSLR LVDGQGNFGSIDGD+AAAM
Sbjct: 61 RPFVKCARVVGETMGKYHPHGDASIYDTLVRMAQPFSLRYMLVDGQGNFGSIDGDNAAAM 120
Query: 121 RYTECRLNKISNELLIDLDKETIDFISNYDGKEKEPSVLPTRIPNLLINGSSGIAVGMAT 180
RYTECRL+KI+ ELL DLDKET+DF+ NYDGKEKEPSVLPTRIPNLLINGSSGIAVGMAT
Sbjct: 121 RYTECRLDKIAGELLADLDKETVDFVPNYDGKEKEPSVLPTRIPNLLINGSSGIAVGMAT 180
Query: 181 NIPPHNLTEVIDGVLYVLHNPECSINDLIKIIPAPDFPTAGIIYGLSSVHDGYYTGKGRV 240
NIPPHN+TEVIDG L+VL N + ++++LI+IIPAPDFPT GIIYG+S V DGY TG+GRV
Sbjct: 181 NIPPHNITEVIDGALHVLRNADATVDELIEIIPAPDFPTGGIIYGVSGVRDGYRTGRGRV 240
Query: 241 IIRAKTHIEEFNRENRTAIIIDELPYQVNKKSLLEKISQLVKEKKLECISNLRDESDKSG 300
++RAKTH EEF +ENR AII+DELPYQVNKKSLLE+I++LV++KKL+ IS++RDESDKSG
Sbjct: 241 VMRAKTHFEEFGKENRAAIIVDELPYQVNKKSLLERIAELVRDKKLDGISDIRDESDKSG 300
Query: 301 MRIVIELKRNEIPEIVLNKLYKQTQLQNTFGMNMLALVNGQPKLLNLKEILYYFILHRKE 360
MR+VIELKRNE+PE+VLN LYKQTQLQ+TFGMNM+ALV+GQPKLLNLK++L F+ HR+E
Sbjct: 301 MRVVIELKRNEVPEVVLNNLYKQTQLQDTFGMNMVALVDGQPKLLNLKQMLECFLSHRRE 360
Query: 361 VIKRRTIFELRKAREYAHILEGLTIALTNIDNFIQIIRSTSTPQEAKNKIIESTWNLPDV 420
V+ RRTIFELRKARE H+LEGL +AL NID+FI II++ TP AK ++ W+ V
Sbjct: 361 VVTRRTIFELRKARERGHVLEGLAVALANIDDFIAIIKAAPTPPVAKVDLMSRAWDSSVV 420
Query: 421 SKIIGFNKKNYNTISKIN-----NISK---LQNNDMYKLSDIQAQEILKMPLQRLTNMEQ 472
+++ + + +N N+ K +Q + +YKLSD QAQEIL+M LQRLT +EQ
Sbjct: 421 REMLA--RTGEEGVGGVNAFRPENLPKHYGIQADGLYKLSDDQAQEILQMRLQRLTGLEQ 478
Query: 473 KKIINKYENVIKKVIDLTDILSNSKRIIEIITDELNIIKNKYGSHKKNIRRSEIILNAIN 532
KI+N+Y+ V++++ DL DIL+ +R+ IITDEL + KN+YG K+ RRS I LNA +
Sbjct: 479 DKIVNEYKEVMEQIADLLDILAKPERVTVIITDELTVAKNEYGIGNKDERRSTIELNATD 538
Query: 533 PSTEDLIASQDMVITLSNLGYIKSQPISEYRAQKRGGRGKKAMMTKDEDWINQLFIANTH 592
TEDLI QDMV+TLS+ GY+K+QPISEYRAQKRGGRGK+AM TKD+DWI+QLFIANTH
Sbjct: 539 LGTEDLITPQDMVVTLSHTGYMKAQPISEYRAQKRGGRGKQAMATKDDDWIDQLFIANTH 598
Query: 593 DYILCFSNYGRLYWLKVWQIPQGSRNSRGKPIINMFSLKNKEKITVILPLSNNKRDFPKN 652
DYILCFSN GRLYWLKVW++PQGSRNSRGKPI+NMF L++ EKITVILP+S R FP++
Sbjct: 599 DYILCFSNRGRLYWLKVWEVPQGSRNSRGKPIVNMFPLQDGEKITVILPISGENRTFPED 658
Query: 653 NYVFMSTSLGIVKKTLLSNFSNPRKSGIIAVNLSNEDFLIGAALTDGSYDIMLFSDSGKA 712
+Y+FM+TSLG VKKT LS+FSNPRK+GIIAV+L + DFLIGAALTDG +D+MLFSDSGKA
Sbjct: 659 HYIFMATSLGTVKKTSLSDFSNPRKAGIIAVDLDDGDFLIGAALTDGKHDVMLFSDSGKA 718
Query: 713 VRFNENSVRAMGRSARGVIGMRLEKKQKVIALLVSNNQKQSVLTATENGYGKRTLIKEYT 772
VRF+EN VR MGR+ARGV GM LE+ Q+VIALLV+ N++QSVLTATENG+GKRT I EYT
Sbjct: 719 VRFDENDVRPMGRTARGVRGMNLEEGQQVIALLVAENEQQSVLTATENGFGKRTPITEYT 778
Query: 773 KHNRGTKGIISIKTNKRNGKVVAATLVNRYHEIMLITTGGILIRTRVSEIRKMGRSTQGV 832
+H RGTKG+I+I+T++RNGKVVAATLV+ EIMLITTGG+LIRTRV+EIR+MGR+TQGV
Sbjct: 779 RHGRGTKGMIAIQTSERNGKVVAATLVDASDEIMLITTGGVLIRTRVAEIREMGRATQGV 838
Query: 833 ILITVENKSKLCGVQRLCK 851
LI VE+ +KL G+QR+ +
Sbjct: 839 TLIAVEDGTKLSGLQRILE 857
|
Source: Janthinobacterium sp. Marseille Species: Janthinobacterium sp. Marseille Genus: Janthinobacterium Family: Oxalobacteraceae Order: Burkholderiales Class: Betaproteobacteria Phylum: Proteobacteria Superkingdom: Bacteria |
| >gi|134095749|ref|YP_001100824.1| DNA gyrase subunit A [Herminiimonas arsenicoxydans] gi|133739652|emb|CAL62703.1| DNA gyrase subunit A [Herminiimonas arsenicoxydans] | Back alignment and taxonomy information |
|---|
| >gi|398833820|ref|ZP_10591941.1| DNA gyrase, A subunit [Herbaspirillum sp. YR522] gi|398220879|gb|EJN07314.1| DNA gyrase, A subunit [Herbaspirillum sp. YR522] | Back alignment and taxonomy information |
|---|
| >gi|340788938|ref|YP_004754403.1| topoisomerase type IIAa [Collimonas fungivorans Ter331] gi|340554205|gb|AEK63580.1| topoisomerase type IIAa [Collimonas fungivorans Ter331] | Back alignment and taxonomy information |
|---|
| >gi|300312989|ref|YP_003777081.1| DNA gyrase subunit A protein [Herbaspirillum seropedicae SmR1] gi|300075774|gb|ADJ65173.1| DNA gyrase subunit A protein [Herbaspirillum seropedicae SmR1] | Back alignment and taxonomy information |
|---|
| >gi|409407455|ref|ZP_11255906.1| DNA gyrase subunit A protein [Herbaspirillum sp. GW103] gi|386433206|gb|EIJ46032.1| DNA gyrase subunit A protein [Herbaspirillum sp. GW103] | Back alignment and taxonomy information |
|---|
| >gi|399017566|ref|ZP_10719757.1| DNA gyrase, A subunit [Herbaspirillum sp. CF444] gi|398103164|gb|EJL93337.1| DNA gyrase, A subunit [Herbaspirillum sp. CF444] | Back alignment and taxonomy information |
|---|
| >gi|329900831|ref|ZP_08272599.1| DNA gyrase subunit A [Oxalobacteraceae bacterium IMCC9480] gi|327549359|gb|EGF33929.1| DNA gyrase subunit A [Oxalobacteraceae bacterium IMCC9480] | Back alignment and taxonomy information |
|---|
| >gi|445495472|ref|ZP_21462516.1| DNA gyrase subunit A [Janthinobacterium sp. HH01] gi|444791633|gb|ELX13180.1| DNA gyrase subunit A [Janthinobacterium sp. HH01] | Back alignment and taxonomy information |
|---|
| >gi|415941470|ref|ZP_11555771.1| DNA gyrase subunit A [Herbaspirillum frisingense GSF30] gi|407759025|gb|EKF68776.1| DNA gyrase subunit A [Herbaspirillum frisingense GSF30] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1619 | ||||||
| UNIPROTKB|P0AES4 | 875 | gyrA [Escherichia coli K-12 (t | 0.533 | 0.986 | 0.522 | 2.3e-238 | |
| TIGR_CMR|SO_2411 | 919 | SO_2411 "DNA gyrase, A subunit | 0.517 | 0.911 | 0.535 | 6e-238 | |
| UNIPROTKB|A6V2Q7 | 921 | gyrA "DNA gyrase subunit A" [P | 0.393 | 0.691 | 0.531 | 6.3e-236 | |
| TIGR_CMR|CBU_0524 | 850 | CBU_0524 "DNA gyrase, A subuni | 0.515 | 0.982 | 0.525 | 1.7e-233 | |
| UNIPROTKB|Q9KSJ8 | 894 | gyrA "DNA gyrase subunit A" [V | 0.517 | 0.937 | 0.519 | 3.3e-230 | |
| TIGR_CMR|VC_1258 | 894 | VC_1258 "DNA gyrase, subunit A | 0.517 | 0.937 | 0.519 | 3.3e-230 | |
| UNIPROTKB|Q8A9B6 | 858 | gyrA "DNA gyrase subunit A" [B | 0.253 | 0.477 | 0.578 | 2.7e-204 | |
| UNIPROTKB|Q74H88 | 857 | gyrA "DNA gyrase subunit A" [G | 0.504 | 0.952 | 0.455 | 1.5e-193 | |
| TIGR_CMR|GSU_0004 | 857 | GSU_0004 "DNA gyrase, A subuni | 0.504 | 0.952 | 0.455 | 1.5e-193 | |
| UNIPROTKB|A9WK19 | 822 | gyrA "DNA gyrase subunit A" [C | 0.283 | 0.558 | 0.526 | 3.4e-193 |
| UNIPROTKB|P0AES4 gyrA [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
Score = 2298 (814.0 bits), Expect = 2.3e-238, P = 2.3e-238
Identities = 458/876 (52%), Positives = 631/876 (72%)
Query: 1 MNQFAKEVISILLEEEMCKSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMHEMNNLWN 60
M+ A+E+ + +EEE+ SYLDYAMSVIVGRALPDVRDGLKPVHRRVL+AM+ + N WN
Sbjct: 1 MSDLAREITPVNIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLYAMNVLGNDWN 60
Query: 61 RPFVKCARVVGETMGKYHPHGDVSIYDALVRMAQSFSLRCTLVDGQGNFGSIDGDSAAAM 120
+ + K ARVVG+ +GKYHPHGD ++YD +VRMAQ FSLR LVDGQGNFGSIDGDSAAAM
Sbjct: 61 KAYKKSARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVDGQGNFGSIDGDSAAAM 120
Query: 121 RYTECRLNKISNELLIDLDKETIDFISNYDGKEKEPSVLPTRIPNLLINGSSGIAVGMAT 180
RYTE RL KI++EL+ DL+KET+DF+ NYDG EK P V+PT+IPNLL+NGSSGIAVGMAT
Sbjct: 121 RYTEIRLAKIAHELMADLEKETVDFVDNYDGTEKIPDVMPTKIPNLLVNGSSGIAVGMAT 180
Query: 181 NIPPHNLTEVIDGVLYVLHNPECSINDLIKIIPAPDFPTAGIIYGLSSVHDGYYTGKGRV 240
NIPPHNLTEVI+G L + + + SI L++ IP PDFPTA II G + + Y TG+G+V
Sbjct: 181 NIPPHNLTEVINGCLAYIDDEDISIEGLMEHIPGPDFPTAAIINGRRGIEEAYRTGRGKV 240
Query: 241 IIRAKTHIEEFNRENRTAIIIDELPYQVNKKSLLEKISQLVKEKKLECISNLRDESDKSG 300
IRA+ +E + R II+ E+PYQVNK L+EKI++LVKEK++E IS LRDESDK G
Sbjct: 241 YIRARAEVEVDAKTGRETIIVHEIPYQVNKARLIEKIAELVKEKRVEGISALRDESDKDG 300
Query: 301 MRIVIELKRNEIPEIVLNKLYKQTQLQNTFGMNMLALVNGQPKLLNLKEILYYFILHRKE 360
MRIVIE+KR+ + E+VLN LY QTQLQ +FG+NM+AL +GQPK++NLK+I+ F+ HR+E
Sbjct: 301 MRIVIEVKRDAVGEVVLNNLYSQTQLQVSFGINMVALHHGQPKIMNLKDIIAAFVRHRRE 360
Query: 361 VIKRRTIFELRKAREYAHILEGLTIALTNIDNFIQIIRSTSTPQEAKNKIIESTWNLPDV 420
V+ RRTIFELRKAR+ AHILE L +AL NID I++IR TP EAK ++ + W L +V
Sbjct: 361 VVTRRTIFELRKARDRAHILEALAVALANIDPIIELIRHAPTPAEAKTALVANPWQLGNV 420
Query: 421 SKIIGFNKKNYNTISKINNISKLQNNDMYKLSDIQAQEILKMPLQRLTNMEQKKIINKYE 480
+ ++ + + +++ +Y L++ QAQ IL + LQ+LT +E +K++++Y+
Sbjct: 421 AAMLERAGDDAARPEWLEPEFGVRDG-LYYLTEQQAQAILDLRLQKLTGLEHEKLLDEYK 479
Query: 481 NVIKKVIDLTDILSNSKRXXXXXXXXXXXXKNKYGSHKKNIRRSEIILNAINPSTEDLIA 540
++ ++ +L IL ++ R + ++G RR+EI N+ + + EDLI
Sbjct: 480 ELLDQIAELLRILGSADRLMEVIREELELVREQFGDK----RRTEITANSADINLEDLIT 535
Query: 541 SQDMVITLSNLGYIKSQPISEYRAQKRGGRGKKAMMTKDEDWINQLFIANTHDYILCFSN 600
+D+V+TLS+ GY+K QP+SEY AQ+RGG+GK A K+ED+I++L +ANTHD+ILCFS+
Sbjct: 536 QEDVVVTLSHQGYVKYQPLSEYEAQRRGGKGKSAARIKEEDFIDRLLVANTHDHILCFSS 595
Query: 601 YGRLYWLKVWQIPQGSRNSRGKPIINMFSLKNKEKITVILPLSNNKRDFPKNNYVFMSTS 660
GR+Y +KV+Q+P+ +R +RG+PI+N+ L+ E+IT ILP++ +F + VFM+T+
Sbjct: 596 RGRVYSMKVYQLPEATRGARGRPIVNLLPLEQDERITAILPVT----EFEEGVKVFMATA 651
Query: 661 LGIVKKTLLSNFSNPRKSGIIAVNLSNEDFLIGAALTDGSYDIMLFSDSGKAVRFNENSV 720
G VKKT+L+ F+ R +G +A+ L + D LIG LT G ++MLFS GK VRF E+SV
Sbjct: 652 NGTVKKTVLTEFNRLRTAGKVAIKLVDGDELIGVDLTSGEDEVMLFSAEGKVVRFKESSV 711
Query: 721 RAMGRSARGVIGMRLEKKQKVIALLVSNNQKQSVLTATENGYGKRTLIKEYTKHNRGTKG 780
RAMG + GV G+RL + KV++L+V ++LTAT+NGYGKRT + EY +R TKG
Sbjct: 712 RAMGCNTTGVRGIRLGEGDKVVSLIVPRGDG-AILTATQNGYGKRTAVAEYPTKSRATKG 770
Query: 781 IISIKTNKRNGKVVAATLVNRYHEIMLITTGGILIRTRVSEIRKMGRSTQGVILITVENK 840
+ISIK +RNG VV A V+ +IM+IT G L+RTRVSEI +GR+TQGVILI
Sbjct: 771 VISIKVTERNGLVVGAVQVDDCDQIMMITDAGTLVRTRVSEISIVGRNTQGVILIRTAED 830
Query: 841 SKLCGVQRLCKITMIKKYIPVITIDGPTASGKGTVA 876
+ G+QR+ + + ++ + TIDG A G +A
Sbjct: 831 ENVVGLQRVAE-PVDEEDLD--TIDGSAAEGDDEIA 863
|
|
| TIGR_CMR|SO_2411 SO_2411 "DNA gyrase, A subunit" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A6V2Q7 gyrA "DNA gyrase subunit A" [Pseudomonas aeruginosa PA7 (taxid:381754)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CBU_0524 CBU_0524 "DNA gyrase, A subunit" [Coxiella burnetii RSA 493 (taxid:227377)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9KSJ8 gyrA "DNA gyrase subunit A" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|VC_1258 VC_1258 "DNA gyrase, subunit A" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8A9B6 gyrA "DNA gyrase subunit A" [Bacteroides thetaiotaomicron VPI-5482 (taxid:226186)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q74H88 gyrA "DNA gyrase subunit A" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_0004 GSU_0004 "DNA gyrase, A subunit" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A9WK19 gyrA "DNA gyrase subunit A" [Chloroflexus aurantiacus J-10-fl (taxid:324602)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| P48371 | GYRA_NEIGO | 5, ., 9, 9, ., 1, ., 3 | 0.5212 | 0.5188 | 0.9170 | yes | N/A |
| P48372 | GYRA_PSEAE | 5, ., 9, 9, ., 1, ., 3 | 0.5028 | 0.5206 | 0.9133 | yes | N/A |
| P37411 | GYRA_SALTY | 5, ., 9, 9, ., 1, ., 3 | 0.5342 | 0.5330 | 0.9829 | yes | N/A |
| P0AES5 | GYRA_SHIFL | 5, ., 9, 9, ., 1, ., 3 | 0.5260 | 0.5318 | 0.984 | yes | N/A |
| P43700 | GYRA_HAEIN | 5, ., 9, 9, ., 1, ., 3 | 0.5235 | 0.5058 | 0.9306 | yes | N/A |
| P48369 | GYRA_AERSA | 5, ., 9, 9, ., 1, ., 3 | 0.5059 | 0.5299 | 0.9305 | yes | N/A |
| P14829 | GYRA_KLEOX | 5, ., 9, 9, ., 1, ., 3 | 0.5239 | 0.5311 | 0.9817 | yes | N/A |
| Q89AS3 | GYRA_BUCBP | 5, ., 9, 9, ., 1, ., 3 | 0.5247 | 0.5176 | 0.9893 | yes | N/A |
| Q8K9W2 | GYRA_BUCAP | 5, ., 9, 9, ., 1, ., 3 | 0.5299 | 0.5083 | 0.9975 | yes | N/A |
| P41513 | GYRA_ERWCA | 5, ., 9, 9, ., 1, ., 3 | 0.5288 | 0.5281 | 0.9738 | yes | N/A |
| P57277 | GYRA_BUCAI | 5, ., 9, 9, ., 1, ., 3 | 0.5320 | 0.5108 | 0.9963 | yes | N/A |
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 2.7.4 | 0.691 |
| 3rd Layer | 5.99.1.3 | 0.737 |
| 4th Layer | 2.7.4.14 | 0.737 |
| 3rd Layer | 5.99.1 | 0.691 |
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 1619 | |||
| PRK05560 | 805 | PRK05560, PRK05560, DNA gyrase subunit A; Validate | 0.0 | |
| TIGR01063 | 800 | TIGR01063, gyrA, DNA gyrase, A subunit | 0.0 | |
| COG0188 | 804 | COG0188, GyrA, Type IIA topoisomerase (DNA gyrase/ | 0.0 | |
| PRK06299 | 565 | PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | 0.0 | |
| PRK05561 | 742 | PRK05561, PRK05561, DNA topoisomerase IV subunit A | 0.0 | |
| cd00187 | 445 | cd00187, TOP4c, DNA Topoisomerase, subtype IIA; do | 0.0 | |
| COG0539 | 541 | COG0539, RpsA, Ribosomal protein S1 [Translation, | 0.0 | |
| smart00434 | 444 | smart00434, TOP4c, DNA Topoisomerase IV | 0.0 | |
| TIGR00717 | 516 | TIGR00717, rpsA, ribosomal protein S1 | 0.0 | |
| pfam00521 | 427 | pfam00521, DNA_topoisoIV, DNA gyrase/topoisomerase | 0.0 | |
| TIGR01061 | 738 | TIGR01061, parC_Gpos, DNA topoisomerase IV, A subu | 0.0 | |
| PRK13979 | 957 | PRK13979, PRK13979, DNA topoisomerase IV subunit A | 1e-165 | |
| TIGR01062 | 735 | TIGR01062, parC_Gneg, DNA topoisomerase IV, A subu | 1e-139 | |
| PRK06676 | 390 | PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | 1e-106 | |
| PRK12269 | 863 | PRK12269, PRK12269, bifunctional cytidylate kinase | 1e-103 | |
| PRK00087 | 647 | PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl d | 6e-98 | |
| PRK13806 | 491 | PRK13806, rpsA, 30S ribosomal protein S1; Provisio | 1e-93 | |
| PRK00023 | 225 | PRK00023, cmk, cytidylate kinase; Provisional | 5e-93 | |
| PRK07899 | 486 | PRK07899, rpsA, 30S ribosomal protein S1; Reviewed | 1e-82 | |
| COG0283 | 222 | COG0283, Cmk, Cytidylate kinase [Nucleotide transp | 3e-82 | |
| PRK11860 | 661 | PRK11860, PRK11860, bifunctional 3-phosphoshikimat | 3e-79 | |
| PRK09631 | 635 | PRK09631, PRK09631, DNA topoisomerase IV subunit A | 2e-68 | |
| TIGR00017 | 217 | TIGR00017, cmk, cytidylate kinase | 5e-68 | |
| PRK13477 | 512 | PRK13477, PRK13477, bifunctional pantoate ligase/c | 2e-59 | |
| PRK12758 | 869 | PRK12758, PRK12758, DNA topoisomerase IV subunit A | 3e-57 | |
| PRK12269 | 863 | PRK12269, PRK12269, bifunctional cytidylate kinase | 2e-56 | |
| cd02020 | 147 | cd02020, CMPK, Cytidine monophosphate kinase (CMPK | 9e-54 | |
| PRK06676 | 390 | PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | 3e-47 | |
| PRK09630 | 479 | PRK09630, PRK09630, DNA topoisomerase IV subunit A | 4e-45 | |
| pfam02224 | 158 | pfam02224, Cytidylate_kin, Cytidylate kinase | 6e-45 | |
| PRK00087 | 647 | PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl d | 2e-44 | |
| PHA02592 | 439 | PHA02592, 52, DNA topisomerase II medium subunit; | 2e-39 | |
| PRK13806 | 491 | PRK13806, rpsA, 30S ribosomal protein S1; Provisio | 3e-38 | |
| PRK00087 | 647 | PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl d | 2e-37 | |
| cd05689 | 72 | cd05689, S1_RPS1_repeat_ec4, S1_RPS1_repeat_ec4: R | 3e-36 | |
| PRK06676 | 390 | PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | 1e-35 | |
| cd05688 | 68 | cd05688, S1_RPS1_repeat_ec3, S1_RPS1_repeat_ec3: R | 1e-32 | |
| TIGR00717 | 516 | TIGR00717, rpsA, ribosomal protein S1 | 2e-31 | |
| PRK07899 | 486 | PRK07899, rpsA, 30S ribosomal protein S1; Reviewed | 2e-31 | |
| PRK09518 | 712 | PRK09518, PRK09518, bifunctional cytidylate kinase | 4e-31 | |
| cd05690 | 69 | cd05690, S1_RPS1_repeat_ec5, S1_RPS1_repeat_ec5: R | 2e-29 | |
| PRK07400 | 318 | PRK07400, PRK07400, 30S ribosomal protein S1; Revi | 2e-28 | |
| cd04465 | 67 | cd04465, S1_RPS1_repeat_ec2_hs2, S1_RPS1_repeat_ec | 3e-24 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 4e-24 | |
| PLN03128 | 1135 | PLN03128, PLN03128, DNA topoisomerase 2; Provision | 6e-23 | |
| cd05688 | 68 | cd05688, S1_RPS1_repeat_ec3, S1_RPS1_repeat_ec3: R | 8e-19 | |
| cd05690 | 69 | cd05690, S1_RPS1_repeat_ec5, S1_RPS1_repeat_ec5: R | 8e-19 | |
| PRK07899 | 486 | PRK07899, rpsA, 30S ribosomal protein S1; Reviewed | 1e-18 | |
| PRK07400 | 318 | PRK07400, PRK07400, 30S ribosomal protein S1; Revi | 1e-17 | |
| cd05708 | 77 | cd05708, S1_Rrp5_repeat_sc12, S1_Rrp5_repeat_sc12: | 2e-17 | |
| pfam00575 | 74 | pfam00575, S1, S1 RNA binding domain | 9e-17 | |
| cd05688 | 68 | cd05688, S1_RPS1_repeat_ec3, S1_RPS1_repeat_ec3: R | 2e-16 | |
| cd05690 | 69 | cd05690, S1_RPS1_repeat_ec5, S1_RPS1_repeat_ec5: R | 2e-16 | |
| cd05685 | 68 | cd05685, S1_Tex, S1_Tex: The C-terminal S1 domain | 3e-16 | |
| pfam00575 | 74 | pfam00575, S1, S1 RNA binding domain | 6e-16 | |
| pfam00575 | 74 | pfam00575, S1, S1 RNA binding domain | 7e-16 | |
| PLN03237 | 1465 | PLN03237, PLN03237, DNA topoisomerase 2; Provision | 7e-16 | |
| smart00316 | 72 | smart00316, S1, Ribosomal protein S1-like RNA-bind | 7e-16 | |
| smart00316 | 72 | smart00316, S1, Ribosomal protein S1-like RNA-bind | 9e-16 | |
| cd00164 | 65 | cd00164, S1_like, S1_like: Ribosomal protein S1-li | 9e-16 | |
| cd05685 | 68 | cd05685, S1_Tex, S1_Tex: The C-terminal S1 domain | 1e-15 | |
| cd05687 | 70 | cd05687, S1_RPS1_repeat_ec1_hs1, S1_RPS1_repeat_ec | 1e-15 | |
| smart00316 | 72 | smart00316, S1, Ribosomal protein S1-like RNA-bind | 2e-15 | |
| cd00164 | 65 | cd00164, S1_like, S1_like: Ribosomal protein S1-li | 3e-15 | |
| PRK11824 | 693 | PRK11824, PRK11824, polynucleotide phosphorylase/p | 2e-14 | |
| PRK11824 | 693 | PRK11824, PRK11824, polynucleotide phosphorylase/p | 3e-14 | |
| COG2183 | 780 | COG2183, Tex, Transcriptional accessory protein [T | 4e-14 | |
| cd05708 | 77 | cd05708, S1_Rrp5_repeat_sc12, S1_Rrp5_repeat_sc12: | 6e-14 | |
| cd00164 | 65 | cd00164, S1_like, S1_like: Ribosomal protein S1-li | 1e-13 | |
| cd05692 | 69 | cd05692, S1_RPS1_repeat_hs4, S1_RPS1_repeat_hs4: R | 8e-13 | |
| PRK13979 | 957 | PRK13979, PRK13979, DNA topoisomerase IV subunit A | 1e-12 | |
| cd05692 | 69 | cd05692, S1_RPS1_repeat_hs4, S1_RPS1_repeat_hs4: R | 1e-12 | |
| PRK07400 | 318 | PRK07400, PRK07400, 30S ribosomal protein S1; Revi | 6e-12 | |
| PRK08059 | 123 | PRK08059, PRK08059, general stress protein 13; Val | 6e-12 | |
| cd05684 | 79 | cd05684, S1_DHX8_helicase, S1_DHX8_helicase: The N | 9e-12 | |
| cd05689 | 72 | cd05689, S1_RPS1_repeat_ec4, S1_RPS1_repeat_ec4: R | 1e-11 | |
| cd05691 | 73 | cd05691, S1_RPS1_repeat_ec6, S1_RPS1_repeat_ec6: R | 1e-11 | |
| cd05689 | 72 | cd05689, S1_RPS1_repeat_ec4, S1_RPS1_repeat_ec4: R | 2e-11 | |
| PRK08059 | 123 | PRK08059, PRK08059, general stress protein 13; Val | 2e-11 | |
| cd04472 | 68 | cd04472, S1_PNPase, S1_PNPase: Polynucleotide phos | 2e-11 | |
| cd04472 | 68 | cd04472, S1_PNPase, S1_PNPase: Polynucleotide phos | 4e-11 | |
| cd05684 | 79 | cd05684, S1_DHX8_helicase, S1_DHX8_helicase: The N | 1e-10 | |
| TIGR03591 | 684 | TIGR03591, polynuc_phos, polyribonucleotide nucleo | 1e-10 | |
| cd04461 | 83 | cd04461, S1_Rrp5_repeat_hs8_sc7, S1_Rrp5_repeat_hs | 1e-10 | |
| COG2183 | 780 | COG2183, Tex, Transcriptional accessory protein [T | 2e-10 | |
| TIGR03591 | 684 | TIGR03591, polynuc_phos, polyribonucleotide nucleo | 2e-10 | |
| COG1185 | 692 | COG1185, Pnp, Polyribonucleotide nucleotidyltransf | 2e-10 | |
| COG1098 | 129 | COG1098, VacB, Predicted RNA binding protein (cont | 2e-10 | |
| pfam00575 | 74 | pfam00575, S1, S1 RNA binding domain | 3e-10 | |
| COG1185 | 692 | COG1185, Pnp, Polyribonucleotide nucleotidyltransf | 4e-10 | |
| COG1098 | 129 | COG1098, VacB, Predicted RNA binding protein (cont | 6e-10 | |
| PRK08582 | 139 | PRK08582, PRK08582, hypothetical protein; Provisio | 6e-10 | |
| pfam13207 | 114 | pfam13207, AAA_17, AAA domain | 6e-10 | |
| PRK05561 | 742 | PRK05561, PRK05561, DNA topoisomerase IV subunit A | 1e-09 | |
| cd05708 | 77 | cd05708, S1_Rrp5_repeat_sc12, S1_Rrp5_repeat_sc12: | 1e-09 | |
| PRK05807 | 136 | PRK05807, PRK05807, hypothetical protein; Provisio | 5e-09 | |
| COG1098 | 129 | COG1098, VacB, Predicted RNA binding protein (cont | 1e-08 | |
| pfam03989 | 48 | pfam03989, DNA_gyraseA_C, DNA gyrase C-terminal do | 1e-08 | |
| cd05697 | 69 | cd05697, S1_Rrp5_repeat_hs5, S1_Rrp5_repeat_hs5: R | 1e-08 | |
| cd05691 | 73 | cd05691, S1_RPS1_repeat_ec6, S1_RPS1_repeat_ec6: R | 2e-08 | |
| pfam03989 | 48 | pfam03989, DNA_gyraseA_C, DNA gyrase C-terminal do | 2e-08 | |
| cd04452 | 76 | cd04452, S1_IF2_alpha, S1_IF2_alpha: The alpha sub | 2e-08 | |
| PRK08059 | 123 | PRK08059, PRK08059, general stress protein 13; Val | 3e-08 | |
| cd05691 | 73 | cd05691, S1_RPS1_repeat_ec6, S1_RPS1_repeat_ec6: R | 3e-08 | |
| cd05685 | 68 | cd05685, S1_Tex, S1_Tex: The C-terminal S1 domain | 5e-08 | |
| COG1093 | 269 | COG1093, SUI2, Translation initiation factor 2, al | 5e-08 | |
| cd05692 | 69 | cd05692, S1_RPS1_repeat_hs4, S1_RPS1_repeat_hs4: R | 8e-08 | |
| pfam00575 | 74 | pfam00575, S1, S1 RNA binding domain | 3e-07 | |
| PRK11824 | 693 | PRK11824, PRK11824, polynucleotide phosphorylase/p | 3e-07 | |
| pfam03989 | 48 | pfam03989, DNA_gyraseA_C, DNA gyrase C-terminal do | 3e-07 | |
| cd04471 | 83 | cd04471, S1_RNase_R, S1_RNase_R: RNase R C-termina | 5e-07 | |
| cd05686 | 73 | cd05686, S1_pNO40, S1_pNO40: pNO40 , S1-like RNA-b | 1e-06 | |
| smart00316 | 72 | smart00316, S1, Ribosomal protein S1-like RNA-bind | 2e-06 | |
| cd04461 | 83 | cd04461, S1_Rrp5_repeat_hs8_sc7, S1_Rrp5_repeat_hs | 2e-06 | |
| cd04461 | 83 | cd04461, S1_Rrp5_repeat_hs8_sc7, S1_Rrp5_repeat_hs | 2e-06 | |
| PRK05807 | 136 | PRK05807, PRK05807, hypothetical protein; Provisio | 2e-06 | |
| smart00316 | 72 | smart00316, S1, Ribosomal protein S1-like RNA-bind | 3e-06 | |
| COG1185 | 692 | COG1185, Pnp, Polyribonucleotide nucleotidyltransf | 3e-06 | |
| PRK08582 | 139 | PRK08582, PRK08582, hypothetical protein; Provisio | 3e-06 | |
| PRK07252 | 120 | PRK07252, PRK07252, hypothetical protein; Provisio | 3e-06 | |
| PRK03987 | 262 | PRK03987, PRK03987, translation initiation factor | 4e-06 | |
| pfam03989 | 48 | pfam03989, DNA_gyraseA_C, DNA gyrase C-terminal do | 5e-06 | |
| PRK05807 | 136 | PRK05807, PRK05807, hypothetical protein; Provisio | 6e-06 | |
| cd04471 | 83 | cd04471, S1_RNase_R, S1_RNase_R: RNase R C-termina | 6e-06 | |
| PRK07252 | 120 | PRK07252, PRK07252, hypothetical protein; Provisio | 7e-06 | |
| TIGR00358 | 654 | TIGR00358, 3_prime_RNase, VacB and RNase II family | 8e-06 | |
| cd04452 | 76 | cd04452, S1_IF2_alpha, S1_IF2_alpha: The alpha sub | 9e-06 | |
| COG2183 | 780 | COG2183, Tex, Transcriptional accessory protein [T | 2e-05 | |
| COG1093 | 269 | COG1093, SUI2, Translation initiation factor 2, al | 2e-05 | |
| PLN00207 | 891 | PLN00207, PLN00207, polyribonucleotide nucleotidyl | 2e-05 | |
| pfam00575 | 74 | pfam00575, S1, S1 RNA binding domain | 3e-05 | |
| cd05687 | 70 | cd05687, S1_RPS1_repeat_ec1_hs1, S1_RPS1_repeat_ec | 3e-05 | |
| cd05684 | 79 | cd05684, S1_DHX8_helicase, S1_DHX8_helicase: The N | 4e-05 | |
| PRK07252 | 120 | PRK07252, PRK07252, hypothetical protein; Provisio | 4e-05 | |
| cd05707 | 68 | cd05707, S1_Rrp5_repeat_sc11, S1_Rrp5_repeat_sc11: | 4e-05 | |
| pfam03989 | 48 | pfam03989, DNA_gyraseA_C, DNA gyrase C-terminal do | 5e-05 | |
| cd05697 | 69 | cd05697, S1_Rrp5_repeat_hs5, S1_Rrp5_repeat_hs5: R | 5e-05 | |
| TIGR02063 | 709 | TIGR02063, RNase_R, ribonuclease R | 5e-05 | |
| cd04465 | 67 | cd04465, S1_RPS1_repeat_ec2_hs2, S1_RPS1_repeat_ec | 6e-05 | |
| cd05707 | 68 | cd05707, S1_Rrp5_repeat_sc11, S1_Rrp5_repeat_sc11: | 6e-05 | |
| cd04472 | 68 | cd04472, S1_PNPase, S1_PNPase: Polynucleotide phos | 1e-04 | |
| TIGR03591 | 684 | TIGR03591, polynuc_phos, polyribonucleotide nucleo | 1e-04 | |
| COG1102 | 179 | COG1102, Cmk, Cytidylate kinase [Nucleotide transp | 1e-04 | |
| cd04460 | 99 | cd04460, S1_RpoE, S1_RpoE: RpoE, S1-like RNA-bindi | 1e-04 | |
| PRK08582 | 139 | PRK08582, PRK08582, hypothetical protein; Provisio | 2e-04 | |
| PRK08563 | 187 | PRK08563, PRK08563, DNA-directed RNA polymerase su | 2e-04 | |
| PRK04182 | 180 | PRK04182, PRK04182, cytidylate kinase; Provisional | 2e-04 | |
| cd04473 | 77 | cd04473, S1_RecJ_like, S1_RecJ_like: The S1 domain | 3e-04 | |
| COG1107 | 715 | COG1107, COG1107, Archaea-specific RecJ-like exonu | 3e-04 | |
| cd05698 | 70 | cd05698, S1_Rrp5_repeat_hs6_sc5, S1_Rrp5_repeat_hs | 3e-04 | |
| cd04460 | 99 | cd04460, S1_RpoE, S1_RpoE: RpoE, S1-like RNA-bindi | 5e-04 | |
| COG1095 | 183 | COG1095, RPB7, DNA-directed RNA polymerase, subuni | 5e-04 | |
| TIGR02696 | 719 | TIGR02696, pppGpp_PNP, guanosine pentaphosphate sy | 5e-04 | |
| TIGR02696 | 719 | TIGR02696, pppGpp_PNP, guanosine pentaphosphate sy | 5e-04 | |
| PRK08563 | 187 | PRK08563, PRK08563, DNA-directed RNA polymerase su | 6e-04 | |
| TIGR02063 | 709 | TIGR02063, RNase_R, ribonuclease R | 7e-04 | |
| cd04473 | 77 | cd04473, S1_RecJ_like, S1_RecJ_like: The S1 domain | 0.001 | |
| cd05705 | 74 | cd05705, S1_Rrp5_repeat_hs14, S1_Rrp5_repeat_hs14: | 0.001 | |
| cd05706 | 73 | cd05706, S1_Rrp5_repeat_sc10, S1_Rrp5_repeat_sc10: | 0.001 | |
| COG0557 | 706 | COG0557, VacB, Exoribonuclease R [Transcription] | 0.001 | |
| cd05686 | 73 | cd05686, S1_pNO40, S1_pNO40: pNO40 , S1-like RNA-b | 0.002 | |
| PRK03987 | 262 | PRK03987, PRK03987, translation initiation factor | 0.002 | |
| cd05698 | 70 | cd05698, S1_Rrp5_repeat_hs6_sc5, S1_Rrp5_repeat_hs | 0.002 | |
| COG0557 | 706 | COG0557, VacB, Exoribonuclease R [Transcription] | 0.002 | |
| cd00164 | 65 | cd00164, S1_like, S1_like: Ribosomal protein S1-li | 0.004 | |
| pfam03989 | 48 | pfam03989, DNA_gyraseA_C, DNA gyrase C-terminal do | 0.004 | |
| cd05698 | 70 | cd05698, S1_Rrp5_repeat_hs6_sc5, S1_Rrp5_repeat_hs | 0.004 | |
| PRK11642 | 813 | PRK11642, PRK11642, exoribonuclease R; Provisional | 0.004 |
| >gnl|CDD|235502 PRK05560, PRK05560, DNA gyrase subunit A; Validated | Back alignment and domain information |
|---|
Score = 1408 bits (3648), Expect = 0.0
Identities = 477/847 (56%), Positives = 615/847 (72%), Gaps = 45/847 (5%)
Query: 5 AKEVISILLEEEMCKSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMHEMNNLWNRPFV 64
+I + +E+EM +SYLDYAMSVIVGRALPDVRDGLKPVHRR+L+AM+E+ N ++P+
Sbjct: 2 GDRIIPVNIEDEMKRSYLDYAMSVIVGRALPDVRDGLKPVHRRILYAMNELGNTPDKPYK 61
Query: 65 KCARVVGETMGKYHPHGDVSIYDALVRMAQSFSLRCTLVDGQGNFGSIDGDSAAAMRYTE 124
K AR+VG+ MGKYHPHGD ++YDALVRMAQ FS+R LVDGQGNFGSIDGD AAAMRYTE
Sbjct: 62 KSARIVGDVMGKYHPHGDSAVYDALVRMAQDFSMRYPLVDGQGNFGSIDGDPAAAMRYTE 121
Query: 125 CRLNKISNELLIDLDKETIDFISNYDGKEKEPSVLPTRIPNLLINGSSGIAVGMATNIPP 184
R++KI++ELL D+DKET+DF+ NYDG E+EP+VLP R PNLL+NGSSGIAVGMATNIPP
Sbjct: 122 ARMSKIAHELLADIDKETVDFVPNYDGSEQEPTVLPARFPNLLVNGSSGIAVGMATNIPP 181
Query: 185 HNLTEVIDGVLYVLHNPECSINDLIKIIPAPDFPTAGIIYGLSSVHDGYYTGKGRVIIRA 244
HNL EVID L ++ NP+ +I +L++IIP PDFPT GII G S + + Y TG+G +++RA
Sbjct: 182 HNLGEVIDACLALIDNPDITIEELMEIIPGPDFPTGGIILGRSGIREAYRTGRGSIVMRA 241
Query: 245 KTHIEEFNRENRTAIIIDELPYQVNKKSLLEKISQLVKEKKLECISNLRDESDKSGMRIV 304
K IEE R AII+ E+PYQVNK L+EKI++LVKEKK+E IS+LRDESD+ GMRIV
Sbjct: 242 KAEIEEIK--GREAIIVTEIPYQVNKARLIEKIAELVKEKKIEGISDLRDESDRDGMRIV 299
Query: 305 IELKRNEIPEIVLNKLYKQTQLQNTFGMNMLALVNGQPKLLNLKEILYYFILHRKEVIKR 364
IELKR+ +PE+VLN LYK TQLQ +FG+NMLALV+GQPKLLNLKEIL F+ HRKEVI R
Sbjct: 300 IELKRDAVPEVVLNNLYKHTQLQTSFGINMLALVDGQPKLLNLKEILEAFLEHRKEVITR 359
Query: 365 RTIFELRKAREYAHILEGLTIALTNIDNFIQIIRSTSTPQEAKNKIIESTWNLPDVSKII 424
RT FELRKA E AHILEGL IAL NID I +IR++ TP EAK ++E
Sbjct: 360 RTRFELRKAEERAHILEGLLIALDNIDEVIALIRASPTPAEAKEGLME------------ 407
Query: 425 GFNKKNYNTISKINNISKLQNNDMYKLSDIQAQEILKMPLQRLTNMEQKKIINKYENVIK 484
+ LS+IQAQ IL M LQRLT +E+ KI ++Y+ ++
Sbjct: 408 -----------------------RFGLSEIQAQAILDMRLQRLTGLERDKIEDEYKELLA 444
Query: 485 KVIDLTDILSNSKRIIEIITDELNIIKNKYGSHKKNIRRSEIILNAINPSTEDLIASQDM 544
+ DL DIL++ +R++EII +EL IK K+G RR+EII + EDLI +D+
Sbjct: 445 LIADLKDILASPERLLEIIKEELLEIKEKFGDP----RRTEIIEGEGDIDDEDLIPEEDV 500
Query: 545 VITLSNLGYIKSQPISEYRAQKRGGRGKKAMMTKDEDWINQLFIANTHDYILCFSNYGRL 604
V+TL++ GYIK P+ EYRAQ+RGG+G TK++D++ LF+A+THD +L F+N GR+
Sbjct: 501 VVTLTHGGYIKRTPLDEYRAQRRGGKGVSGAKTKEDDFVEHLFVASTHDTLLFFTNRGRV 560
Query: 605 YWLKVWQIPQGSRNSRGKPIINMFSLKNKEKITVILPLSNNKRDFPKNNYVFMSTSLGIV 664
Y LKV++IP+ SR +RG+PI+N+ L+ EKIT ILP+ R+F + Y+F +T G V
Sbjct: 561 YRLKVYEIPEASRTARGRPIVNLLPLEPGEKITAILPV----REFDDDKYLFFATKNGTV 616
Query: 665 KKTLLSNFSNPRKSGIIAVNLSNEDFLIGAALTDGSYDIMLFSDSGKAVRFNENSVRAMG 724
KKT LS FSN R +GIIA+NL D LIG LTDG DI+L + +GKA+RF E+ VR MG
Sbjct: 617 KKTSLSEFSNIRSNGIIAINLDEGDELIGVRLTDGDDDILLATKNGKAIRFPESDVRPMG 676
Query: 725 RSARGVIGMRLEKKQKVIALLVSNNQKQSVLTATENGYGKRTLIKEYTKHNRGTKGIISI 784
R+ARGV G++L + +V+++ V Q +LT TENGYGKRT + EY RG KG+I+I
Sbjct: 677 RTARGVRGIKLREGDEVVSMDVVREDSQEILTVTENGYGKRTPVSEYRLQGRGGKGVITI 736
Query: 785 KTNKRNGKVVAATLVNRYHEIMLITTGGILIRTRVSEIRKMGRSTQGVILITVENKSKLC 844
K ++NGK+V A V+ EIMLIT G LIRTRVSEI GR+TQGV LI ++ K+
Sbjct: 737 KITEKNGKLVGALPVDDDDEIMLITDSGKLIRTRVSEISITGRNTQGVRLIRLDEGDKVV 796
Query: 845 GVQRLCK 851
V R+ +
Sbjct: 797 SVARVAE 803
|
Length = 805 |
| >gnl|CDD|233256 TIGR01063, gyrA, DNA gyrase, A subunit | Back alignment and domain information |
|---|
| >gnl|CDD|223266 COG0188, GyrA, Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), A subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|235775 PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235503 PRK05561, PRK05561, DNA topoisomerase IV subunit A; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|238111 cd00187, TOP4c, DNA Topoisomerase, subtype IIA; domain A'; bacterial DNA topoisomerase IV (C subunit, ParC), bacterial DNA gyrases (A subunit, GyrA),mammalian DNA toposiomerases II | Back alignment and domain information |
|---|
| >gnl|CDD|223613 COG0539, RpsA, Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|214660 smart00434, TOP4c, DNA Topoisomerase IV | Back alignment and domain information |
|---|
| >gnl|CDD|233102 TIGR00717, rpsA, ribosomal protein S1 | Back alignment and domain information |
|---|
| >gnl|CDD|215969 pfam00521, DNA_topoisoIV, DNA gyrase/topoisomerase IV, subunit A | Back alignment and domain information |
|---|
| >gnl|CDD|233255 TIGR01061, parC_Gpos, DNA topoisomerase IV, A subunit, Gram-positive | Back alignment and domain information |
|---|
| >gnl|CDD|237576 PRK13979, PRK13979, DNA topoisomerase IV subunit A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130134 TIGR01062, parC_Gneg, DNA topoisomerase IV, A subunit, proteobacterial | Back alignment and domain information |
|---|
| >gnl|CDD|235851 PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|105491 PRK12269, PRK12269, bifunctional cytidylate kinase/ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234623 PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237516 PRK13806, rpsA, 30S ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234579 PRK00023, cmk, cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236126 PRK07899, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223360 COG0283, Cmk, Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|237003 PRK11860, PRK11860, bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidine monophosphate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236598 PRK09631, PRK09631, DNA topoisomerase IV subunit A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|129128 TIGR00017, cmk, cytidylate kinase | Back alignment and domain information |
|---|
| >gnl|CDD|237393 PRK13477, PRK13477, bifunctional pantoate ligase/cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237192 PRK12758, PRK12758, DNA topoisomerase IV subunit A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|105491 PRK12269, PRK12269, bifunctional cytidylate kinase/ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238978 cd02020, CMPK, Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >gnl|CDD|235851 PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|170022 PRK09630, PRK09630, DNA topoisomerase IV subunit A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216937 pfam02224, Cytidylate_kin, Cytidylate kinase | Back alignment and domain information |
|---|
| >gnl|CDD|234623 PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|222896 PHA02592, 52, DNA topisomerase II medium subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237516 PRK13806, rpsA, 30S ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234623 PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240194 cd05689, S1_RPS1_repeat_ec4, S1_RPS1_repeat_ec4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|235851 PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240193 cd05688, S1_RPS1_repeat_ec3, S1_RPS1_repeat_ec3: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|233102 TIGR00717, rpsA, ribosomal protein S1 | Back alignment and domain information |
|---|
| >gnl|CDD|236126 PRK07899, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236546 PRK09518, PRK09518, bifunctional cytidylate kinase/GTPase Der; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240195 cd05690, S1_RPS1_repeat_ec5, S1_RPS1_repeat_ec5: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|180960 PRK07400, PRK07400, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|239911 cd04465, S1_RPS1_repeat_ec2_hs2, S1_RPS1_repeat_ec2_hs2: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215593 PLN03128, PLN03128, DNA topoisomerase 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240193 cd05688, S1_RPS1_repeat_ec3, S1_RPS1_repeat_ec3: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|240195 cd05690, S1_RPS1_repeat_ec5, S1_RPS1_repeat_ec5: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|236126 PRK07899, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|180960 PRK07400, PRK07400, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240213 cd05708, S1_Rrp5_repeat_sc12, S1_Rrp5_repeat_sc12: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|216000 pfam00575, S1, S1 RNA binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|240193 cd05688, S1_RPS1_repeat_ec3, S1_RPS1_repeat_ec3: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|240195 cd05690, S1_RPS1_repeat_ec5, S1_RPS1_repeat_ec5: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|240190 cd05685, S1_Tex, S1_Tex: The C-terminal S1 domain of a transcription accessory factor called Tex, which has been characterized in Bordetella pertussis and Pseudomonas aeruginosa | Back alignment and domain information |
|---|
| >gnl|CDD|216000 pfam00575, S1, S1 RNA binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|216000 pfam00575, S1, S1 RNA binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|215641 PLN03237, PLN03237, DNA topoisomerase 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|197648 smart00316, S1, Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|197648 smart00316, S1, Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|238094 cd00164, S1_like, S1_like: Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|240190 cd05685, S1_Tex, S1_Tex: The C-terminal S1 domain of a transcription accessory factor called Tex, which has been characterized in Bordetella pertussis and Pseudomonas aeruginosa | Back alignment and domain information |
|---|
| >gnl|CDD|240192 cd05687, S1_RPS1_repeat_ec1_hs1, S1_RPS1_repeat_ec1_hs1: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|197648 smart00316, S1, Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|238094 cd00164, S1_like, S1_like: Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|236995 PRK11824, PRK11824, polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236995 PRK11824, PRK11824, polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225094 COG2183, Tex, Transcriptional accessory protein [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|240213 cd05708, S1_Rrp5_repeat_sc12, S1_Rrp5_repeat_sc12: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|238094 cd00164, S1_like, S1_like: Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|240197 cd05692, S1_RPS1_repeat_hs4, S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|237576 PRK13979, PRK13979, DNA topoisomerase IV subunit A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240197 cd05692, S1_RPS1_repeat_hs4, S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|180960 PRK07400, PRK07400, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|181215 PRK08059, PRK08059, general stress protein 13; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|240189 cd05684, S1_DHX8_helicase, S1_DHX8_helicase: The N-terminal S1 domain of human ATP-dependent RNA helicase DHX8, a DEAH (Asp-Glu-Ala-His) box polypeptide | Back alignment and domain information |
|---|
| >gnl|CDD|240194 cd05689, S1_RPS1_repeat_ec4, S1_RPS1_repeat_ec4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|240196 cd05691, S1_RPS1_repeat_ec6, S1_RPS1_repeat_ec6: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|240194 cd05689, S1_RPS1_repeat_ec4, S1_RPS1_repeat_ec4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|181215 PRK08059, PRK08059, general stress protein 13; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|239918 cd04472, S1_PNPase, S1_PNPase: Polynucleotide phosphorylase (PNPase), ), S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|239918 cd04472, S1_PNPase, S1_PNPase: Polynucleotide phosphorylase (PNPase), ), S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|240189 cd05684, S1_DHX8_helicase, S1_DHX8_helicase: The N-terminal S1 domain of human ATP-dependent RNA helicase DHX8, a DEAH (Asp-Glu-Ala-His) box polypeptide | Back alignment and domain information |
|---|
| >gnl|CDD|234271 TIGR03591, polynuc_phos, polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|239908 cd04461, S1_Rrp5_repeat_hs8_sc7, S1_Rrp5_repeat_hs8_sc7: Rrp5 Homo sapiens S1 repeat 8 (hs8) and Saccharomyces cerevisiae S1 repeat 7 (sc7)-like domains | Back alignment and domain information |
|---|
| >gnl|CDD|225094 COG2183, Tex, Transcriptional accessory protein [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|234271 TIGR03591, polynuc_phos, polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|224106 COG1185, Pnp, Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|224023 COG1098, VacB, Predicted RNA binding protein (contains ribosomal protein S1 domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|216000 pfam00575, S1, S1 RNA binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|224106 COG1185, Pnp, Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|224023 COG1098, VacB, Predicted RNA binding protein (contains ribosomal protein S1 domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|236305 PRK08582, PRK08582, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221983 pfam13207, AAA_17, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|235503 PRK05561, PRK05561, DNA topoisomerase IV subunit A; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|240213 cd05708, S1_Rrp5_repeat_sc12, S1_Rrp5_repeat_sc12: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|235614 PRK05807, PRK05807, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224023 COG1098, VacB, Predicted RNA binding protein (contains ribosomal protein S1 domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|217832 pfam03989, DNA_gyraseA_C, DNA gyrase C-terminal domain, beta-propeller | Back alignment and domain information |
|---|
| >gnl|CDD|240202 cd05697, S1_Rrp5_repeat_hs5, S1_Rrp5_repeat_hs5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|240196 cd05691, S1_RPS1_repeat_ec6, S1_RPS1_repeat_ec6: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|217832 pfam03989, DNA_gyraseA_C, DNA gyrase C-terminal domain, beta-propeller | Back alignment and domain information |
|---|
| >gnl|CDD|239899 cd04452, S1_IF2_alpha, S1_IF2_alpha: The alpha subunit of translation Initiation Factor 2, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|181215 PRK08059, PRK08059, general stress protein 13; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|240196 cd05691, S1_RPS1_repeat_ec6, S1_RPS1_repeat_ec6: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|240190 cd05685, S1_Tex, S1_Tex: The C-terminal S1 domain of a transcription accessory factor called Tex, which has been characterized in Bordetella pertussis and Pseudomonas aeruginosa | Back alignment and domain information |
|---|
| >gnl|CDD|224018 COG1093, SUI2, Translation initiation factor 2, alpha subunit (eIF-2alpha) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|240197 cd05692, S1_RPS1_repeat_hs4, S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|216000 pfam00575, S1, S1 RNA binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|236995 PRK11824, PRK11824, polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217832 pfam03989, DNA_gyraseA_C, DNA gyrase C-terminal domain, beta-propeller | Back alignment and domain information |
|---|
| >gnl|CDD|239917 cd04471, S1_RNase_R, S1_RNase_R: RNase R C-terminal S1 domain | Back alignment and domain information |
|---|
| >gnl|CDD|240191 cd05686, S1_pNO40, S1_pNO40: pNO40 , S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|197648 smart00316, S1, Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|239908 cd04461, S1_Rrp5_repeat_hs8_sc7, S1_Rrp5_repeat_hs8_sc7: Rrp5 Homo sapiens S1 repeat 8 (hs8) and Saccharomyces cerevisiae S1 repeat 7 (sc7)-like domains | Back alignment and domain information |
|---|
| >gnl|CDD|239908 cd04461, S1_Rrp5_repeat_hs8_sc7, S1_Rrp5_repeat_hs8_sc7: Rrp5 Homo sapiens S1 repeat 8 (hs8) and Saccharomyces cerevisiae S1 repeat 7 (sc7)-like domains | Back alignment and domain information |
|---|
| >gnl|CDD|235614 PRK05807, PRK05807, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|197648 smart00316, S1, Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|224106 COG1185, Pnp, Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|236305 PRK08582, PRK08582, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180908 PRK07252, PRK07252, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235188 PRK03987, PRK03987, translation initiation factor IF-2 subunit alpha; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|217832 pfam03989, DNA_gyraseA_C, DNA gyrase C-terminal domain, beta-propeller | Back alignment and domain information |
|---|
| >gnl|CDD|235614 PRK05807, PRK05807, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239917 cd04471, S1_RNase_R, S1_RNase_R: RNase R C-terminal S1 domain | Back alignment and domain information |
|---|
| >gnl|CDD|180908 PRK07252, PRK07252, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|232937 TIGR00358, 3_prime_RNase, VacB and RNase II family 3'-5' exoribonucleases | Back alignment and domain information |
|---|
| >gnl|CDD|239899 cd04452, S1_IF2_alpha, S1_IF2_alpha: The alpha subunit of translation Initiation Factor 2, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|225094 COG2183, Tex, Transcriptional accessory protein [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|224018 COG1093, SUI2, Translation initiation factor 2, alpha subunit (eIF-2alpha) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|215104 PLN00207, PLN00207, polyribonucleotide nucleotidyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216000 pfam00575, S1, S1 RNA binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|240192 cd05687, S1_RPS1_repeat_ec1_hs1, S1_RPS1_repeat_ec1_hs1: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|240189 cd05684, S1_DHX8_helicase, S1_DHX8_helicase: The N-terminal S1 domain of human ATP-dependent RNA helicase DHX8, a DEAH (Asp-Glu-Ala-His) box polypeptide | Back alignment and domain information |
|---|
| >gnl|CDD|180908 PRK07252, PRK07252, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240212 cd05707, S1_Rrp5_repeat_sc11, S1_Rrp5_repeat_sc11: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|217832 pfam03989, DNA_gyraseA_C, DNA gyrase C-terminal domain, beta-propeller | Back alignment and domain information |
|---|
| >gnl|CDD|240202 cd05697, S1_Rrp5_repeat_hs5, S1_Rrp5_repeat_hs5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|233703 TIGR02063, RNase_R, ribonuclease R | Back alignment and domain information |
|---|
| >gnl|CDD|239911 cd04465, S1_RPS1_repeat_ec2_hs2, S1_RPS1_repeat_ec2_hs2: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|240212 cd05707, S1_Rrp5_repeat_sc11, S1_Rrp5_repeat_sc11: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|239918 cd04472, S1_PNPase, S1_PNPase: Polynucleotide phosphorylase (PNPase), ), S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|234271 TIGR03591, polynuc_phos, polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|224027 COG1102, Cmk, Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|239907 cd04460, S1_RpoE, S1_RpoE: RpoE, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|236305 PRK08582, PRK08582, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236289 PRK08563, PRK08563, DNA-directed RNA polymerase subunit E'; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235244 PRK04182, PRK04182, cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239919 cd04473, S1_RecJ_like, S1_RecJ_like: The S1 domain of the archaea-specific RecJ-like exonuclease | Back alignment and domain information |
|---|
| >gnl|CDD|224032 COG1107, COG1107, Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|240203 cd05698, S1_Rrp5_repeat_hs6_sc5, S1_Rrp5_repeat_hs6_sc5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|239907 cd04460, S1_RpoE, S1_RpoE: RpoE, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|224020 COG1095, RPB7, DNA-directed RNA polymerase, subunit E' [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|131743 TIGR02696, pppGpp_PNP, guanosine pentaphosphate synthetase I/polynucleotide phosphorylase | Back alignment and domain information |
|---|
| >gnl|CDD|131743 TIGR02696, pppGpp_PNP, guanosine pentaphosphate synthetase I/polynucleotide phosphorylase | Back alignment and domain information |
|---|
| >gnl|CDD|236289 PRK08563, PRK08563, DNA-directed RNA polymerase subunit E'; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233703 TIGR02063, RNase_R, ribonuclease R | Back alignment and domain information |
|---|
| >gnl|CDD|239919 cd04473, S1_RecJ_like, S1_RecJ_like: The S1 domain of the archaea-specific RecJ-like exonuclease | Back alignment and domain information |
|---|
| >gnl|CDD|240210 cd05705, S1_Rrp5_repeat_hs14, S1_Rrp5_repeat_hs14: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|240211 cd05706, S1_Rrp5_repeat_sc10, S1_Rrp5_repeat_sc10: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|223631 COG0557, VacB, Exoribonuclease R [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|240191 cd05686, S1_pNO40, S1_pNO40: pNO40 , S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|235188 PRK03987, PRK03987, translation initiation factor IF-2 subunit alpha; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|240203 cd05698, S1_Rrp5_repeat_hs6_sc5, S1_Rrp5_repeat_hs6_sc5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|223631 COG0557, VacB, Exoribonuclease R [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|238094 cd00164, S1_like, S1_like: Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|217832 pfam03989, DNA_gyraseA_C, DNA gyrase C-terminal domain, beta-propeller | Back alignment and domain information |
|---|
| >gnl|CDD|240203 cd05698, S1_Rrp5_repeat_hs6_sc5, S1_Rrp5_repeat_hs6_sc5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1619 | |||
| PRK13979 | 957 | DNA topoisomerase IV subunit A; Provisional | 100.0 | |
| COG0188 | 804 | GyrA Type IIA topoisomerase (DNA gyrase/topo II, t | 100.0 | |
| TIGR01063 | 800 | gyrA DNA gyrase, A subunit. This model describes t | 100.0 | |
| PRK05560 | 805 | DNA gyrase subunit A; Validated | 100.0 | |
| TIGR01061 | 738 | parC_Gpos DNA topoisomerase IV, A subunit, Gram-po | 100.0 | |
| PRK05561 | 742 | DNA topoisomerase IV subunit A; Validated | 100.0 | |
| TIGR01062 | 735 | parC_Gneg DNA topoisomerase IV, A subunit, proteob | 100.0 | |
| PRK09631 | 635 | DNA topoisomerase IV subunit A; Provisional | 100.0 | |
| PRK12758 | 869 | DNA topoisomerase IV subunit A; Provisional | 100.0 | |
| cd00187 | 445 | TOP4c DNA Topoisomerase, subtype IIA; domain A'; b | 100.0 | |
| smart00434 | 445 | TOP4c DNA Topoisomerase IV. Bacterial DNA topoisom | 100.0 | |
| PRK12269 | 863 | bifunctional cytidylate kinase/ribosomal protein S | 100.0 | |
| PHA02592 | 439 | 52 DNA topisomerase II medium subunit; Provisional | 100.0 | |
| PF00521 | 426 | DNA_topoisoIV: DNA gyrase/topoisomerase IV, subuni | 100.0 | |
| PRK09630 | 479 | DNA topoisomerase IV subunit A; Provisional | 100.0 | |
| PLN03128 | 1135 | DNA topoisomerase 2; Provisional | 100.0 | |
| PLN03237 | 1465 | DNA topoisomerase 2; Provisional | 100.0 | |
| PTZ00108 | 1388 | DNA topoisomerase 2-like protein; Provisional | 100.0 | |
| COG0539 | 541 | RpsA Ribosomal protein S1 [Translation, ribosomal | 100.0 | |
| PRK06299 | 565 | rpsA 30S ribosomal protein S1; Reviewed | 100.0 | |
| TIGR00717 | 516 | rpsA ribosomal protein S1. This model provides tru | 100.0 | |
| PRK13806 | 491 | rpsA 30S ribosomal protein S1; Provisional | 100.0 | |
| COG0539 | 541 | RpsA Ribosomal protein S1 [Translation, ribosomal | 100.0 | |
| PRK13806 | 491 | rpsA 30S ribosomal protein S1; Provisional | 100.0 | |
| PRK12269 | 863 | bifunctional cytidylate kinase/ribosomal protein S | 100.0 | |
| PRK06299 | 565 | rpsA 30S ribosomal protein S1; Reviewed | 100.0 | |
| TIGR00717 | 516 | rpsA ribosomal protein S1. This model provides tru | 100.0 | |
| COG0283 | 222 | Cmk Cytidylate kinase [Nucleotide transport and me | 100.0 | |
| PRK07899 | 486 | rpsA 30S ribosomal protein S1; Reviewed | 100.0 | |
| PRK07899 | 486 | rpsA 30S ribosomal protein S1; Reviewed | 100.0 | |
| PRK06676 | 390 | rpsA 30S ribosomal protein S1; Reviewed | 100.0 | |
| PRK06676 | 390 | rpsA 30S ribosomal protein S1; Reviewed | 100.0 | |
| PRK00087 | 647 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | 100.0 | |
| PRK00087 | 647 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | 100.0 | |
| PRK11860 | 661 | bifunctional 3-phosphoshikimate 1-carboxyvinyltran | 100.0 | |
| PRK07400 | 318 | 30S ribosomal protein S1; Reviewed | 100.0 | |
| PF02224 | 157 | Cytidylate_kin: Cytidylate kinase; InterPro: IPR01 | 100.0 | |
| TIGR00017 | 217 | cmk cytidylate kinase. This family consists of cyt | 100.0 | |
| KOG1070|consensus | 1710 | 100.0 | ||
| KOG0355|consensus | 842 | 100.0 | ||
| KOG1070|consensus | 1710 | 100.0 | ||
| PRK13477 | 512 | bifunctional pantoate ligase/cytidylate kinase; Pr | 100.0 | |
| PRK07400 | 318 | 30S ribosomal protein S1; Reviewed | 100.0 | |
| PRK09518 | 712 | bifunctional cytidylate kinase/GTPase Der; Reviewe | 100.0 | |
| PRK00023 | 225 | cmk cytidylate kinase; Provisional | 100.0 | |
| PRK13979 | 957 | DNA topoisomerase IV subunit A; Provisional | 99.97 | |
| TIGR01061 | 738 | parC_Gpos DNA topoisomerase IV, A subunit, Gram-po | 99.96 | |
| TIGR01063 | 800 | gyrA DNA gyrase, A subunit. This model describes t | 99.95 | |
| PRK05561 | 742 | DNA topoisomerase IV subunit A; Validated | 99.94 | |
| PRK05560 | 805 | DNA gyrase subunit A; Validated | 99.94 | |
| TIGR01062 | 735 | parC_Gneg DNA topoisomerase IV, A subunit, proteob | 99.93 | |
| COG0188 | 804 | GyrA Type IIA topoisomerase (DNA gyrase/topo II, t | 99.91 | |
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 99.91 | |
| KOG0355|consensus | 842 | 99.85 | ||
| PF13189 | 179 | Cytidylate_kin2: Cytidylate kinase-like family; PD | 99.71 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 99.66 | |
| TIGR02173 | 171 | cyt_kin_arch cytidylate kinase, putative. Proteins | 99.65 | |
| PTZ00248 | 319 | eukaryotic translation initiation factor 2 subunit | 99.64 | |
| PTZ00248 | 319 | eukaryotic translation initiation factor 2 subunit | 99.58 | |
| COG2996 | 287 | Predicted RNA-bindining protein (contains S1 and H | 99.57 | |
| PRK04182 | 180 | cytidylate kinase; Provisional | 99.57 | |
| COG1098 | 129 | VacB Predicted RNA binding protein (contains ribos | 99.44 | |
| COG2996 | 287 | Predicted RNA-bindining protein (contains S1 and H | 99.38 | |
| cd05705 | 74 | S1_Rrp5_repeat_hs14 S1_Rrp5_repeat_hs14: Rrp5 is a | 99.35 | |
| cd05703 | 73 | S1_Rrp5_repeat_hs12_sc9 S1_Rrp5_repeat_hs12_sc9: R | 99.33 | |
| COG1098 | 129 | VacB Predicted RNA binding protein (contains ribos | 99.32 | |
| cd05705 | 74 | S1_Rrp5_repeat_hs14 S1_Rrp5_repeat_hs14: Rrp5 is a | 99.29 | |
| cd05694 | 74 | S1_Rrp5_repeat_hs2_sc2 S1_Rrp5_repeat_hs2_sc2: Rrp | 99.26 | |
| cd05703 | 73 | S1_Rrp5_repeat_hs12_sc9 S1_Rrp5_repeat_hs12_sc9: R | 99.24 | |
| cd05694 | 74 | S1_Rrp5_repeat_hs2_sc2 S1_Rrp5_repeat_hs2_sc2: Rrp | 99.2 | |
| PRK08582 | 139 | hypothetical protein; Provisional | 99.19 | |
| PF00575 | 74 | S1: S1 RNA binding domain; InterPro: IPR003029 Rib | 99.18 | |
| cd05698 | 70 | S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp | 99.17 | |
| PF00575 | 74 | S1: S1 RNA binding domain; InterPro: IPR003029 Rib | 99.17 | |
| cd05696 | 71 | S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a t | 99.15 | |
| cd05697 | 69 | S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a t | 99.13 | |
| PRK08582 | 139 | hypothetical protein; Provisional | 99.13 | |
| cd04461 | 83 | S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp | 99.12 | |
| cd05696 | 71 | S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a t | 99.12 | |
| cd05690 | 69 | S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal p | 99.11 | |
| cd05706 | 73 | S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a | 99.11 | |
| cd05697 | 69 | S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a t | 99.1 | |
| cd05704 | 72 | S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a | 99.1 | |
| cd04461 | 83 | S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp | 99.09 | |
| cd05698 | 70 | S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp | 99.09 | |
| cd05689 | 72 | S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal p | 99.09 | |
| cd05704 | 72 | S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a | 99.07 | |
| cd05706 | 73 | S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a | 99.07 | |
| cd05707 | 68 | S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a | 99.07 | |
| PRK07252 | 120 | hypothetical protein; Provisional | 99.06 | |
| cd05695 | 66 | S1_Rrp5_repeat_hs3 S1_Rrp5_repeat_hs3: Rrp5 is a t | 99.03 | |
| cd05690 | 69 | S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal p | 99.03 | |
| cd04452 | 76 | S1_IF2_alpha S1_IF2_alpha: The alpha subunit of tr | 99.02 | |
| cd05686 | 73 | S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding dom | 99.01 | |
| PRK13946 | 184 | shikimate kinase; Provisional | 99.01 | |
| cd05691 | 73 | S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal p | 99.01 | |
| cd05708 | 77 | S1_Rrp5_repeat_sc12 S1_Rrp5_repeat_sc12: Rrp5 is a | 99.0 | |
| cd05693 | 100 | S1_Rrp5_repeat_hs1_sc1 S1_Rrp5_repeat_hs1_sc1: Rrp | 99.0 | |
| cd05707 | 68 | S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a | 99.0 | |
| cd05693 | 100 | S1_Rrp5_repeat_hs1_sc1 S1_Rrp5_repeat_hs1_sc1: Rrp | 99.0 | |
| PRK07252 | 120 | hypothetical protein; Provisional | 99.0 | |
| cd05689 | 72 | S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal p | 98.99 | |
| cd05686 | 73 | S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding dom | 98.98 | |
| cd04452 | 76 | S1_IF2_alpha S1_IF2_alpha: The alpha subunit of tr | 98.96 | |
| cd05708 | 77 | S1_Rrp5_repeat_sc12 S1_Rrp5_repeat_sc12: Rrp5 is a | 98.95 | |
| PRK08059 | 123 | general stress protein 13; Validated | 98.95 | |
| COG1936 | 180 | Predicted nucleotide kinase (related to CMP and AM | 98.94 | |
| cd05695 | 66 | S1_Rrp5_repeat_hs3 S1_Rrp5_repeat_hs3: Rrp5 is a t | 98.94 | |
| PRK05807 | 136 | hypothetical protein; Provisional | 98.93 | |
| cd05687 | 70 | S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Rib | 98.93 | |
| cd05684 | 79 | S1_DHX8_helicase S1_DHX8_helicase: The N-terminal | 98.93 | |
| cd05691 | 73 | S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal p | 98.92 | |
| cd05687 | 70 | S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Rib | 98.9 | |
| PRK08059 | 123 | general stress protein 13; Validated | 98.89 | |
| PLN00207 | 891 | polyribonucleotide nucleotidyltransferase; Provisi | 98.89 | |
| PRK05807 | 136 | hypothetical protein; Provisional | 98.86 | |
| PLN00207 | 891 | polyribonucleotide nucleotidyltransferase; Provisi | 98.86 | |
| cd05692 | 69 | S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal p | 98.86 | |
| cd05684 | 79 | S1_DHX8_helicase S1_DHX8_helicase: The N-terminal | 98.84 | |
| cd04465 | 67 | S1_RPS1_repeat_ec2_hs2 S1_RPS1_repeat_ec2_hs2: Rib | 98.84 | |
| cd05692 | 69 | S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal p | 98.83 | |
| cd05789 | 86 | S1_Rrp4 S1_Rrp4: Rrp4 S1-like RNA-binding domain. | 98.82 | |
| cd05685 | 68 | S1_Tex S1_Tex: The C-terminal S1 domain of a trans | 98.81 | |
| cd04465 | 67 | S1_RPS1_repeat_ec2_hs2 S1_RPS1_repeat_ec2_hs2: Rib | 98.81 | |
| cd05789 | 86 | S1_Rrp4 S1_Rrp4: Rrp4 S1-like RNA-binding domain. | 98.77 | |
| smart00316 | 72 | S1 Ribosomal protein S1-like RNA-binding domain. | 98.75 | |
| cd05685 | 68 | S1_Tex S1_Tex: The C-terminal S1 domain of a trans | 98.75 | |
| PHA02945 | 88 | interferon resistance protein; Provisional | 98.75 | |
| cd05688 | 68 | S1_RPS1_repeat_ec3 S1_RPS1_repeat_ec3: Ribosomal p | 98.74 | |
| cd04472 | 68 | S1_PNPase S1_PNPase: Polynucleotide phosphorylase | 98.71 | |
| smart00316 | 72 | S1 Ribosomal protein S1-like RNA-binding domain. | 98.69 | |
| cd04471 | 83 | S1_RNase_R S1_RNase_R: RNase R C-terminal S1 domai | 98.67 | |
| PHA02945 | 88 | interferon resistance protein; Provisional | 98.67 | |
| cd04472 | 68 | S1_PNPase S1_PNPase: Polynucleotide phosphorylase | 98.67 | |
| PRK13947 | 171 | shikimate kinase; Provisional | 98.66 | |
| cd05688 | 68 | S1_RPS1_repeat_ec3 S1_RPS1_repeat_ec3: Ribosomal p | 98.65 | |
| TIGR02696 | 719 | pppGpp_PNP guanosine pentaphosphate synthetase I/p | 98.65 | |
| cd04453 | 88 | S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-lik | 98.64 | |
| PRK09521 | 189 | exosome complex RNA-binding protein Csl4; Provisio | 98.64 | |
| COG1093 | 269 | SUI2 Translation initiation factor 2, alpha subuni | 98.64 | |
| PRK03987 | 262 | translation initiation factor IF-2 subunit alpha; | 98.62 | |
| cd05702 | 70 | S1_Rrp5_repeat_hs11_sc8 S1_Rrp5_repeat_hs11_sc8: R | 98.6 | |
| cd04453 | 88 | S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-lik | 98.59 | |
| PRK09521 | 189 | exosome complex RNA-binding protein Csl4; Provisio | 98.59 | |
| TIGR02696 | 719 | pppGpp_PNP guanosine pentaphosphate synthetase I/p | 98.57 | |
| cd04473 | 77 | S1_RecJ_like S1_RecJ_like: The S1 domain of the ar | 98.56 | |
| cd04471 | 83 | S1_RNase_R S1_RNase_R: RNase R C-terminal S1 domai | 98.56 | |
| PRK08154 | 309 | anaerobic benzoate catabolism transcriptional regu | 98.55 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 98.54 | |
| cd04454 | 82 | S1_Rrp4_like S1_Rrp4_like: Rrp4-like, S1-like RNA- | 98.54 | |
| PRK03987 | 262 | translation initiation factor IF-2 subunit alpha; | 98.54 | |
| cd05702 | 70 | S1_Rrp5_repeat_hs11_sc8 S1_Rrp5_repeat_hs11_sc8: R | 98.53 | |
| COG1093 | 269 | SUI2 Translation initiation factor 2, alpha subuni | 98.5 | |
| cd04473 | 77 | S1_RecJ_like S1_RecJ_like: The S1 domain of the ar | 98.5 | |
| cd04454 | 82 | S1_Rrp4_like S1_Rrp4_like: Rrp4-like, S1-like RNA- | 98.48 | |
| cd00164 | 65 | S1_like S1_like: Ribosomal protein S1-like RNA-bin | 98.44 | |
| PRK11824 | 693 | polynucleotide phosphorylase/polyadenylase; Provis | 98.43 | |
| PRK11824 | 693 | polynucleotide phosphorylase/polyadenylase; Provis | 98.43 | |
| PRK09202 | 470 | nusA transcription elongation factor NusA; Validat | 98.42 | |
| COG2183 | 780 | Tex Transcriptional accessory protein [Transcripti | 98.42 | |
| COG2183 | 780 | Tex Transcriptional accessory protein [Transcripti | 98.42 | |
| PRK01184 | 184 | hypothetical protein; Provisional | 98.4 | |
| cd00164 | 65 | S1_like S1_like: Ribosomal protein S1-like RNA-bin | 98.4 | |
| PRK09202 | 470 | nusA transcription elongation factor NusA; Validat | 98.38 | |
| cd04460 | 99 | S1_RpoE S1_RpoE: RpoE, S1-like RNA-binding domain. | 98.34 | |
| PF03989 | 48 | DNA_gyraseA_C: DNA gyrase C-terminal domain, beta- | 98.29 | |
| PF03989 | 48 | DNA_gyraseA_C: DNA gyrase C-terminal domain, beta- | 98.28 | |
| PRK03839 | 180 | putative kinase; Provisional | 98.28 | |
| PRK04163 | 235 | exosome complex RNA-binding protein Rrp4; Provisio | 98.27 | |
| cd04460 | 99 | S1_RpoE S1_RpoE: RpoE, S1-like RNA-binding domain. | 98.23 | |
| cd04455 | 67 | S1_NusA S1_NusA: N-utilizing substance A protein ( | 98.18 | |
| PRK04163 | 235 | exosome complex RNA-binding protein Rrp4; Provisio | 98.17 | |
| PRK13949 | 169 | shikimate kinase; Provisional | 98.13 | |
| TIGR03591 | 684 | polynuc_phos polyribonucleotide nucleotidyltransfe | 98.13 | |
| cd04455 | 67 | S1_NusA S1_NusA: N-utilizing substance A protein ( | 98.13 | |
| COG1185 | 692 | Pnp Polyribonucleotide nucleotidyltransferase (pol | 98.11 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 98.08 | |
| PRK14733 | 204 | coaE dephospho-CoA kinase; Provisional | 98.07 | |
| COG1107 | 715 | Archaea-specific RecJ-like exonuclease, contains D | 98.04 | |
| PRK03731 | 171 | aroL shikimate kinase II; Reviewed | 98.04 | |
| COG1185 | 692 | Pnp Polyribonucleotide nucleotidyltransferase (pol | 98.03 | |
| cd00464 | 154 | SK Shikimate kinase (SK) is the fifth enzyme in th | 98.01 | |
| TIGR00448 | 179 | rpoE DNA-directed RNA polymerase (rpoE), archaeal | 98.0 | |
| PRK13948 | 182 | shikimate kinase; Provisional | 98.0 | |
| PRK05057 | 172 | aroK shikimate kinase I; Reviewed | 98.0 | |
| PRK12327 | 362 | nusA transcription elongation factor NusA; Provisi | 97.98 | |
| PRK09631 | 635 | DNA topoisomerase IV subunit A; Provisional | 97.98 | |
| TIGR03591 | 684 | polynuc_phos polyribonucleotide nucleotidyltransfe | 97.96 | |
| TIGR00448 | 179 | rpoE DNA-directed RNA polymerase (rpoE), archaeal | 97.93 | |
| PLN02199 | 303 | shikimate kinase | 97.93 | |
| PRK14021 | 542 | bifunctional shikimate kinase/3-dehydroquinate syn | 97.88 | |
| PRK00081 | 194 | coaE dephospho-CoA kinase; Reviewed | 97.88 | |
| PRK14730 | 195 | coaE dephospho-CoA kinase; Provisional | 97.86 | |
| KOG3354|consensus | 191 | 97.86 | ||
| COG3265 | 161 | GntK Gluconate kinase [Carbohydrate transport and | 97.85 | |
| COG0703 | 172 | AroK Shikimate kinase [Amino acid transport and me | 97.84 | |
| PF01202 | 158 | SKI: Shikimate kinase; InterPro: IPR000623 Shikima | 97.84 | |
| TIGR01953 | 341 | NusA transcription termination factor NusA. This m | 97.82 | |
| PRK06217 | 183 | hypothetical protein; Validated | 97.82 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 97.78 | |
| PRK14732 | 196 | coaE dephospho-CoA kinase; Provisional | 97.78 | |
| TIGR01953 | 341 | NusA transcription termination factor NusA. This m | 97.76 | |
| TIGR02063 | 709 | RNase_R ribonuclease R. This family consists of an | 97.76 | |
| PTZ00451 | 244 | dephospho-CoA kinase; Provisional | 97.75 | |
| PRK14734 | 200 | coaE dephospho-CoA kinase; Provisional | 97.74 | |
| PRK11642 | 813 | exoribonuclease R; Provisional | 97.73 | |
| PRK12758 | 869 | DNA topoisomerase IV subunit A; Provisional | 97.72 | |
| KOG1067|consensus | 760 | 97.72 | ||
| PRK00625 | 173 | shikimate kinase; Provisional | 97.71 | |
| PRK07429 | 327 | phosphoribulokinase; Provisional | 97.7 | |
| KOG1067|consensus | 760 | 97.67 | ||
| PLN02422 | 232 | dephospho-CoA kinase | 97.64 | |
| PRK14532 | 188 | adenylate kinase; Provisional | 97.62 | |
| TIGR00358 | 654 | 3_prime_RNase VacB and RNase II family 3'-5' exori | 97.62 | |
| TIGR00152 | 188 | dephospho-CoA kinase. This model produces scores i | 97.6 | |
| TIGR02063 | 709 | RNase_R ribonuclease R. This family consists of an | 97.59 | |
| COG0237 | 201 | CoaE Dephospho-CoA kinase [Coenzyme metabolism] | 97.59 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 97.58 | |
| cd02022 | 179 | DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 | 97.58 | |
| cd05791 | 92 | S1_CSL4 S1_CSL4: CSL4, S1-like RNA-binding domain. | 97.57 | |
| PLN02200 | 234 | adenylate kinase family protein | 97.54 | |
| KOG3347|consensus | 176 | 97.53 | ||
| COG1095 | 183 | RPB7 DNA-directed RNA polymerase, subunit E' [Tran | 97.51 | |
| cd05699 | 72 | S1_Rrp5_repeat_hs7 S1_Rrp5_repeat_hs7: Rrp5 is a t | 97.5 | |
| PRK14528 | 186 | adenylate kinase; Provisional | 97.49 | |
| PRK11642 | 813 | exoribonuclease R; Provisional | 97.48 | |
| cd05791 | 92 | S1_CSL4 S1_CSL4: CSL4, S1-like RNA-binding domain. | 97.47 | |
| PRK03333 | 395 | coaE dephospho-CoA kinase/protein folding accessor | 97.45 | |
| TIGR00358 | 654 | 3_prime_RNase VacB and RNase II family 3'-5' exori | 97.45 | |
| COG1095 | 183 | RPB7 DNA-directed RNA polymerase, subunit E' [Tran | 97.44 | |
| PRK08563 | 187 | DNA-directed RNA polymerase subunit E'; Provisiona | 97.41 | |
| cd05699 | 72 | S1_Rrp5_repeat_hs7 S1_Rrp5_repeat_hs7: Rrp5 is a t | 97.4 | |
| PRK13808 | 333 | adenylate kinase; Provisional | 97.4 | |
| PRK14731 | 208 | coaE dephospho-CoA kinase; Provisional | 97.39 | |
| PRK12327 | 362 | nusA transcription elongation factor NusA; Provisi | 97.39 | |
| cd02026 | 273 | PRK Phosphoribulokinase (PRK) is an enzyme involve | 97.38 | |
| PRK00279 | 215 | adk adenylate kinase; Reviewed | 97.36 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 97.35 | |
| COG0572 | 218 | Udk Uridine kinase [Nucleotide transport and metab | 97.32 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 97.27 | |
| PRK08563 | 187 | DNA-directed RNA polymerase subunit E'; Provisiona | 97.24 | |
| PRK13975 | 196 | thymidylate kinase; Provisional | 97.23 | |
| KOG3079|consensus | 195 | 97.22 | ||
| PRK13951 | 488 | bifunctional shikimate kinase/3-dehydroquinate syn | 97.19 | |
| PRK02496 | 184 | adk adenylate kinase; Provisional | 97.18 | |
| COG0529 | 197 | CysC Adenylylsulfate kinase and related kinases [I | 97.12 | |
| PHA02858 | 86 | EIF2a-like PKR inhibitor; Provisional | 97.08 | |
| TIGR01351 | 210 | adk adenylate kinases. Adenylate kinase (EC 2.7.4. | 97.07 | |
| PHA02858 | 86 | EIF2a-like PKR inhibitor; Provisional | 97.05 | |
| TIGR01313 | 163 | therm_gnt_kin carbohydrate kinase, thermoresistant | 97.01 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 97.01 | |
| PRK14526 | 211 | adenylate kinase; Provisional | 96.99 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 96.99 | |
| PLN02674 | 244 | adenylate kinase | 96.95 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 96.94 | |
| PRK14531 | 183 | adenylate kinase; Provisional | 96.93 | |
| PRK03846 | 198 | adenylylsulfate kinase; Provisional | 96.93 | |
| PLN02348 | 395 | phosphoribulokinase | 96.92 | |
| PF01121 | 180 | CoaE: Dephospho-CoA kinase; InterPro: IPR001977 Th | 96.91 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 96.89 | |
| PRK05537 | 568 | bifunctional sulfate adenylyltransferase subunit 1 | 96.87 | |
| PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 96.83 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 96.83 | |
| COG1097 | 239 | RRP4 RNA-binding protein Rrp4 and related proteins | 96.82 | |
| PLN02459 | 261 | probable adenylate kinase | 96.71 | |
| cd04462 | 88 | S1_RNAPII_Rpb7 S1_RNAPII_Rpb7: Eukaryotic RNA poly | 96.7 | |
| PRK11545 | 163 | gntK gluconate kinase 1; Provisional | 96.69 | |
| PRK08356 | 195 | hypothetical protein; Provisional | 96.64 | |
| PTZ00301 | 210 | uridine kinase; Provisional | 96.62 | |
| COG1097 | 239 | RRP4 RNA-binding protein Rrp4 and related proteins | 96.62 | |
| PRK05416 | 288 | glmZ(sRNA)-inactivating NTPase; Provisional | 96.61 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 96.58 | |
| COG1107 | 715 | Archaea-specific RecJ-like exonuclease, contains D | 96.55 | |
| cd04462 | 88 | S1_RNAPII_Rpb7 S1_RNAPII_Rpb7: Eukaryotic RNA poly | 96.52 | |
| PRK05054 | 644 | exoribonuclease II; Provisional | 96.48 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 96.48 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 96.48 | |
| PRK15453 | 290 | phosphoribulokinase; Provisional | 96.47 | |
| TIGR00455 | 184 | apsK adenylylsulfate kinase (apsK). Important resi | 96.46 | |
| PRK12328 | 374 | nusA transcription elongation factor NusA; Provisi | 96.44 | |
| PF03668 | 284 | ATP_bind_2: P-loop ATPase protein family; InterPro | 96.43 | |
| PRK14529 | 223 | adenylate kinase; Provisional | 96.43 | |
| PF07931 | 174 | CPT: Chloramphenicol phosphotransferase-like prote | 96.41 | |
| PRK14527 | 191 | adenylate kinase; Provisional | 96.41 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 96.36 | |
| PRK12328 | 374 | nusA transcription elongation factor NusA; Provisi | 96.31 | |
| cd02029 | 277 | PRK_like Phosphoribulokinase-like (PRK-like) is a | 96.29 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 96.29 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 96.24 | |
| cd01428 | 194 | ADK Adenylate kinase (ADK) catalyzes the reversibl | 96.24 | |
| TIGR00757 | 414 | RNaseEG ribonuclease, Rne/Rng family. The C-termin | 96.21 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 96.2 | |
| PRK09825 | 176 | idnK D-gluconate kinase; Provisional | 96.19 | |
| KOG2916|consensus | 304 | 96.16 | ||
| PF13509 | 61 | S1_2: S1 domain; PDB: 3GO5_A. | 96.08 | |
| PRK06696 | 223 | uridine kinase; Validated | 96.07 | |
| PTZ00088 | 229 | adenylate kinase 1; Provisional | 96.07 | |
| cd05790 | 86 | S1_Rrp40 S1_Rrp40: Rrp40 S1-like RNA-binding domai | 95.97 | |
| PF13509 | 61 | S1_2: S1 domain; PDB: 3GO5_A. | 95.92 | |
| PF00485 | 194 | PRK: Phosphoribulokinase / Uridine kinase family; | 95.92 | |
| cd05790 | 86 | S1_Rrp40 S1_Rrp40: Rrp40 S1-like RNA-binding domai | 95.91 | |
| PTZ00162 | 176 | DNA-directed RNA polymerase II subunit 7; Provisio | 95.89 | |
| PRK12338 | 319 | hypothetical protein; Provisional | 95.79 | |
| PTZ00162 | 176 | DNA-directed RNA polymerase II subunit 7; Provisio | 95.79 | |
| TIGR00757 | 414 | RNaseEG ribonuclease, Rne/Rng family. The C-termin | 95.72 | |
| PRK12329 | 449 | nusA transcription elongation factor NusA; Provisi | 95.62 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 95.61 | |
| cd02024 | 187 | NRK1 Nicotinamide riboside kinase (NRK) is an enzy | 95.6 | |
| TIGR02062 | 639 | RNase_B exoribonuclease II. This family consists o | 95.58 | |
| KOG2916|consensus | 304 | 95.55 | ||
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 95.54 | |
| PF01583 | 156 | APS_kinase: Adenylylsulphate kinase; InterPro: IPR | 95.51 | |
| PF00406 | 151 | ADK: Adenylate kinase; InterPro: IPR000850 Adenyla | 95.47 | |
| KOG1856|consensus | 1299 | 95.47 | ||
| PRK05054 | 644 | exoribonuclease II; Provisional | 95.42 | |
| COG1096 | 188 | Predicted RNA-binding protein (consists of S1 doma | 95.39 | |
| KOG1856|consensus | 1299 | 95.38 | ||
| PRK12329 | 449 | nusA transcription elongation factor NusA; Provisi | 95.34 | |
| COG1660 | 286 | Predicted P-loop-containing kinase [General functi | 95.3 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 95.27 | |
| PF10447 | 82 | EXOSC1: Exosome component EXOSC1/CSL4; InterPro: I | 95.1 | |
| COG0557 | 706 | VacB Exoribonuclease R [Transcription] | 94.96 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 94.94 | |
| PF10447 | 82 | EXOSC1: Exosome component EXOSC1/CSL4; InterPro: I | 94.85 | |
| PRK12339 | 197 | 2-phosphoglycerate kinase; Provisional | 94.85 | |
| COG1096 | 188 | Predicted RNA-binding protein (consists of S1 doma | 94.78 | |
| TIGR02062 | 639 | RNase_B exoribonuclease II. This family consists o | 94.77 | |
| COG2019 | 189 | AdkA Archaeal adenylate kinase [Nucleotide transpo | 94.75 | |
| cd05700 | 65 | S1_Rrp5_repeat_hs9 S1_Rrp5_repeat_hs9: Rrp5 is a t | 94.72 | |
| PLN02842 | 505 | nucleotide kinase | 94.64 | |
| PRK05506 | 632 | bifunctional sulfate adenylyltransferase subunit 1 | 94.36 | |
| PRK14737 | 186 | gmk guanylate kinase; Provisional | 94.15 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 93.96 | |
| PRK05439 | 311 | pantothenate kinase; Provisional | 93.94 | |
| TIGR00041 | 195 | DTMP_kinase thymidylate kinase. Function: phosphor | 93.81 | |
| COG0557 | 706 | VacB Exoribonuclease R [Transcription] | 93.8 | |
| cd02028 | 179 | UMPK_like Uridine monophosphate kinase_like (UMPK_ | 93.79 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 93.75 | |
| PRK00698 | 205 | tmk thymidylate kinase; Validated | 93.65 | |
| PRK09270 | 229 | nucleoside triphosphate hydrolase domain-containin | 93.62 | |
| PRK13973 | 213 | thymidylate kinase; Provisional | 93.56 | |
| PRK07667 | 193 | uridine kinase; Provisional | 93.43 | |
| KOG1240|consensus | 1431 | 93.31 | ||
| PLN02318 | 656 | phosphoribulokinase/uridine kinase | 93.29 | |
| cd02030 | 219 | NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO | 93.12 | |
| cd01672 | 200 | TMPK Thymidine monophosphate kinase (TMPK), also k | 92.7 | |
| KOG3220|consensus | 225 | 92.57 | ||
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 91.84 | |
| PRK10811 | 1068 | rne ribonuclease E; Reviewed | 91.2 | |
| PRK04220 | 301 | 2-phosphoglycerate kinase; Provisional | 90.81 | |
| COG2074 | 299 | 2-phosphoglycerate kinase [Carbohydrate transport | 90.55 | |
| PRK11712 | 489 | ribonuclease G; Provisional | 89.94 | |
| PF10246 | 104 | MRP-S35: Mitochondrial ribosomal protein MRP-S35; | 89.12 | |
| PRK10811 | 1068 | rne ribonuclease E; Reviewed | 88.87 | |
| KOG3298|consensus | 170 | 88.49 | ||
| PF08292 | 122 | RNA_pol_Rbc25: RNA polymerase III subunit Rpc25; I | 87.99 | |
| PRK11784 | 345 | tRNA 2-selenouridine synthase; Provisional | 87.38 | |
| cd01673 | 193 | dNK Deoxyribonucleoside kinase (dNK) catalyzes the | 86.73 | |
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 86.63 | |
| PLN02924 | 220 | thymidylate kinase | 86.31 | |
| PRK12337 | 475 | 2-phosphoglycerate kinase; Provisional | 86.3 | |
| PF01745 | 233 | IPT: Isopentenyl transferase; InterPro: IPR002648 | 85.74 | |
| PRK13976 | 209 | thymidylate kinase; Provisional | 85.38 | |
| PRK11712 | 489 | ribonuclease G; Provisional | 85.21 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 85.07 | |
| smart00072 | 184 | GuKc Guanylate kinase homologues. Active enzymes c | 84.7 | |
| KOG3409|consensus | 193 | 84.45 | ||
| KOG3409|consensus | 193 | 83.15 | ||
| PF02223 | 186 | Thymidylate_kin: Thymidylate kinase; InterPro: IPR | 83.0 | |
| PF08292 | 122 | RNA_pol_Rbc25: RNA polymerase III subunit Rpc25; I | 82.87 | |
| PRK14738 | 206 | gmk guanylate kinase; Provisional | 81.58 | |
| PLN02165 | 334 | adenylate isopentenyltransferase | 81.49 | |
| PRK00300 | 205 | gmk guanylate kinase; Provisional | 81.19 | |
| PRK12442 | 87 | translation initiation factor IF-1; Reviewed | 80.86 |
| >PRK13979 DNA topoisomerase IV subunit A; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.7e-195 Score=1871.89 Aligned_cols=817 Identities=38% Similarity=0.620 Sum_probs=771.6
Q ss_pred ccceeccHHHHHHHHHHhhhhhhhccccCCCCccCCCcchhHHHHHHHhcCCCCCCCceeEEEehhhhccCcCCCCcchH
Q psy14505 6 KEVISILLEEEMCKSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMHEMNNLWNRPFVKCARVVGETMGKYHPHGDVSI 85 (1619)
Q Consensus 6 ~~~~~~~~~~~~~~~~~~ya~~~i~~Ralp~~~DGlKp~qRril~~~~~~~~~~~~~~~K~a~~~g~v~~~yhphgd~s~ 85 (1619)
++|.+++|+++|+++|++||||||++|||||+|||||||||||||||+++|++++++|+||||+||+|||+||||||+|+
T Consensus 11 ~~i~~~~~~~~~~~~yl~Ya~~vi~~RAlPd~rDGLKPvqRrILyam~~~~~~~~~~~~K~A~ivG~v~g~YHPHGd~si 90 (957)
T PRK13979 11 NNIIKIPLEEAMPENYLPYAVEVAKDRALPDVRDGLKPVHRRILYGAYMLKAFPDKPYYKSARIVGDILGKYHPHGDSSV 90 (957)
T ss_pred CceeeecHHHHHHHHHHHhHHHHHHhhcCCccccCCCchHhHHHHHHHHcCCCCCCCceeehhhHHhHHhccCCCchHHH
Confidence 36889999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHhhcCccccccccCCCCCCCCCCCcccccccccccccHHHHHhhccCCCCccccccCCCCCcCCcceecCCCce
Q psy14505 86 YDALVRMAQSFSLRCTLVDGQGNFGSIDGDSAAAMRYTECRLNKISNELLIDLDKETIDFISNYDGKEKEPSVLPTRIPN 165 (1619)
Q Consensus 86 ~~~~v~maq~~~~~~pl~~~~GnfGs~~g~~~aa~RY~~~~ls~~~~~~~~~~d~~~~~~~~n~d~~~~eP~~~~~~~P~ 165 (1619)
|||||||||+|+||||||||||||||+|||+||||||||||||++++.||+|+|++||+|+|||||++.||+||||+|||
T Consensus 91 y~alvrmaQ~f~~~~plidg~GnFGs~dgd~~AA~RYte~rl~~~a~~~~~d~d~~~v~~~~n~d~~~~EP~vlp~~~P~ 170 (957)
T PRK13979 91 YDAMVILAQDFTTRMPLIDGHGNWGSIDGDSAAAMRYTEARLTPIAMEMLRDIDKDVVNMVDNYSDSEKEPEVLPARYPN 170 (957)
T ss_pred HHHHHHHhhhccccceeEeCCCCCCCCCCCchhhhhhhhhcchHHHHHHhhccCccccccccCCCCCeeccccccccCCc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred eeecCCcceeeeeecCCCCCChHHHHHHHHHHhcCCCCChHHHhccCCCCCCCCceEEeccccccccceecccEEEEeEE
Q psy14505 166 LLINGSSGIAVGMATNIPPHNLTEVIDGVLYVLHNPECSINDLIKIIPAPDFPTAGIIYGLSSVHDGYYTGKGRVIIRAK 245 (1619)
Q Consensus 166 ~L~ng~~Gia~G~at~ip~~n~~ev~~~~~~~l~~~~~~~~~l~~~~~~p~~p~g~~i~~~~~~~~~y~~g~G~~~~~~~ 245 (1619)
||||||+|||||||||||||||.|||+||+++|++|+++.++||+++|||||||||+|.+.+|+.++|+||+|++.+||+
T Consensus 171 lLvNG~~GIavG~aT~Ipphnl~evi~a~~~~i~~~~~~~~~l~~~~~gpDfptGg~i~~~~~i~~~y~tg~G~~~~r~k 250 (957)
T PRK13979 171 LLVNGAFGIAVGLATNIPPHNLKEVIDGTLAYIDNNEITTKELMNYIKGPDLPTGGILIGKKSLLSAYETGEGKVTLRAK 250 (957)
T ss_pred eeecCCcceeeeeecCCCCCCHHHHHHHHHHHhcCCCCCHHHHhhhccCCCCCCCeEEECchhHHHHhhcCCCCEEEEEE
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred EEEEEeccCCccEEEEEecCCcccHHHHHHHHHHHHhccC----cCCcceeecccCCcceEEEEEecCCCCH---HHHHH
Q psy14505 246 THIEEFNRENRTAIIIDELPYQVNKKSLLEKISQLVKEKK----LECISNLRDESDKSGMRIVIELKRNEIP---EIVLN 318 (1619)
Q Consensus 246 ~~~~~~~~~~~~~i~itelP~~~~~~~~~~~i~~~~~~~~----~~~i~~~~d~s~~~~~~i~i~lk~~~~~---~~~~~ 318 (1619)
+++|.. ..++++|+||||||++|+++|+++|++++.+++ +++|+|+|||||++|+||+|++|+++++ +.+++
T Consensus 251 ~~~e~~-~~~~~~ivitEiPy~~~~~~~~~~i~~l~~~~~~~~~~~~i~~~~desd~~g~rivi~lk~~~~~~~~~~v~~ 329 (957)
T PRK13979 251 TKIEKL-ENGRLGIVITEFPYRRNKAKLLQTISEMTADKKHSKALENISDIRDESDRNGIRAVIEFKKSADEDVAEKVLK 329 (957)
T ss_pred EEEEEc-CCCceEEEEEccCCcccHHHHHHHHHHHHhcccccccCccccchhhccCCCceEEEEEECCCCCcccHHHHHH
Confidence 999864 356778999999999999999999999998876 8999999999999999999999999875 88999
Q ss_pred HHHhhcccccceeeeEEEEECCeeeeeCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhchhHHHHHHH
Q psy14505 319 KLYKQTQLQNTFGMNMLALVNGQPKLLNLKEILYYFILHRKEVIKRRTIFELRKAREYAHILEGLTIALTNIDNFIQIIR 398 (1619)
Q Consensus 319 ~l~k~t~l~~~~~~n~~~~~~~~p~~~~l~~il~~f~~~R~~~~~rR~~~~l~k~~~r~~ileg~~~a~~~id~vi~iir 398 (1619)
+|||+|+||++|++||++|++|+|+.+++++||++|++||+++|+||++|+|+|+++|+||||||++|+++||+||++||
T Consensus 330 ~L~~~t~l~~~~~~n~~~~~~~~p~~~~l~~il~~~~~~r~~~~~rr~~~~l~k~~~r~~i~eGl~~a~~~id~vi~~ir 409 (957)
T PRK13979 330 YLYKKTDLQCNISFNMVALADGKPETMGLKTMLKHYVEHQKEVVTRRTKKELEIAEKRFHIVEGFIKAIGIMDEIIKTIR 409 (957)
T ss_pred HHHHhCCCeeEeeeeEEEEECCEEEEcCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cCCCHHHHHHHHHhhcCCCCchhhhhhcccccccccccccccccccCCCccccCHHHHHHhhccchhhcchHHHHHHHHH
Q psy14505 399 STSTPQEAKNKIIESTWNLPDVSKIIGFNKKNYNTISKINNISKLQNNDMYKLSDIQAQEILKMPLQRLTNMEQKKIINK 478 (1619)
Q Consensus 399 ~s~~~~~a~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Qa~aIL~m~L~~Lt~~e~~~l~~e 478 (1619)
+|+++++|+++||++ |+||+.||+|||+|||||||+||+++|++|
T Consensus 410 ~s~~~~~a~~~l~~~-----------------------------------f~~s~~qa~aIl~mrL~~Lt~le~~kl~~E 454 (957)
T PRK13979 410 SSKSKKDASENLIEK-----------------------------------FGFTDEQAEAILELMLYRLTGLEIVAFEKE 454 (957)
T ss_pred cCCCHHHHHHHHHHH-----------------------------------hCCCHHHHHHHHhCcHHhhhhhHHHHHHHH
Confidence 999999999999986 999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHhcCHHHHHHHHHHHHHHHHHHhCCCCCCCCccccccc--cCCCCccccccCcceEEEEccCccEEe
Q psy14505 479 YENVIKKVIDLTDILSNSKRIIEIITDELNIIKNKYGSHKKNIRRSEIILN--AINPSTEDLIASQDMVITLSNLGYIKS 556 (1619)
Q Consensus 479 ~~~l~~~i~~l~~iL~~~~~~~~~i~~el~~ik~~f~~~~~~~RrT~I~~~--~~~~~~~~li~~e~~~v~ls~~GyiKr 556 (1619)
+++|+++|++|++||+|+++++++|++||.+++++||+ ||||+|.++ +.+++.+++|++|+++|++|++|||||
T Consensus 455 ~~eL~~~I~~l~~iL~~~~~l~~vi~~EL~eik~kygd----~RRT~I~~~~~~~~i~~edlI~~E~v~v~lS~~GyIKr 530 (957)
T PRK13979 455 YKELEKLIKKLTKILSSEKELLKVIKKELKEVKEKYGD----ERRTSIIEDDEKAKIDVEELIVVEDVVITLSNEGFIKR 530 (957)
T ss_pred HHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHHHHhCC----CCCeeeccccccccCCHhHcCCCcceEEEEecCCEEEE
Confidence 99999999999999999999999999999999999999 999999764 346888999999999999999999999
Q ss_pred ccCchhhhcccCCCCccccccCCCCeEEEEEEeeCccEEEEEeeCceEEEEEcccCCCCCccCCCccceeccc-CC-CCc
Q psy14505 557 QPISEYRAQKRGGRGKKAMMTKDEDWINQLFIANTHDYILCFSNYGRLYWLKVWQIPQGSRNSRGKPIINMFS-LK-NKE 634 (1619)
Q Consensus 557 ~~~~~~~~~~r~g~g~~~~~~k~~D~~~~~~~~~t~d~llifT~~Gkv~~i~v~elp~~~~~~~G~~i~~ll~-l~-~~e 634 (1619)
++.++|+.|++| .++++++++|.+.+++.|+|||+|+||||.||+|++++|+||+++|+++|.|+.++++ ++ ++|
T Consensus 531 ~~~~~~~~q~~g---~~~~~~ke~D~i~~~~~~~T~d~LL~FTn~Gkvy~ikvy~IPe~~~~~~G~~I~nll~~~~~~~E 607 (957)
T PRK13979 531 IPLKSYNRSNSN---VEDIEYREGDFNKFLIQSNTKDTLLIFTDKGNMYQIKGINIPEFKWKEKGERLDEIIKGIDLESE 607 (957)
T ss_pred cccccccccccc---ccccccCCCCceEEEEEEcCCCEEEEEECCCeEEEEEeeeCCCCCcCCCCeEHHHhhhccCCCCC
Confidence 999999888665 6678899999999999999999999999999999999999999999999999999996 76 699
Q ss_pred eEEEEEecCCCCCCCCCCcEEEEEeCCceEEEeeCCCCcCCCCCCceeeecCCCCeEEEEEEecCC---CeEEEEeCCce
Q psy14505 635 KITVILPLSNNKRDFPKNNYVFMSTSLGIVKKTLLSNFSNPRKSGIIAVNLSNEDFLIGAALTDGS---YDIMLFSDSGK 711 (1619)
Q Consensus 635 ~i~~i~~~~~~~~~~~~e~~~v~iT~~G~iKr~~~~~~~~~~r~G~~~~~lke~D~l~~~~~~~~~---d~lll~T~~G~ 711 (1619)
+|++++++ +++.++.+++++|++|++||+++++|...++ |+.+++|+++|+|+.+..+++. +.|+++|++|+
T Consensus 608 kIv~i~~~----~ef~~~~~lv~~Tk~G~VKrt~L~ef~~~r~-~~~aikL~e~DeLV~v~~~~~~~~~~~Iil~Tk~G~ 682 (957)
T PRK13979 608 KIIEAYSI----EDFTPQKDFIFITDSGGIKKTSLDKFVTNYT-KLMALKLKKGEKLIKVKLVDRTREEKFIKIKTKKGL 682 (957)
T ss_pred eEEEEEEe----ccCCCCCEEEEEECCCeEEEEehhhcccccc-ceEEEEcCCCCEEEEEEEcCCCCCCCEEEEEeCCCc
Confidence 99999998 4666677899999999999999999987765 7999999999999999999864 56999999999
Q ss_pred EEEEecccccccCCCCCCccceecCCCCEEEEEEEecC------------------------------------------
Q psy14505 712 AVRFNENSVRAMGRSARGVIGMRLEKKQKVIALLVSNN------------------------------------------ 749 (1619)
Q Consensus 712 ~~~~~~~eIp~~~r~a~Gv~~i~L~~~e~Iv~~~~~~~------------------------------------------ 749 (1619)
+++|+..+||++||.++||++|+|.+||+|+++.++++
T Consensus 683 airF~~~eVr~mGR~a~GVkgI~L~~~D~Vv~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~T~d~Ll~FTn 762 (957)
T PRK13979 683 SFTVEEPELEPVDRNIIGYQLFDLLPNDSIKKVDFCDNYEYKEFYVNINKKGIIKISDKDNKSSISVFTNSSKNLLIFSD 762 (957)
T ss_pred EEEEEHHHCcccCCCCcCeeeEeeCCCCEEEEEEEEhhhhhcchhhhcccccceeecccccccccceeecCCceEEEEec
Confidence 99999999999999999999999999999998877541
Q ss_pred ---------------------------------------------CCCcEEEEEecCceeEEecccccccccccccceee
Q psy14505 750 ---------------------------------------------QKQSVLTATENGYGKRTLIKEYTKHNRGTKGIISI 784 (1619)
Q Consensus 750 ---------------------------------------------~~~~ll~~T~~G~~Kr~~l~e~~~~~R~~kG~~~i 784 (1619)
.+.+++++|++|++||+++++|...+| |..+|
T Consensus 763 ~Gkvy~ikv~eIPe~~~kG~~i~nll~~l~~~E~Ii~i~~~~~~~~~~~Ll~vTk~G~iKRt~lsef~~~rr---~~~ai 839 (957)
T PRK13979 763 EGKVYKIPAFMLQNIKNEGINISALTGDFEKDEKIIKIISIFEFEEDLSIYFFSKKGLVKKTLLNEFKGEGN---STQAY 839 (957)
T ss_pred CCeEEEEEeeecccccccCcCHHHhhcccCCCCeEEEEEeecccCCCceEEEEecCCcEEEeEHHHhcccCC---CeEEE
Confidence 123689999999999999999998765 47899
Q ss_pred eeccCCCeEEEEEEec-CCcEEEEEECCCeEEEEecCcccccCCCCCCeEEEEcCCCceEEEEEEeeccccccccccEEE
Q psy14505 785 KTNKRNGKVVAATLVN-RYHEIMLITTGGILIRTRVSEIRKMGRSTQGVILITVENKSKLCGVQRLCKITMIKKYIPVIT 863 (1619)
Q Consensus 785 kl~~~~d~Lv~~~~~~-~~~~i~l~T~~g~~lrf~~~eI~~~gr~a~Gv~~i~L~~~d~v~~~~~~~~~~~~k~~~~iIt 863 (1619)
+|++++|+|++|..++ ++++++++|++|+++||++++||++||.|+||++|+|+++|+|+++..+...+ ...++++|
T Consensus 840 kLke~~DeLV~v~~v~~~~~eIvL~T~~G~~iRf~~~eIr~~GR~A~GVk~I~L~~~D~Vv~~~~i~~~~--~~~ll~iT 917 (957)
T PRK13979 840 KFKHKEDELVNVDIKEHEEKNILLITEKGMAIRFKSEAVNPMGKIASGVTGISLKDEDKVIYGSIIDEND--TRKIKLKS 917 (957)
T ss_pred EecCCCCeEEEEEEecCCCCEEEEEECCCeEEEEEhHHCCcccccCCCeEEEEeCCCCEEEEEEEEcCCC--CceEEEEE
Confidence 9987579999999998 68899999999999999999999999999999999999999999999885321 11356677
Q ss_pred ecCCcCCCCchhHHH
Q psy14505 864 IDGPTASGKGTVAQL 878 (1619)
Q Consensus 864 i~g~~gsGK~~~~~~ 878 (1619)
..|.||++....
T Consensus 918 ---e~G~gKr~~~~e 929 (957)
T PRK13979 918 ---KAKDKGEIEIKD 929 (957)
T ss_pred ---cCCceEEeEHHH
Confidence 458899887765
|
|
| >COG0188 GyrA Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), A subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR01063 gyrA DNA gyrase, A subunit | Back alignment and domain information |
|---|
| >PRK05560 DNA gyrase subunit A; Validated | Back alignment and domain information |
|---|
| >TIGR01061 parC_Gpos DNA topoisomerase IV, A subunit, Gram-positive | Back alignment and domain information |
|---|
| >PRK05561 DNA topoisomerase IV subunit A; Validated | Back alignment and domain information |
|---|
| >TIGR01062 parC_Gneg DNA topoisomerase IV, A subunit, proteobacterial | Back alignment and domain information |
|---|
| >PRK09631 DNA topoisomerase IV subunit A; Provisional | Back alignment and domain information |
|---|
| >PRK12758 DNA topoisomerase IV subunit A; Provisional | Back alignment and domain information |
|---|
| >cd00187 TOP4c DNA Topoisomerase, subtype IIA; domain A'; bacterial DNA topoisomerase IV (C subunit, ParC), bacterial DNA gyrases (A subunit, GyrA),mammalian DNA toposiomerases II | Back alignment and domain information |
|---|
| >smart00434 TOP4c DNA Topoisomerase IV | Back alignment and domain information |
|---|
| >PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >PHA02592 52 DNA topisomerase II medium subunit; Provisional | Back alignment and domain information |
|---|
| >PF00521 DNA_topoisoIV: DNA gyrase/topoisomerase IV, subunit A; InterPro: IPR002205 DNA topoisomerases regulate the number of topological links between two DNA strands (i | Back alignment and domain information |
|---|
| >PRK09630 DNA topoisomerase IV subunit A; Provisional | Back alignment and domain information |
|---|
| >PLN03128 DNA topoisomerase 2; Provisional | Back alignment and domain information |
|---|
| >PLN03237 DNA topoisomerase 2; Provisional | Back alignment and domain information |
|---|
| >PTZ00108 DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >COG0539 RpsA Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK06299 rpsA 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >TIGR00717 rpsA ribosomal protein S1 | Back alignment and domain information |
|---|
| >PRK13806 rpsA 30S ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >COG0539 RpsA Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK13806 rpsA 30S ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >PRK06299 rpsA 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >TIGR00717 rpsA ribosomal protein S1 | Back alignment and domain information |
|---|
| >COG0283 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07899 rpsA 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >PRK07899 rpsA 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >PRK06676 rpsA 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >PRK06676 rpsA 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >PRK00087 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed | Back alignment and domain information |
|---|
| >PRK00087 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed | Back alignment and domain information |
|---|
| >PRK11860 bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidine monophosphate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK07400 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >PF02224 Cytidylate_kin: Cytidylate kinase; InterPro: IPR011994 Cytidylate kinase (2 | Back alignment and domain information |
|---|
| >TIGR00017 cmk cytidylate kinase | Back alignment and domain information |
|---|
| >KOG1070|consensus | Back alignment and domain information |
|---|
| >KOG0355|consensus | Back alignment and domain information |
|---|
| >KOG1070|consensus | Back alignment and domain information |
|---|
| >PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK07400 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed | Back alignment and domain information |
|---|
| >PRK00023 cmk cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13979 DNA topoisomerase IV subunit A; Provisional | Back alignment and domain information |
|---|
| >TIGR01061 parC_Gpos DNA topoisomerase IV, A subunit, Gram-positive | Back alignment and domain information |
|---|
| >TIGR01063 gyrA DNA gyrase, A subunit | Back alignment and domain information |
|---|
| >PRK05561 DNA topoisomerase IV subunit A; Validated | Back alignment and domain information |
|---|
| >PRK05560 DNA gyrase subunit A; Validated | Back alignment and domain information |
|---|
| >TIGR01062 parC_Gneg DNA topoisomerase IV, A subunit, proteobacterial | Back alignment and domain information |
|---|
| >COG0188 GyrA Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), A subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0355|consensus | Back alignment and domain information |
|---|
| >PF13189 Cytidylate_kin2: Cytidylate kinase-like family; PDB: 3FDI_A | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >TIGR02173 cyt_kin_arch cytidylate kinase, putative | Back alignment and domain information |
|---|
| >PTZ00248 eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >PTZ00248 eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >COG2996 Predicted RNA-bindining protein (contains S1 and HTH domains) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04182 cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG1098 VacB Predicted RNA binding protein (contains ribosomal protein S1 domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG2996 Predicted RNA-bindining protein (contains S1 and HTH domains) [General function prediction only] | Back alignment and domain information |
|---|
| >cd05705 S1_Rrp5_repeat_hs14 S1_Rrp5_repeat_hs14: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05703 S1_Rrp5_repeat_hs12_sc9 S1_Rrp5_repeat_hs12_sc9: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >COG1098 VacB Predicted RNA binding protein (contains ribosomal protein S1 domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd05705 S1_Rrp5_repeat_hs14 S1_Rrp5_repeat_hs14: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05694 S1_Rrp5_repeat_hs2_sc2 S1_Rrp5_repeat_hs2_sc2: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05703 S1_Rrp5_repeat_hs12_sc9 S1_Rrp5_repeat_hs12_sc9: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05694 S1_Rrp5_repeat_hs2_sc2 S1_Rrp5_repeat_hs2_sc2: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PRK08582 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF00575 S1: S1 RNA binding domain; InterPro: IPR003029 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >cd05698 S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PF00575 S1: S1 RNA binding domain; InterPro: IPR003029 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >cd05696 S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05697 S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PRK08582 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04461 S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp5 Homo sapiens S1 repeat 8 (hs8) and Saccharomyces cerevisiae S1 repeat 7 (sc7)-like domains | Back alignment and domain information |
|---|
| >cd05696 S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05690 S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05706 S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05697 S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05704 S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd04461 S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp5 Homo sapiens S1 repeat 8 (hs8) and Saccharomyces cerevisiae S1 repeat 7 (sc7)-like domains | Back alignment and domain information |
|---|
| >cd05698 S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05689 S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05704 S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05706 S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05707 S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PRK07252 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd05695 S1_Rrp5_repeat_hs3 S1_Rrp5_repeat_hs3: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05690 S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd04452 S1_IF2_alpha S1_IF2_alpha: The alpha subunit of translation Initiation Factor 2, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd05686 S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PRK13946 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >cd05691 S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05708 S1_Rrp5_repeat_sc12 S1_Rrp5_repeat_sc12: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05693 S1_Rrp5_repeat_hs1_sc1 S1_Rrp5_repeat_hs1_sc1: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05707 S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05693 S1_Rrp5_repeat_hs1_sc1 S1_Rrp5_repeat_hs1_sc1: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PRK07252 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd05689 S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05686 S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd04452 S1_IF2_alpha S1_IF2_alpha: The alpha subunit of translation Initiation Factor 2, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd05708 S1_Rrp5_repeat_sc12 S1_Rrp5_repeat_sc12: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PRK08059 general stress protein 13; Validated | Back alignment and domain information |
|---|
| >COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd05695 S1_Rrp5_repeat_hs3 S1_Rrp5_repeat_hs3: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PRK05807 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd05687 S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05684 S1_DHX8_helicase S1_DHX8_helicase: The N-terminal S1 domain of human ATP-dependent RNA helicase DHX8, a DEAH (Asp-Glu-Ala-His) box polypeptide | Back alignment and domain information |
|---|
| >cd05691 S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05687 S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >PRK08059 general stress protein 13; Validated | Back alignment and domain information |
|---|
| >PLN00207 polyribonucleotide nucleotidyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05807 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN00207 polyribonucleotide nucleotidyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd05692 S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05684 S1_DHX8_helicase S1_DHX8_helicase: The N-terminal S1 domain of human ATP-dependent RNA helicase DHX8, a DEAH (Asp-Glu-Ala-His) box polypeptide | Back alignment and domain information |
|---|
| >cd04465 S1_RPS1_repeat_ec2_hs2 S1_RPS1_repeat_ec2_hs2: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05692 S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05789 S1_Rrp4 S1_Rrp4: Rrp4 S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd05685 S1_Tex S1_Tex: The C-terminal S1 domain of a transcription accessory factor called Tex, which has been characterized in Bordetella pertussis and Pseudomonas aeruginosa | Back alignment and domain information |
|---|
| >cd04465 S1_RPS1_repeat_ec2_hs2 S1_RPS1_repeat_ec2_hs2: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05789 S1_Rrp4 S1_Rrp4: Rrp4 S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >smart00316 S1 Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd05685 S1_Tex S1_Tex: The C-terminal S1 domain of a transcription accessory factor called Tex, which has been characterized in Bordetella pertussis and Pseudomonas aeruginosa | Back alignment and domain information |
|---|
| >PHA02945 interferon resistance protein; Provisional | Back alignment and domain information |
|---|
| >cd05688 S1_RPS1_repeat_ec3 S1_RPS1_repeat_ec3: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd04472 S1_PNPase S1_PNPase: Polynucleotide phosphorylase (PNPase), ), S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >smart00316 S1 Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd04471 S1_RNase_R S1_RNase_R: RNase R C-terminal S1 domain | Back alignment and domain information |
|---|
| >PHA02945 interferon resistance protein; Provisional | Back alignment and domain information |
|---|
| >cd04472 S1_PNPase S1_PNPase: Polynucleotide phosphorylase (PNPase), ), S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PRK13947 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >cd05688 S1_RPS1_repeat_ec3 S1_RPS1_repeat_ec3: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase | Back alignment and domain information |
|---|
| >cd04453 S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PRK09521 exosome complex RNA-binding protein Csl4; Provisional | Back alignment and domain information |
|---|
| >COG1093 SUI2 Translation initiation factor 2, alpha subunit (eIF-2alpha) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK03987 translation initiation factor IF-2 subunit alpha; Validated | Back alignment and domain information |
|---|
| >cd05702 S1_Rrp5_repeat_hs11_sc8 S1_Rrp5_repeat_hs11_sc8: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd04453 S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PRK09521 exosome complex RNA-binding protein Csl4; Provisional | Back alignment and domain information |
|---|
| >TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase | Back alignment and domain information |
|---|
| >cd04473 S1_RecJ_like S1_RecJ_like: The S1 domain of the archaea-specific RecJ-like exonuclease | Back alignment and domain information |
|---|
| >cd04471 S1_RNase_R S1_RNase_R: RNase R C-terminal S1 domain | Back alignment and domain information |
|---|
| >PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >cd04454 S1_Rrp4_like S1_Rrp4_like: Rrp4-like, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PRK03987 translation initiation factor IF-2 subunit alpha; Validated | Back alignment and domain information |
|---|
| >cd05702 S1_Rrp5_repeat_hs11_sc8 S1_Rrp5_repeat_hs11_sc8: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >COG1093 SUI2 Translation initiation factor 2, alpha subunit (eIF-2alpha) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd04473 S1_RecJ_like S1_RecJ_like: The S1 domain of the archaea-specific RecJ-like exonuclease | Back alignment and domain information |
|---|
| >cd04454 S1_Rrp4_like S1_Rrp4_like: Rrp4-like, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd00164 S1_like S1_like: Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >PRK09202 nusA transcription elongation factor NusA; Validated | Back alignment and domain information |
|---|
| >COG2183 Tex Transcriptional accessory protein [Transcription] | Back alignment and domain information |
|---|
| >COG2183 Tex Transcriptional accessory protein [Transcription] | Back alignment and domain information |
|---|
| >PRK01184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd00164 S1_like S1_like: Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PRK09202 nusA transcription elongation factor NusA; Validated | Back alignment and domain information |
|---|
| >cd04460 S1_RpoE S1_RpoE: RpoE, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PF03989 DNA_gyraseA_C: DNA gyrase C-terminal domain, beta-propeller; InterPro: IPR006691 DNA topoisomerases regulate the number of topological links between two DNA strands (i | Back alignment and domain information |
|---|
| >PF03989 DNA_gyraseA_C: DNA gyrase C-terminal domain, beta-propeller; InterPro: IPR006691 DNA topoisomerases regulate the number of topological links between two DNA strands (i | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >PRK04163 exosome complex RNA-binding protein Rrp4; Provisional | Back alignment and domain information |
|---|
| >cd04460 S1_RpoE S1_RpoE: RpoE, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd04455 S1_NusA S1_NusA: N-utilizing substance A protein (NusA), S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PRK04163 exosome complex RNA-binding protein Rrp4; Provisional | Back alignment and domain information |
|---|
| >PRK13949 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >cd04455 S1_NusA S1_NusA: N-utilizing substance A protein (NusA), S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14733 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK03731 aroL shikimate kinase II; Reviewed | Back alignment and domain information |
|---|
| >COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants | Back alignment and domain information |
|---|
| >TIGR00448 rpoE DNA-directed RNA polymerase (rpoE), archaeal and eukaryotic form | Back alignment and domain information |
|---|
| >PRK13948 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK05057 aroK shikimate kinase I; Reviewed | Back alignment and domain information |
|---|
| >PRK12327 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >PRK09631 DNA topoisomerase IV subunit A; Provisional | Back alignment and domain information |
|---|
| >TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >TIGR00448 rpoE DNA-directed RNA polymerase (rpoE), archaeal and eukaryotic form | Back alignment and domain information |
|---|
| >PLN02199 shikimate kinase | Back alignment and domain information |
|---|
| >PRK14021 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional | Back alignment and domain information |
|---|
| >PRK00081 coaE dephospho-CoA kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK14730 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >KOG3354|consensus | Back alignment and domain information |
|---|
| >COG3265 GntK Gluconate kinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2 | Back alignment and domain information |
|---|
| >TIGR01953 NusA transcription termination factor NusA | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >PRK14732 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01953 NusA transcription termination factor NusA | Back alignment and domain information |
|---|
| >TIGR02063 RNase_R ribonuclease R | Back alignment and domain information |
|---|
| >PTZ00451 dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14734 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PRK11642 exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >PRK12758 DNA topoisomerase IV subunit A; Provisional | Back alignment and domain information |
|---|
| >KOG1067|consensus | Back alignment and domain information |
|---|
| >PRK00625 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK07429 phosphoribulokinase; Provisional | Back alignment and domain information |
|---|
| >KOG1067|consensus | Back alignment and domain information |
|---|
| >PLN02422 dephospho-CoA kinase | Back alignment and domain information |
|---|
| >PRK14532 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00358 3_prime_RNase VacB and RNase II family 3'-5' exoribonucleases | Back alignment and domain information |
|---|
| >TIGR00152 dephospho-CoA kinase | Back alignment and domain information |
|---|
| >TIGR02063 RNase_R ribonuclease R | Back alignment and domain information |
|---|
| >COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 | Back alignment and domain information |
|---|
| >cd05791 S1_CSL4 S1_CSL4: CSL4, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PLN02200 adenylate kinase family protein | Back alignment and domain information |
|---|
| >KOG3347|consensus | Back alignment and domain information |
|---|
| >COG1095 RPB7 DNA-directed RNA polymerase, subunit E' [Transcription] | Back alignment and domain information |
|---|
| >cd05699 S1_Rrp5_repeat_hs7 S1_Rrp5_repeat_hs7: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PRK14528 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK11642 exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >cd05791 S1_CSL4 S1_CSL4: CSL4, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PRK03333 coaE dephospho-CoA kinase/protein folding accessory domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00358 3_prime_RNase VacB and RNase II family 3'-5' exoribonucleases | Back alignment and domain information |
|---|
| >COG1095 RPB7 DNA-directed RNA polymerase, subunit E' [Transcription] | Back alignment and domain information |
|---|
| >PRK08563 DNA-directed RNA polymerase subunit E'; Provisional | Back alignment and domain information |
|---|
| >cd05699 S1_Rrp5_repeat_hs7 S1_Rrp5_repeat_hs7: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PRK13808 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14731 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PRK12327 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes | Back alignment and domain information |
|---|
| >PRK00279 adk adenylate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK08563 DNA-directed RNA polymerase subunit E'; Provisional | Back alignment and domain information |
|---|
| >PRK13975 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG3079|consensus | Back alignment and domain information |
|---|
| >PRK13951 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional | Back alignment and domain information |
|---|
| >PRK02496 adk adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PHA02858 EIF2a-like PKR inhibitor; Provisional | Back alignment and domain information |
|---|
| >TIGR01351 adk adenylate kinases | Back alignment and domain information |
|---|
| >PHA02858 EIF2a-like PKR inhibitor; Provisional | Back alignment and domain information |
|---|
| >TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14526 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >PLN02674 adenylate kinase | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14531 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK03846 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02348 phosphoribulokinase | Back alignment and domain information |
|---|
| >PF01121 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 This family contains dephospho-CoA kinases (2 | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated | Back alignment and domain information |
|---|
| >PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >COG1097 RRP4 RNA-binding protein Rrp4 and related proteins (contain S1 domain and KH domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PLN02459 probable adenylate kinase | Back alignment and domain information |
|---|
| >cd04462 S1_RNAPII_Rpb7 S1_RNAPII_Rpb7: Eukaryotic RNA polymerase II (RNAPII) Rpb7 subunit C-terminal S1 domain | Back alignment and domain information |
|---|
| >PRK11545 gntK gluconate kinase 1; Provisional | Back alignment and domain information |
|---|
| >PRK08356 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00301 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >COG1097 RRP4 RNA-binding protein Rrp4 and related proteins (contain S1 domain and KH domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd04462 S1_RNAPII_Rpb7 S1_RNAPII_Rpb7: Eukaryotic RNA polymerase II (RNAPII) Rpb7 subunit C-terminal S1 domain | Back alignment and domain information |
|---|
| >PRK05054 exoribonuclease II; Provisional | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK15453 phosphoribulokinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00455 apsK adenylylsulfate kinase (apsK) | Back alignment and domain information |
|---|
| >PRK12328 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >PF03668 ATP_bind_2: P-loop ATPase protein family; InterPro: IPR005337 This entry represents UPF0042 nucleotide-binding proteins | Back alignment and domain information |
|---|
| >PRK14529 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF07931 CPT: Chloramphenicol phosphotransferase-like protein; InterPro: IPR012853 The members of this family are all similar to chloramphenicol 3-O phosphotransferase (CPT, Q56148 from SWISSPROT) expressed by Streptomyces venezuelae | Back alignment and domain information |
|---|
| >PRK14527 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >PRK12328 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) | Back alignment and domain information |
|---|
| >TIGR00757 RNaseEG ribonuclease, Rne/Rng family | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >PRK09825 idnK D-gluconate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG2916|consensus | Back alignment and domain information |
|---|
| >PF13509 S1_2: S1 domain; PDB: 3GO5_A | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >PTZ00088 adenylate kinase 1; Provisional | Back alignment and domain information |
|---|
| >cd05790 S1_Rrp40 S1_Rrp40: Rrp40 S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PF13509 S1_2: S1 domain; PDB: 3GO5_A | Back alignment and domain information |
|---|
| >PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 | Back alignment and domain information |
|---|
| >cd05790 S1_Rrp40 S1_Rrp40: Rrp40 S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PTZ00162 DNA-directed RNA polymerase II subunit 7; Provisional | Back alignment and domain information |
|---|
| >PRK12338 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00162 DNA-directed RNA polymerase II subunit 7; Provisional | Back alignment and domain information |
|---|
| >TIGR00757 RNaseEG ribonuclease, Rne/Rng family | Back alignment and domain information |
|---|
| >PRK12329 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) | Back alignment and domain information |
|---|
| >TIGR02062 RNase_B exoribonuclease II | Back alignment and domain information |
|---|
| >KOG2916|consensus | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction |
Back alignment and domain information |
|---|
| >KOG1856|consensus | Back alignment and domain information |
|---|
| >PRK05054 exoribonuclease II; Provisional | Back alignment and domain information |
|---|
| >COG1096 Predicted RNA-binding protein (consists of S1 domain and a Zn-ribbon domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1856|consensus | Back alignment and domain information |
|---|
| >PRK12329 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >COG1660 Predicted P-loop-containing kinase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >PF10447 EXOSC1: Exosome component EXOSC1/CSL4; InterPro: IPR019495 The exosome mediates degradation of unstable mRNAs that contain AU-rich elements (AREs) within their 3' untranslated regions [] | Back alignment and domain information |
|---|
| >COG0557 VacB Exoribonuclease R [Transcription] | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >PF10447 EXOSC1: Exosome component EXOSC1/CSL4; InterPro: IPR019495 The exosome mediates degradation of unstable mRNAs that contain AU-rich elements (AREs) within their 3' untranslated regions [] | Back alignment and domain information |
|---|
| >PRK12339 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >COG1096 Predicted RNA-binding protein (consists of S1 domain and a Zn-ribbon domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR02062 RNase_B exoribonuclease II | Back alignment and domain information |
|---|
| >COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd05700 S1_Rrp5_repeat_hs9 S1_Rrp5_repeat_hs9: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PLN02842 nucleotide kinase | Back alignment and domain information |
|---|
| >PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional | Back alignment and domain information |
|---|
| >PRK14737 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >PRK05439 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00041 DTMP_kinase thymidylate kinase | Back alignment and domain information |
|---|
| >COG0557 VacB Exoribonuclease R [Transcription] | Back alignment and domain information |
|---|
| >cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >PRK00698 tmk thymidylate kinase; Validated | Back alignment and domain information |
|---|
| >PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed | Back alignment and domain information |
|---|
| >PRK13973 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK07667 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1240|consensus | Back alignment and domain information |
|---|
| >PLN02318 phosphoribulokinase/uridine kinase | Back alignment and domain information |
|---|
| >cd02030 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) is a family of proteins that are highly similar to deoxyribonucleoside kinases (dNK) | Back alignment and domain information |
|---|
| >cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor | Back alignment and domain information |
|---|
| >KOG3220|consensus | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >PRK10811 rne ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >PRK04220 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11712 ribonuclease G; Provisional | Back alignment and domain information |
|---|
| >PF10246 MRP-S35: Mitochondrial ribosomal protein MRP-S35; InterPro: IPR019375 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >PRK10811 rne ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >KOG3298|consensus | Back alignment and domain information |
|---|
| >PF08292 RNA_pol_Rbc25: RNA polymerase III subunit Rpc25; InterPro: IPR013238 Rpc25 is a strongly conserved subunit of RNA polymerase III and has homology to Rpa43 in RNA polymerase I, Rpb7 in RNA polymerase II and the archaeal RpoE subunit | Back alignment and domain information |
|---|
| >PRK11784 tRNA 2-selenouridine synthase; Provisional | Back alignment and domain information |
|---|
| >cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs) | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >PLN02924 thymidylate kinase | Back alignment and domain information |
|---|
| >PRK12337 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] | Back alignment and domain information |
|---|
| >PRK13976 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK11712 ribonuclease G; Provisional | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >smart00072 GuKc Guanylate kinase homologues | Back alignment and domain information |
|---|
| >KOG3409|consensus | Back alignment and domain information |
|---|
| >KOG3409|consensus | Back alignment and domain information |
|---|
| >PF02223 Thymidylate_kin: Thymidylate kinase; InterPro: IPR018094 Thymidylate kinase (2 | Back alignment and domain information |
|---|
| >PF08292 RNA_pol_Rbc25: RNA polymerase III subunit Rpc25; InterPro: IPR013238 Rpc25 is a strongly conserved subunit of RNA polymerase III and has homology to Rpa43 in RNA polymerase I, Rpb7 in RNA polymerase II and the archaeal RpoE subunit | Back alignment and domain information |
|---|
| >PRK14738 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02165 adenylate isopentenyltransferase | Back alignment and domain information |
|---|
| >PRK00300 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK12442 translation initiation factor IF-1; Reviewed | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 1619 | ||||
| 2y3p_A | 522 | Crystal Structure Of N-Terminal Domain Of Gyra With | 1e-171 | ||
| 1ab4_A | 493 | 59kda Fragment Of Gyrase A From E. Coli Length = 49 | 1e-162 | ||
| 3nuh_A | 525 | A Domain Insertion In E. Coli Gyrb Adopts A Novel F | 1e-159 | ||
| 3lpx_A | 500 | Crystal Structure Of Gyra Length = 500 | 1e-158 | ||
| 4ddq_A | 502 | Structural Plasticity Of The Bacillus Subtilis Gyra | 1e-155 | ||
| 2xco_A | 726 | The 3.1a Crystal Structure Of The Catalytic Core (B | 1e-144 | ||
| 2xcs_B | 692 | The 2.1a Crystal Structure Of S. Aureus Gyrase Comp | 1e-144 | ||
| 2xcr_B | 726 | The 3.5a Crystal Structure Of The Catalytic Core (B | 1e-143 | ||
| 3ifz_A | 508 | Crystal Structure Of The First Part Of The Mycobact | 1e-130 | ||
| 3ilw_A | 470 | Structure Of Dna Gyrase Subunit A N-Terminal Domain | 1e-124 | ||
| 2inr_A | 514 | Crystal Structure Of A 59 Kda Fragment Of Topoisome | 1e-108 | ||
| 2nov_A | 496 | Breakage-Reunion Domain Of S.Pneumoniae Topo Iv: Cr | 1e-107 | ||
| 1zvu_A | 716 | Structure Of The Full-Length E. Coli Parc Subunit L | 4e-92 | ||
| 2xkj_E | 767 | Crystal Structure Of Catalytic Core Of A. Baumannii | 3e-86 | ||
| 2xkk_A | 767 | Crystal Structure Of Moxifloxacin, Dna, And A. Baum | 3e-85 | ||
| 1zi0_A | 307 | A Superhelical Spiral In Escherichia Coli Dna Gyras | 3e-84 | ||
| 3l6v_A | 370 | Crystal Structure Of The Xanthomonas Campestris Gyr | 3e-79 | ||
| 3uc1_A | 327 | Mycobacterium Tuberculosis Gyrase Type Iia Topoisom | 3e-56 | ||
| 2cmk_A | 227 | Cytidine Monophosphate Kinase In Complex With Cytid | 4e-47 | ||
| 1cke_A | 227 | Cmp Kinase From Escherichia Coli Free Enzyme Struct | 1e-46 | ||
| 2fem_A | 227 | Mutant R188m Of The Cytidine Monophosphate Kinase F | 3e-46 | ||
| 4e22_A | 252 | Structure Of Cytidine Monophosphate Kinase From Yer | 3e-46 | ||
| 1suu_A | 312 | Structure Of Dna Gyrase A C-Terminal Domain Length | 2e-37 | ||
| 1q3t_A | 236 | Solution Structure And Function Of An Essential Cmp | 3e-36 | ||
| 2khi_A | 115 | Nmr Structure Of The Domain 4 Of The E. Coli Riboso | 7e-33 | ||
| 2khi_A | 115 | Nmr Structure Of The Domain 4 Of The E. Coli Riboso | 2e-07 | ||
| 2h92_A | 219 | Crystal Structure Of Staphylococcus Aureus Cytidine | 2e-29 | ||
| 3r8c_A | 228 | Crystal Structure Of Cytidylate Kinase (Cmk) From M | 2e-28 | ||
| 3r20_A | 233 | Crystal Structure Of Cytidylate Kinase From Mycobac | 2e-28 | ||
| 1wp5_A | 323 | Crystal Structure Of The C-Terminal Domain Of Dna T | 4e-28 | ||
| 4ely_A | 156 | Ccdbvfi:gyra14ec Length = 156 | 5e-21 | ||
| 4elz_A | 153 | Ccdbvfi:gyra14vfi Length = 153 | 1e-20 | ||
| 1x75_A | 132 | Ccdb:gyra14 Complex Length = 132 | 5e-20 | ||
| 3akc_A | 208 | Crystal Structure Of Cmp Kinase In Complex With Cdp | 2e-19 | ||
| 4fm9_A | 763 | Human Topoisomerase Ii Alpha Bound To Dna Length = | 2e-19 | ||
| 3qx3_A | 803 | Human Topoisomerase Iibeta In Complex With Dna And | 2e-17 | ||
| 2rgr_A | 759 | Topoisomerase Iia Bound To G-segment Dna Length = 7 | 2e-17 | ||
| 1bgw_A | 793 | Topoisomerase Residues 410-1202 Length = 793 | 2e-17 | ||
| 4gfh_F | 1099 | Topoisomerase Ii-Dna-Amppnp Complex Length = 1099 | 3e-16 | ||
| 3l4k_A | 722 | Topoisomerase Ii-Dna Cleavage Complex, Apo Length = | 4e-16 | ||
| 4gfh_A | 1103 | Topoisomerase Ii-Dna-Amppnp Complex Length = 1103 | 4e-16 | ||
| 3no0_A | 276 | Aquifex Aeolicus Type Iia Topoisomerase C-Terminal | 7e-12 | ||
| 3bzc_A | 785 | Crystal Structure Of The Tex Protein From Pseudomon | 2e-10 | ||
| 3bzc_A | 785 | Crystal Structure Of The Tex Protein From Pseudomon | 2e-06 | ||
| 2oce_A | 780 | Crystal Structure Of Tex Family Protein Pa5201 From | 2e-10 | ||
| 2oce_A | 780 | Crystal Structure Of Tex Family Protein Pa5201 From | 2e-06 | ||
| 2khj_A | 109 | Nmr Structure Of The Domain 6 Of The E. Coli Riboso | 3e-07 | ||
| 3cdi_A | 723 | Crystal Structure Of E. Coli Pnpase Length = 723 | 1e-06 | ||
| 3cdi_A | 723 | Crystal Structure Of E. Coli Pnpase Length = 723 | 1e-04 | ||
| 2bh8_A | 101 | Combinatorial Protein 1b11 Length = 101 | 1e-06 | ||
| 1sro_A | 76 | S1 Rna Binding Domain, Nmr, 20 Structures Length = | 4e-06 | ||
| 1sro_A | 76 | S1 Rna Binding Domain, Nmr, 20 Structures Length = | 3e-04 | ||
| 2k4k_A | 130 | Solution Structure Of Gsp13 From Bacillus Subtilis | 5e-06 | ||
| 4aim_A | 726 | Crystal Structure Of C. Crescentus Pnpase Bound To | 8e-06 | ||
| 4aid_A | 726 | Crystal Structure Of C. Crescentus Pnpase Bound To | 8e-06 | ||
| 4am3_A | 717 | Crystal Structure Of C. Crescentus Pnpase Bound To | 9e-06 | ||
| 2cqo_A | 119 | Solution Structure Of The S1 Rna Binding Domain Of | 2e-05 | ||
| 3aev_A | 275 | Crystal Structure Of AEIF2ALPHA-Adim2p-Rrna Complex | 3e-04 | ||
| 1yz6_A | 274 | Crystal Structure Of Intact Alpha Subunit Of Aif2 F | 4e-04 | ||
| 1q8k_A | 308 | Solution Structure Of Alpha Subunit Of Human Eif2 L | 5e-04 |
| >pdb|2Y3P|A Chain A, Crystal Structure Of N-Terminal Domain Of Gyra With The Antibiotic Simocyclinone D8 Length = 522 | Back alignment and structure |
|
| >pdb|1AB4|A Chain A, 59kda Fragment Of Gyrase A From E. Coli Length = 493 | Back alignment and structure |
| >pdb|3NUH|A Chain A, A Domain Insertion In E. Coli Gyrb Adopts A Novel Fold That Plays A Critical Role In Gyrase Function Length = 525 | Back alignment and structure |
| >pdb|3LPX|A Chain A, Crystal Structure Of Gyra Length = 500 | Back alignment and structure |
| >pdb|4DDQ|A Chain A, Structural Plasticity Of The Bacillus Subtilis Gyra Homodimer Length = 502 | Back alignment and structure |
| >pdb|2XCO|A Chain A, The 3.1a Crystal Structure Of The Catalytic Core (B'a' Region) Of Staphylococcus Aureus Dna Gyrase Length = 726 | Back alignment and structure |
| >pdb|2XCS|B Chain B, The 2.1a Crystal Structure Of S. Aureus Gyrase Complex With Gsk299423 And Dna Length = 692 | Back alignment and structure |
| >pdb|2XCR|B Chain B, The 3.5a Crystal Structure Of The Catalytic Core (B'a' Region) Of Staphylococcus Aureus Dna Gyrase Complexed With Gsk299423 And Dna Length = 726 | Back alignment and structure |
| >pdb|3IFZ|A Chain A, Crystal Structure Of The First Part Of The Mycobacterium Tuberculosis Dna Gyrase Reaction Core: The Breakage And Reunion Domain At 2.7 A Resolution Length = 508 | Back alignment and structure |
| >pdb|3ILW|A Chain A, Structure Of Dna Gyrase Subunit A N-Terminal Domain Length = 470 | Back alignment and structure |
| >pdb|2INR|A Chain A, Crystal Structure Of A 59 Kda Fragment Of Topoisomerase Iv Subunit A (Grla) From Staphylococcus Aureus Length = 514 | Back alignment and structure |
| >pdb|2NOV|A Chain A, Breakage-Reunion Domain Of S.Pneumoniae Topo Iv: Crystal Structure Of A Gram-Positive Quinolone Target Length = 496 | Back alignment and structure |
| >pdb|1ZVU|A Chain A, Structure Of The Full-Length E. Coli Parc Subunit Length = 716 | Back alignment and structure |
| >pdb|2XKJ|E Chain E, Crystal Structure Of Catalytic Core Of A. Baumannii Topo Iv (Pare-Parc Fusion Truncate) Length = 767 | Back alignment and structure |
| >pdb|2XKK|A Chain A, Crystal Structure Of Moxifloxacin, Dna, And A. Baumannii Topo Iv (Pare-Parc Fusion Truncate) Length = 767 | Back alignment and structure |
| >pdb|1ZI0|A Chain A, A Superhelical Spiral In Escherichia Coli Dna Gyrase A C- Terminal Domain Imparts Unidirectional Supercoiling Bias Length = 307 | Back alignment and structure |
| >pdb|3L6V|A Chain A, Crystal Structure Of The Xanthomonas Campestris Gyrase A C- Terminal Domain Length = 370 | Back alignment and structure |
| >pdb|3UC1|A Chain A, Mycobacterium Tuberculosis Gyrase Type Iia Topoisomerase C-Terminal Domain Length = 327 | Back alignment and structure |
| >pdb|2CMK|A Chain A, Cytidine Monophosphate Kinase In Complex With Cytidine-Di- Phosphate Length = 227 | Back alignment and structure |
| >pdb|1CKE|A Chain A, Cmp Kinase From Escherichia Coli Free Enzyme Structure Length = 227 | Back alignment and structure |
| >pdb|2FEM|A Chain A, Mutant R188m Of The Cytidine Monophosphate Kinase From E. Coli Length = 227 | Back alignment and structure |
| >pdb|4E22|A Chain A, Structure Of Cytidine Monophosphate Kinase From Yersinia Pseudotuberculosis Length = 252 | Back alignment and structure |
| >pdb|1SUU|A Chain A, Structure Of Dna Gyrase A C-Terminal Domain Length = 312 | Back alignment and structure |
| >pdb|1Q3T|A Chain A, Solution Structure And Function Of An Essential Cmp Kinase Of Streptococcus Pneumoniae Length = 236 | Back alignment and structure |
| >pdb|2KHI|A Chain A, Nmr Structure Of The Domain 4 Of The E. Coli Ribosomal Protein S1 Length = 115 | Back alignment and structure |
| >pdb|2KHI|A Chain A, Nmr Structure Of The Domain 4 Of The E. Coli Ribosomal Protein S1 Length = 115 | Back alignment and structure |
| >pdb|2H92|A Chain A, Crystal Structure Of Staphylococcus Aureus Cytidine Monophosphate Kinase In Complex With Cytidine-5'- Monophosphate Length = 219 | Back alignment and structure |
| >pdb|3R8C|A Chain A, Crystal Structure Of Cytidylate Kinase (Cmk) From Mycobacterium Abscessus Length = 228 | Back alignment and structure |
| >pdb|3R20|A Chain A, Crystal Structure Of Cytidylate Kinase From Mycobacterium Smegmatis Length = 233 | Back alignment and structure |
| >pdb|1WP5|A Chain A, Crystal Structure Of The C-Terminal Domain Of Dna Topoisomerase Iv Length = 323 | Back alignment and structure |
| >pdb|4ELY|A Chain A, Ccdbvfi:gyra14ec Length = 156 | Back alignment and structure |
| >pdb|4ELZ|A Chain A, Ccdbvfi:gyra14vfi Length = 153 | Back alignment and structure |
| >pdb|1X75|A Chain A, Ccdb:gyra14 Complex Length = 132 | Back alignment and structure |
| >pdb|3AKC|A Chain A, Crystal Structure Of Cmp Kinase In Complex With Cdp And Adp From Thermus Thermophilus Hb8 Length = 208 | Back alignment and structure |
| >pdb|4FM9|A Chain A, Human Topoisomerase Ii Alpha Bound To Dna Length = 763 | Back alignment and structure |
| >pdb|3QX3|A Chain A, Human Topoisomerase Iibeta In Complex With Dna And Etoposide Length = 803 | Back alignment and structure |
| >pdb|2RGR|A Chain A, Topoisomerase Iia Bound To G-segment Dna Length = 759 | Back alignment and structure |
| >pdb|1BGW|A Chain A, Topoisomerase Residues 410-1202 Length = 793 | Back alignment and structure |
| >pdb|3NO0|A Chain A, Aquifex Aeolicus Type Iia Topoisomerase C-Terminal Domain Length = 276 | Back alignment and structure |
| >pdb|3BZC|A Chain A, Crystal Structure Of The Tex Protein From Pseudomonas Aeruginosa, Crystal Form I Length = 785 | Back alignment and structure |
| >pdb|3BZC|A Chain A, Crystal Structure Of The Tex Protein From Pseudomonas Aeruginosa, Crystal Form I Length = 785 | Back alignment and structure |
| >pdb|2OCE|A Chain A, Crystal Structure Of Tex Family Protein Pa5201 From Pseudomonas Aeruginosa Length = 780 | Back alignment and structure |
| >pdb|2OCE|A Chain A, Crystal Structure Of Tex Family Protein Pa5201 From Pseudomonas Aeruginosa Length = 780 | Back alignment and structure |
| >pdb|2KHJ|A Chain A, Nmr Structure Of The Domain 6 Of The E. Coli Ribosomal Protein S1 Length = 109 | Back alignment and structure |
| >pdb|3CDI|A Chain A, Crystal Structure Of E. Coli Pnpase Length = 723 | Back alignment and structure |
| >pdb|3CDI|A Chain A, Crystal Structure Of E. Coli Pnpase Length = 723 | Back alignment and structure |
| >pdb|2BH8|A Chain A, Combinatorial Protein 1b11 Length = 101 | Back alignment and structure |
| >pdb|1SRO|A Chain A, S1 Rna Binding Domain, Nmr, 20 Structures Length = 76 | Back alignment and structure |
| >pdb|1SRO|A Chain A, S1 Rna Binding Domain, Nmr, 20 Structures Length = 76 | Back alignment and structure |
| >pdb|2K4K|A Chain A, Solution Structure Of Gsp13 From Bacillus Subtilis Length = 130 | Back alignment and structure |
| >pdb|4AIM|A Chain A, Crystal Structure Of C. Crescentus Pnpase Bound To Rnase E Recognition Peptide Length = 726 | Back alignment and structure |
| >pdb|4AID|A Chain A, Crystal Structure Of C. Crescentus Pnpase Bound To Rnase E Recognition Peptide Length = 726 | Back alignment and structure |
| >pdb|4AM3|A Chain A, Crystal Structure Of C. Crescentus Pnpase Bound To Rna Length = 717 | Back alignment and structure |
| >pdb|2CQO|A Chain A, Solution Structure Of The S1 Rna Binding Domain Of Human Hypothetical Protein Flj11067 Length = 119 | Back alignment and structure |
| >pdb|3AEV|A Chain A, Crystal Structure Of AEIF2ALPHA-Adim2p-Rrna Complex From Pyrococcus Horikoshii Ot3 Length = 275 | Back alignment and structure |
| >pdb|1YZ6|A Chain A, Crystal Structure Of Intact Alpha Subunit Of Aif2 From Pyrococcus Abyssi Length = 274 | Back alignment and structure |
| >pdb|1Q8K|A Chain A, Solution Structure Of Alpha Subunit Of Human Eif2 Length = 308 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1zvu_A Topoisomerase IV subunit A; beta-pinwheel, ATPase, supercoiling, decatenation, DNA bindi topology; 3.00A {Escherichia coli} Length = 716 | Back alignment and structure |
|---|
Score = 975 bits (2522), Expect = 0.0
Identities = 223/776 (28%), Positives = 387/776 (49%), Gaps = 80/776 (10%)
Query: 30 VGRALPDVRDGLKPVHRRVLFAMHEMNNLWNRPFVKCARVVGETMGKYHPHGDVSIYDAL 89
+ RALP + DGLKPV RR+++AM E+ + F K AR VG+ +GKYHPHGD + Y+A+
Sbjct: 1 MDRALPFIGDGLKPVQRRIVYAMSELGLNASAKFKKSARTVGDVLGKYHPHGDSACYEAM 60
Query: 90 VRMAQSFSLRCTLVDGQGNFGSIDGD-SAAAMRYTECRLNKISNELLIDLDKETIDFISN 148
V MAQ FS R LVDGQGN+G+ D S AAMRYTE RL+K S LL +L + T D++ N
Sbjct: 61 VLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTESRLSKYSELLLSELGQGTADWVPN 120
Query: 149 YDGKEKEPSVLPTRIPNLLINGSSGIAVGMATNIPPHNLTEVIDGVLYVLHNPECSINDL 208
+DG +EP +LP R+PN+L+NG++GIAVGMAT+IPPHNL EV + ++ P+ +++ L
Sbjct: 121 FDGTLQEPKMLPARLPNILLNGTTGIAVGMATDIPPHNLREVAQAAIALIDQPKTTLDQL 180
Query: 209 IKIIPAPDFPTAG-IIYGLSSVHDGYYTGKGRVIIRAKTHIEEFNRENRTAIIIDELPYQ 267
+ I+ PD+PT II + + Y G+G V +RA E+ A++I LP+Q
Sbjct: 181 LDIVQGPDYPTEAEIITSRAEIRKIYENGRGSVRMRAVWKKED------GAVVISALPHQ 234
Query: 268 VNKKSLLEKISQLVKEKKLECISNLRDESDKSG-MRIVIELKRNEI-PEIVLNKLYKQTQ 325
V+ +LE+I+ ++ KKL + +LRDESD R+VI + N + + V+N L+ T
Sbjct: 235 VSGARVLEQIAAQMRNKKLPMVDDLRDESDHENPTRLVIVPRSNRVDMDQVMNHLFATTD 294
Query: 326 LQNTFGMNMLAL-VNGQPKLLNLKEILYYFILHRKEVIKRRTIFELRKAREYAHILEGLT 384
L+ ++ +N+ + ++G+P + NL EIL +++ R++ ++RR + L K + HILEGL
Sbjct: 295 LEKSYRINLNMIGLDGRPAVKNLLEILSEWLVFRRDTVRRRLNYRLEKVLKRLHILEGLL 354
Query: 385 IALTNIDNFIQIIRSTSTPQEAKNKIIESTWNLPDVSKIIGFNKKNYNTISKINNISKLQ 444
+A NID I+IIR+ E K ++
Sbjct: 355 VAFLNIDEVIEIIRNE---DEPKPALMSR------------------------------- 380
Query: 445 NNDMYKLSDIQAQEILKMPLQRLTNMEQKKIINKYENVIKKVIDLTDILSNSKRIIEIIT 504
+ L++ QA+ IL++ L+ L +E+ KI + + K+ L IL++ +++ ++
Sbjct: 381 ----FGLTETQAEAILELKLRHLAKLEEMKIRGEQSELEKERDQLQGILASERKMNNLLK 436
Query: 505 DELNIIKNKYGSHKKNIRRSEIILN--AINPSTEDLIASQDMVITLSNLGYIKSQPISEY 562
EL YG RRS + A S D++ S+ + I LS +G++
Sbjct: 437 KELQADAQAYGDD----RRSPLQEREEAKAMSEHDMLPSEPVTIVLSQMGWV-------- 484
Query: 563 RAQKRGGRGKKAMMTKDEDWINQLFIANTHDYILCFSNYGRLYWLKVWQIPQGSRNSRGK 622
R+ K + K D ++ ++ + GR Y + +P S +G+
Sbjct: 485 RSAKGHDIDAPGLNYKAGDSFKAAVKGKSNQPVVFVDSTGRSYAIDPITLP--SARGQGE 542
Query: 623 PIINMFSLKNKEKITVILPLSNNKRDFPKNNYVFMSTSLGIVKKTLLSNFSNPRKSGIIA 682
P+ +L + +L S+++ + M++ G ++ ++G
Sbjct: 543 PLTGKLTLPPGATVDHMLMESDDQ-------KLLMASDAGYGFVCTFNDLVARNRAGKAL 595
Query: 683 VNLSNEDFLIGAALTDGSYD-IMLFSDSGKAVRFNENSVRAMGRSARGVIGMRLEKKQK- 740
+ L ++ + + + D ++ + +G+ + F + + + + +G + + +
Sbjct: 596 ITLPENAHVMPPVVIEDASDMLLAITQAGRMLMFPVSDLPQLSK-GKGNKIINIPSAEAA 654
Query: 741 -----VIALLVSNNQKQSVLTATENGYGKRTLIKEYTKHNRGTKGIISIKTNKRNG 791
+ L V Q + + R + RG +G + + +
Sbjct: 655 RGEDGLAQLYVLPPQSTLTIHVGKRKIKLRPEELQKVTGERGRRGTLMRGLQRIDR 710
|
| >1zvu_A Topoisomerase IV subunit A; beta-pinwheel, ATPase, supercoiling, decatenation, DNA bindi topology; 3.00A {Escherichia coli} Length = 716 | Back alignment and structure |
|---|
| >3lpx_A GYRA, DNA gyrase, A subunit; topoisomraseii, ATP-binding, isomerase, nucleo binding; HET: DNA; 2.60A {Colwellia psychrerythraea} PDB: 2wl2_A* 2y3p_A* 3nuh_A* 1ab4_A Length = 500 | Back alignment and structure |
|---|
| >2inr_A DNA topoisomerase 4 subunit A; topoisomerase II fold; HET: DNA; 2.80A {Staphylococcus aureus} Length = 514 | Back alignment and structure |
|---|
| >2xcs_B DNA gyrase subunit B, DNA gyrase subunit A; isomerase, type IIA topoisomerase; HET: DNA 5UA RXV; 2.10A {Staphylococcus aureus} PDB: 2xct_B* 2xcr_B* 2xcq_A* 2xco_A* Length = 692 | Back alignment and structure |
|---|
| >2nov_A DNA topoisomerase 4 subunit A; protein, PARC, TOPO IV, GRAM-positive bacteria, quinolone target, DNA binding, DNA cleavage; HET: DNA; 2.67A {Streptococcus pneumoniae} PDB: 3foe_A* 3fof_A* 3k9f_A* 3ksa_A* 3ksb_A* 3ltn_A* 3rad_A* 3rae_A* 3raf_A* Length = 496 | Back alignment and structure |
|---|
| >3ilw_A DNA gyrase subunit A; DNA topology, topoisomerase, antibiotic resistance, breakage-reunion domain, struct genomics; HET: DNA; 1.60A {Mycobacterium tuberculosis} PDB: 3ifz_A* Length = 470 | Back alignment and structure |
|---|
| >2xkj_E Topoisomerase IV; type IIA topoisomerase; 2.20A {Acinetobacter baumannii} PDB: 2xkk_A* Length = 767 | Back alignment and structure |
|---|
| >3l6v_A GYRA, DNA gyrase subunit A; gyrase A C-terminal domain, GYRA C-terminal domain, DNA wrapping, beta-strand-bearing proline, ATP-binding; HET: DNA; 2.19A {Xanthomonas campestris PV} Length = 370 | Back alignment and structure |
|---|
| >3l6v_A GYRA, DNA gyrase subunit A; gyrase A C-terminal domain, GYRA C-terminal domain, DNA wrapping, beta-strand-bearing proline, ATP-binding; HET: DNA; 2.19A {Xanthomonas campestris PV} Length = 370 | Back alignment and structure |
|---|
| >1zi0_A DNA gyrase subunit A; beta pinwheel, topoisomerase, spiralling beta pinwheel, DNA wrapping, isomerase, DNA bindng protein; HET: DNA; 2.60A {Escherichia coli} Length = 307 | Back alignment and structure |
|---|
| >1suu_A DNA gyrase subunit A; topoisomerase,DNA gyrase, beta-propeller, beta-pinwheel, ISO; HET: DNA; 1.75A {Borrelia burgdorferi} SCOP: b.68.10.1 Length = 312 | Back alignment and structure |
|---|
| >3uc1_A DNA gyrase subunit A; DNA binding protein, topoisomerase, isomerase; HET: DNA; 1.65A {Mycobacterium tuberculosis} Length = 327 | Back alignment and structure |
|---|
| >3uc1_A DNA gyrase subunit A; DNA binding protein, topoisomerase, isomerase; HET: DNA; 1.65A {Mycobacterium tuberculosis} Length = 327 | Back alignment and structure |
|---|
| >3uc1_A DNA gyrase subunit A; DNA binding protein, topoisomerase, isomerase; HET: DNA; 1.65A {Mycobacterium tuberculosis} Length = 327 | Back alignment and structure |
|---|
| >3uc1_A DNA gyrase subunit A; DNA binding protein, topoisomerase, isomerase; HET: DNA; 1.65A {Mycobacterium tuberculosis} Length = 327 | Back alignment and structure |
|---|
| >1wp5_A Topoisomerase IV; broken beta-propeller, hairpin-invaded beta-propeller, six- bladed beta-propeller; 1.79A {Geobacillus stearothermophilus} SCOP: b.68.10.1 Length = 323 | Back alignment and structure |
|---|
| >3no0_A DNA gyrase subunit A; DNA topology, topoisomerase, C-terminal DO gyrase, DNA binding protein, isomerase; HET: DNA GOL; 1.30A {Aquifex aeolicus} Length = 276 | Back alignment and structure |
|---|
| >3l4j_A DNA topoisomerase 2; topoisomerase, protein-DNA complex, covalently linked comple supercoiling; HET: DNA PTR TSP; 2.48A {Saccharomyces cerevisiae} PDB: 3l4k_A* 1bjt_A 1bgw_A 2rgr_A* Length = 757 | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Length = 227 | Back alignment and structure |
|---|
| >2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Length = 219 | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Length = 236 | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} PDB: 3r8c_A 4die_A* Length = 233 | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Length = 208 | Back alignment and structure |
|---|
| >2khi_A 30S ribosomal protein S1; acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2khi_A 30S ribosomal protein S1; acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2khi_A 30S ribosomal protein S1; acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2khi_A 30S ribosomal protein S1; acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2a19_A EIF-2- alpha, eukaryotic translation initiation factor 2 alpha; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Saccharomyces cerevisiae} PDB: 2a1a_A* 1q46_A Length = 175 | Back alignment and structure |
|---|
| >2a19_A EIF-2- alpha, eukaryotic translation initiation factor 2 alpha; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Saccharomyces cerevisiae} PDB: 2a1a_A* 1q46_A Length = 175 | Back alignment and structure |
|---|
| >2a19_A EIF-2- alpha, eukaryotic translation initiation factor 2 alpha; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Saccharomyces cerevisiae} PDB: 2a1a_A* 1q46_A Length = 175 | Back alignment and structure |
|---|
| >2k4k_A GSP13, general stress protein 13; cytoplasm, stress response, RNA binding protein; NMR {Bacillus subtilis} Length = 130 | Back alignment and structure |
|---|
| >2k4k_A GSP13, general stress protein 13; cytoplasm, stress response, RNA binding protein; NMR {Bacillus subtilis} Length = 130 | Back alignment and structure |
|---|
| >2k4k_A GSP13, general stress protein 13; cytoplasm, stress response, RNA binding protein; NMR {Bacillus subtilis} Length = 130 | Back alignment and structure |
|---|
| >2k4k_A GSP13, general stress protein 13; cytoplasm, stress response, RNA binding protein; NMR {Bacillus subtilis} Length = 130 | Back alignment and structure |
|---|
| >2k4k_A GSP13, general stress protein 13; cytoplasm, stress response, RNA binding protein; NMR {Bacillus subtilis} Length = 130 | Back alignment and structure |
|---|
| >1kl9_A Eukaryotic translation initiation factor 2 subuni; OB fold, helical domain; 1.90A {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 Length = 182 | Back alignment and structure |
|---|
| >1kl9_A Eukaryotic translation initiation factor 2 subuni; OB fold, helical domain; 1.90A {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 Length = 182 | Back alignment and structure |
|---|
| >1kl9_A Eukaryotic translation initiation factor 2 subuni; OB fold, helical domain; 1.90A {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 Length = 182 | Back alignment and structure |
|---|
| >1kl9_A Eukaryotic translation initiation factor 2 subuni; OB fold, helical domain; 1.90A {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 Length = 182 | Back alignment and structure |
|---|
| >1kl9_A Eukaryotic translation initiation factor 2 subuni; OB fold, helical domain; 1.90A {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 Length = 182 | Back alignment and structure |
|---|
| >1q8k_A Eukaryotic translation initiation factor 2 subunit 1; NMR {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 d.58.51.1 Length = 308 | Back alignment and structure |
|---|
| >1q8k_A Eukaryotic translation initiation factor 2 subunit 1; NMR {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 d.58.51.1 Length = 308 | Back alignment and structure |
|---|
| >1q8k_A Eukaryotic translation initiation factor 2 subunit 1; NMR {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 d.58.51.1 Length = 308 | Back alignment and structure |
|---|
| >1q8k_A Eukaryotic translation initiation factor 2 subunit 1; NMR {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 d.58.51.1 Length = 308 | Back alignment and structure |
|---|
| >3qx3_A DNA topoisomerase 2-beta; toprim domain, winged-helix domain, coiled-coil domain, DNA and cleavage, nucleus; HET: DNA EVP; 2.16A {Homo sapiens} Length = 803 | Back alignment and structure |
|---|
| >2khj_A 30S ribosomal protein S1; OB fold, acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Length = 109 | Back alignment and structure |
|---|
| >2khj_A 30S ribosomal protein S1; OB fold, acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Length = 109 | Back alignment and structure |
|---|
| >2khj_A 30S ribosomal protein S1; OB fold, acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Length = 109 | Back alignment and structure |
|---|
| >2khj_A 30S ribosomal protein S1; OB fold, acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Length = 109 | Back alignment and structure |
|---|
| >2cqo_A Nucleolar protein of 40 kDa; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2cqo_A Nucleolar protein of 40 kDa; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2cqo_A Nucleolar protein of 40 kDa; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >3go5_A Multidomain protein with S1 RNA-binding domains; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.40A {Streptococcus pneumoniae} Length = 285 | Back alignment and structure |
|---|
| >3go5_A Multidomain protein with S1 RNA-binding domains; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.40A {Streptococcus pneumoniae} Length = 285 | Back alignment and structure |
|---|
| >3go5_A Multidomain protein with S1 RNA-binding domains; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.40A {Streptococcus pneumoniae} Length = 285 | Back alignment and structure |
|---|
| >2bh8_A 1B11; transcription, molecular evolution, unique architecture, transcription regulation, phosphorylation; 1.9A {Escherichia coli} Length = 101 | Back alignment and structure |
|---|
| >2bh8_A 1B11; transcription, molecular evolution, unique architecture, transcription regulation, phosphorylation; 1.9A {Escherichia coli} Length = 101 | Back alignment and structure |
|---|
| >2bh8_A 1B11; transcription, molecular evolution, unique architecture, transcription regulation, phosphorylation; 1.9A {Escherichia coli} Length = 101 | Back alignment and structure |
|---|
| >3cw2_C Translation initiation factor 2 subunit alpha; AIF2, intact AIF2, initiation factor 2 alpha subunit, initiation factor 2 beta subunit; 2.80A {Sulfolobus solfataricus} PDB: 2aho_B 3v11_B* Length = 266 | Back alignment and structure |
|---|
| >3cw2_C Translation initiation factor 2 subunit alpha; AIF2, intact AIF2, initiation factor 2 alpha subunit, initiation factor 2 beta subunit; 2.80A {Sulfolobus solfataricus} PDB: 2aho_B 3v11_B* Length = 266 | Back alignment and structure |
|---|
| >3cw2_C Translation initiation factor 2 subunit alpha; AIF2, intact AIF2, initiation factor 2 alpha subunit, initiation factor 2 beta subunit; 2.80A {Sulfolobus solfataricus} PDB: 2aho_B 3v11_B* Length = 266 | Back alignment and structure |
|---|
| >1zvt_A Topoisomerase IV subunit A; beta-pinwheel, ATPase, supercoiling, decatenation, DNA bindi topology; 1.70A {Escherichia coli} Length = 256 | Back alignment and structure |
|---|
| >1zvt_A Topoisomerase IV subunit A; beta-pinwheel, ATPase, supercoiling, decatenation, DNA bindi topology; 1.70A {Escherichia coli} Length = 256 | Back alignment and structure |
|---|
| >2k52_A Uncharacterized protein MJ1198; metal-binding, zinc, zinc-finger, structural genomics, PSI-2, protein structure initiative; NMR {Methanocaldococcus jannaschii} Length = 80 | Back alignment and structure |
|---|
| >2k52_A Uncharacterized protein MJ1198; metal-binding, zinc, zinc-finger, structural genomics, PSI-2, protein structure initiative; NMR {Methanocaldococcus jannaschii} Length = 80 | Back alignment and structure |
|---|
| >2k52_A Uncharacterized protein MJ1198; metal-binding, zinc, zinc-finger, structural genomics, PSI-2, protein structure initiative; NMR {Methanocaldococcus jannaschii} Length = 80 | Back alignment and structure |
|---|
| >2k52_A Uncharacterized protein MJ1198; metal-binding, zinc, zinc-finger, structural genomics, PSI-2, protein structure initiative; NMR {Methanocaldococcus jannaschii} Length = 80 | Back alignment and structure |
|---|
| >2eqs_A ATP-dependent RNA helicase DHX8; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2eqs_A ATP-dependent RNA helicase DHX8; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2eqs_A ATP-dependent RNA helicase DHX8; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >3bzc_A TEX; helix-turn-helix, helix-hairpin-helix, S1 domain, YQGF domain, transcription, RNA binding protein; 2.27A {Pseudomonas aeruginosa} SCOP: a.60.2.6 a.60.2.6 a.294.1.1 b.40.4.5 c.55.3.13 PDB: 3bzk_A 2oce_A Length = 785 | Back alignment and structure |
|---|
| >3bzc_A TEX; helix-turn-helix, helix-hairpin-helix, S1 domain, YQGF domain, transcription, RNA binding protein; 2.27A {Pseudomonas aeruginosa} SCOP: a.60.2.6 a.60.2.6 a.294.1.1 b.40.4.5 c.55.3.13 PDB: 3bzk_A 2oce_A Length = 785 | Back alignment and structure |
|---|
| >3bzc_A TEX; helix-turn-helix, helix-hairpin-helix, S1 domain, YQGF domain, transcription, RNA binding protein; 2.27A {Pseudomonas aeruginosa} SCOP: a.60.2.6 a.60.2.6 a.294.1.1 b.40.4.5 c.55.3.13 PDB: 3bzk_A 2oce_A Length = 785 | Back alignment and structure |
|---|
| >3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} Length = 223 | Back alignment and structure |
|---|
| >3aev_A Translation initiation factor 2 subunit alpha; proteins-rRNA complex, 16S rRNA, RNA-binding; 2.80A {Pyrococcus horikoshii} PDB: 1yz6_A Length = 275 | Back alignment and structure |
|---|
| >3aev_A Translation initiation factor 2 subunit alpha; proteins-rRNA complex, 16S rRNA, RNA-binding; 2.80A {Pyrococcus horikoshii} PDB: 1yz6_A Length = 275 | Back alignment and structure |
|---|
| >3psf_A Transcription elongation factor SPT6; nucleus; 2.59A {Saccharomyces cerevisiae} Length = 1030 | Back alignment and structure |
|---|
| >3psf_A Transcription elongation factor SPT6; nucleus; 2.59A {Saccharomyces cerevisiae} Length = 1030 | Back alignment and structure |
|---|
| >3psf_A Transcription elongation factor SPT6; nucleus; 2.59A {Saccharomyces cerevisiae} Length = 1030 | Back alignment and structure |
|---|
| >3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae} Length = 1219 | Back alignment and structure |
|---|
| >3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae} Length = 1219 | Back alignment and structure |
|---|
| >3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae} Length = 1219 | Back alignment and structure |
|---|
| >4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Length = 726 | Back alignment and structure |
|---|
| >4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Length = 726 | Back alignment and structure |
|---|
| >4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Length = 726 | Back alignment and structure |
|---|
| >3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Length = 723 | Back alignment and structure |
|---|
| >3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Length = 723 | Back alignment and structure |
|---|
| >3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Length = 723 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Length = 757 | Back alignment and structure |
|---|
| >1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Length = 757 | Back alignment and structure |
|---|
| >1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Length = 757 | Back alignment and structure |
|---|
| >1wi5_A RRP5 protein homolog; S1 domain, OB-fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.40.4.5 Length = 119 | Back alignment and structure |
|---|
| >1wi5_A RRP5 protein homolog; S1 domain, OB-fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.40.4.5 Length = 119 | Back alignment and structure |
|---|
| >1wi5_A RRP5 protein homolog; S1 domain, OB-fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.40.4.5 Length = 119 | Back alignment and structure |
|---|
| >1wi5_A RRP5 protein homolog; S1 domain, OB-fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.40.4.5 Length = 119 | Back alignment and structure |
|---|
| >3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Length = 201 | Back alignment and structure |
|---|
| >4ayb_E DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2y0s_E 4b1o_E 4b1p_T 2waq_E 2wb1_E 2pmz_E 3hkz_E Length = 180 | Back alignment and structure |
|---|
| >4ayb_E DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2y0s_E 4b1o_E 4b1p_T 2waq_E 2wb1_E 2pmz_E 3hkz_E Length = 180 | Back alignment and structure |
|---|
| >4ayb_E DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2y0s_E 4b1o_E 4b1p_T 2waq_E 2wb1_E 2pmz_E 3hkz_E Length = 180 | Back alignment and structure |
|---|
| >2id0_A Exoribonuclease 2; RNAse, exonuclease, hydrolyase, mRNA decay, RNR family, hydrolase; 2.35A {Escherichia coli} SCOP: b.40.4.5 b.40.4.5 b.40.4.5 b.40.4.16 PDB: 2ix0_A* 2ix1_A Length = 644 | Back alignment and structure |
|---|
| >2id0_A Exoribonuclease 2; RNAse, exonuclease, hydrolyase, mRNA decay, RNR family, hydrolase; 2.35A {Escherichia coli} SCOP: b.40.4.5 b.40.4.5 b.40.4.5 b.40.4.16 PDB: 2ix0_A* 2ix1_A Length = 644 | Back alignment and structure |
|---|
| >2c35_B Human RPB7, DNA-directed RNA polymerase II 19 kDa polypeptide; transcription, nucleotidyltransferase; 2.70A {Homo sapiens} SCOP: b.40.4.5 d.230.1.1 Length = 172 | Back alignment and structure |
|---|
| >2wp8_J Exosome complex exonuclease DIS3; nucleus, hydrolase, RNA-binding, exonucle binding, mitochondrion, rRNA processing; 3.00A {Saccharomyces cerevisiae} Length = 977 | Back alignment and structure |
|---|
| >2vnu_D Exosome complex exonuclease RRP44; hydrolase-RNA complex, RNA degradation, RNA-binding, RNA Pro; HET: 1PE; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.5 b.40.4.5 b.40.4.5 b.40.4.16 Length = 760 | Back alignment and structure |
|---|
| >3h0g_G DNA-directed RNA polymerase II subunit RPB7; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 172 | Back alignment and structure |
|---|
| >1go3_E DNA-directed RNA polymerase subunit E; transferase, transferase, transcription; 1.75A {Methanococcus jannaschii} SCOP: b.40.4.5 d.230.1.1 Length = 187 | Back alignment and structure |
|---|
| >2b8k_G B16, DNA-directed RNA polymerase II 19 kDa polypeptide; DNA-dependent RNA polymerase, cellular RNA polymerase; 4.15A {Saccharomyces cerevisiae} SCOP: b.40.4.5 d.230.1.1 Length = 215 | Back alignment and structure |
|---|
| >1y14_B B16, RPB7, DNA-directed RNA polymerase II 19 kDa polypeptide; transferase; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.5 d.230.1.1 PDB: 1nt9_G 1wcm_G 1pqv_G 1y1v_G 1y1w_G 1y1y_G 1y77_G* 2b63_G* 2ja5_G* 2ja6_G* 2ja7_G* 2ja8_G* 2r7z_G 2r92_G 2r93_G 2vum_G* 3fki_G 3h3v_H 3hou_G* 3hov_G* ... Length = 171 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1619 | |||
| 1zvu_A | 716 | Topoisomerase IV subunit A; beta-pinwheel, ATPase, | 100.0 | |
| 3lpx_A | 500 | GYRA, DNA gyrase, A subunit; topoisomraseii, ATP-b | 100.0 | |
| 2inr_A | 514 | DNA topoisomerase 4 subunit A; topoisomerase II fo | 100.0 | |
| 2nov_A | 496 | DNA topoisomerase 4 subunit A; protein, PARC, TOPO | 100.0 | |
| 3ilw_A | 470 | DNA gyrase subunit A; DNA topology, topoisomerase, | 100.0 | |
| 2xcs_B | 692 | DNA gyrase subunit B, DNA gyrase subunit A; isomer | 100.0 | |
| 2xkj_E | 767 | Topoisomerase IV; type IIA topoisomerase; 2.20A {A | 100.0 | |
| 3l4j_A | 757 | DNA topoisomerase 2; topoisomerase, protein-DNA co | 100.0 | |
| 3qx3_A | 803 | DNA topoisomerase 2-beta; toprim domain, winged-he | 100.0 | |
| 4gfh_A | 1177 | DNA topoisomerase 2; topoisomerase, protein-DNA co | 100.0 | |
| 3uc1_A | 327 | DNA gyrase subunit A; DNA binding protein, topoiso | 100.0 | |
| 3l6v_A | 370 | GYRA, DNA gyrase subunit A; gyrase A C-terminal do | 100.0 | |
| 1zi0_A | 307 | DNA gyrase subunit A; beta pinwheel, topoisomerase | 100.0 | |
| 1wp5_A | 323 | Topoisomerase IV; broken beta-propeller, hairpin-i | 100.0 | |
| 1suu_A | 312 | DNA gyrase subunit A; topoisomerase,DNA gyrase, be | 100.0 | |
| 3no0_A | 276 | DNA gyrase subunit A; DNA topology, topoisomerase, | 100.0 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 100.0 | |
| 3l6v_A | 370 | GYRA, DNA gyrase subunit A; gyrase A C-terminal do | 100.0 | |
| 1zi0_A | 307 | DNA gyrase subunit A; beta pinwheel, topoisomerase | 100.0 | |
| 1wp5_A | 323 | Topoisomerase IV; broken beta-propeller, hairpin-i | 100.0 | |
| 1zvt_A | 256 | Topoisomerase IV subunit A; beta-pinwheel, ATPase, | 100.0 | |
| 1suu_A | 312 | DNA gyrase subunit A; topoisomerase,DNA gyrase, be | 100.0 | |
| 3uc1_A | 327 | DNA gyrase subunit A; DNA binding protein, topoiso | 99.98 | |
| 3go5_A | 285 | Multidomain protein with S1 RNA-binding domains; s | 99.97 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 99.97 | |
| 1zvt_A | 256 | Topoisomerase IV subunit A; beta-pinwheel, ATPase, | 99.96 | |
| 3ku8_A | 156 | GYRA14, DNA gyrase subunit A; alpha+beta, SH3 doma | 99.96 | |
| 3go5_A | 285 | Multidomain protein with S1 RNA-binding domains; s | 99.96 | |
| 3no0_A | 276 | DNA gyrase subunit A; DNA topology, topoisomerase, | 99.94 | |
| 1zvu_A | 716 | Topoisomerase IV subunit A; beta-pinwheel, ATPase, | 99.94 | |
| 3fdi_A | 201 | Uncharacterized protein; cytidylate kinase like pr | 99.89 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 99.88 | |
| 2h92_A | 219 | Cytidylate kinase; rossmann fold, transferase; HET | 99.86 | |
| 3hdt_A | 223 | Putative kinase; structura genomics, PSI-2, protei | 99.85 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 99.82 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 99.82 | |
| 1kl9_A | 182 | Eukaryotic translation initiation factor 2 subuni; | 99.67 | |
| 2khi_A | 115 | 30S ribosomal protein S1; acetylation, phosphoprot | 99.63 | |
| 1kl9_A | 182 | Eukaryotic translation initiation factor 2 subuni; | 99.61 | |
| 2khi_A | 115 | 30S ribosomal protein S1; acetylation, phosphoprot | 99.59 | |
| 2a19_A | 175 | EIF-2- alpha, eukaryotic translation initiation fa | 99.49 | |
| 2a19_A | 175 | EIF-2- alpha, eukaryotic translation initiation fa | 99.48 | |
| 2khj_A | 109 | 30S ribosomal protein S1; OB fold, acetylation, ph | 99.46 | |
| 2khj_A | 109 | 30S ribosomal protein S1; OB fold, acetylation, ph | 99.41 | |
| 1q8k_A | 308 | Eukaryotic translation initiation factor 2 subunit | 99.4 | |
| 1q8k_A | 308 | Eukaryotic translation initiation factor 2 subunit | 99.37 | |
| 2cqo_A | 119 | Nucleolar protein of 40 kDa; S1 domain, OB-fold, s | 99.35 | |
| 2k4k_A | 130 | GSP13, general stress protein 13; cytoplasm, stres | 99.32 | |
| 2cqo_A | 119 | Nucleolar protein of 40 kDa; S1 domain, OB-fold, s | 99.31 | |
| 2eqs_A | 103 | ATP-dependent RNA helicase DHX8; S1 domain, OB-fol | 99.29 | |
| 3aev_A | 275 | Translation initiation factor 2 subunit alpha; pro | 99.28 | |
| 2eqs_A | 103 | ATP-dependent RNA helicase DHX8; S1 domain, OB-fol | 99.27 | |
| 2k52_A | 80 | Uncharacterized protein MJ1198; metal-binding, zin | 99.27 | |
| 2k4k_A | 130 | GSP13, general stress protein 13; cytoplasm, stres | 99.26 | |
| 3aev_A | 275 | Translation initiation factor 2 subunit alpha; pro | 99.26 | |
| 1luz_A | 88 | Protein K3, protein K2; stranded anti-parallel bet | 99.25 | |
| 2k52_A | 80 | Uncharacterized protein MJ1198; metal-binding, zin | 99.22 | |
| 1luz_A | 88 | Protein K3, protein K2; stranded anti-parallel bet | 99.21 | |
| 1e3p_A | 757 | Guanosine pentaphosphate synthetase; polyribonucle | 99.05 | |
| 1wi5_A | 119 | RRP5 protein homolog; S1 domain, OB-fold, structur | 99.02 | |
| 3cw2_C | 266 | Translation initiation factor 2 subunit alpha; AIF | 99.02 | |
| 3cw2_C | 266 | Translation initiation factor 2 subunit alpha; AIF | 99.01 | |
| 1e3p_A | 757 | Guanosine pentaphosphate synthetase; polyribonucle | 98.96 | |
| 1wi5_A | 119 | RRP5 protein homolog; S1 domain, OB-fold, structur | 98.95 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 98.9 | |
| 3cdi_A | 723 | Polynucleotide phosphorylase; mRNA turnover, RNAse | 98.89 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 98.89 | |
| 3cdi_A | 723 | Polynucleotide phosphorylase; mRNA turnover, RNAse | 98.83 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 98.8 | |
| 4aid_A | 726 | Polyribonucleotide nucleotidyltransferase; transfe | 98.78 | |
| 3psi_A | 1219 | Transcription elongation factor SPT6; nucleus; 3.3 | 98.76 | |
| 4aid_A | 726 | Polyribonucleotide nucleotidyltransferase; transfe | 98.73 | |
| 3psi_A | 1219 | Transcription elongation factor SPT6; nucleus; 3.3 | 98.71 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 98.69 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 98.69 | |
| 1go3_E | 187 | DNA-directed RNA polymerase subunit E; transferase | 98.63 | |
| 3bzc_A | 785 | TEX; helix-turn-helix, helix-hairpin-helix, S1 dom | 98.62 | |
| 3psf_A | 1030 | Transcription elongation factor SPT6; nucleus; 2.5 | 98.59 | |
| 1go3_E | 187 | DNA-directed RNA polymerase subunit E; transferase | 98.59 | |
| 3bzc_A | 785 | TEX; helix-turn-helix, helix-hairpin-helix, S1 dom | 98.57 | |
| 3psf_A | 1030 | Transcription elongation factor SPT6; nucleus; 2.5 | 98.53 | |
| 4ayb_E | 180 | DNA-directed RNA polymerase; transferase, multi-su | 98.52 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 98.52 | |
| 1a7j_A | 290 | Phosphoribulokinase; transferase, calvin cycle; 2. | 98.5 | |
| 2nn6_I | 209 | 3'-5' exoribonuclease CSL4 homolog; RNA, exosome, | 98.48 | |
| 2nn6_I | 209 | 3'-5' exoribonuclease CSL4 homolog; RNA, exosome, | 98.48 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 98.48 | |
| 1hh2_P | 344 | NUSA, N utilization substance protein A; transcrip | 98.47 | |
| 2bh8_A | 101 | 1B11; transcription, molecular evolution, unique a | 98.45 | |
| 2b8k_G | 215 | B16, DNA-directed RNA polymerase II 19 kDa polypep | 98.42 | |
| 3m7n_A | 179 | Putative uncharacterized protein AF_0206; exosome, | 98.41 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 98.39 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 98.39 | |
| 1y14_B | 171 | B16, RPB7, DNA-directed RNA polymerase II 19 kDa p | 98.39 | |
| 2b8k_G | 215 | B16, DNA-directed RNA polymerase II 19 kDa polypep | 98.39 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 98.37 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 98.36 | |
| 1y14_B | 171 | B16, RPB7, DNA-directed RNA polymerase II 19 kDa p | 98.36 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 98.35 | |
| 1hh2_P | 344 | NUSA, N utilization substance protein A; transcrip | 98.34 | |
| 3m7n_A | 179 | Putative uncharacterized protein AF_0206; exosome, | 98.34 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 98.34 | |
| 4ayb_E | 180 | DNA-directed RNA polymerase; transferase, multi-su | 98.33 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 98.32 | |
| 2c35_B | 172 | Human RPB7, DNA-directed RNA polymerase II 19 kDa | 98.32 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 98.31 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 98.3 | |
| 2je6_I | 251 | RRP4, exosome complex RNA-binding protein 1; nucle | 98.28 | |
| 2bh8_A | 101 | 1B11; transcription, molecular evolution, unique a | 98.28 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 98.27 | |
| 2z0s_A | 235 | Probable exosome complex RNA-binding protein 1; al | 98.26 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 98.25 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 98.25 | |
| 2c35_B | 172 | Human RPB7, DNA-directed RNA polymerase II 19 kDa | 98.24 | |
| 2z0s_A | 235 | Probable exosome complex RNA-binding protein 1; al | 98.23 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 98.22 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 98.18 | |
| 2ba0_A | 229 | Archeal exosome RNA binding protein RRP4; RNAse PH | 98.16 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 98.16 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 98.15 | |
| 2ba0_A | 229 | Archeal exosome RNA binding protein RRP4; RNAse PH | 98.13 | |
| 2je6_I | 251 | RRP4, exosome complex RNA-binding protein 1; nucle | 98.1 | |
| 3h0g_G | 172 | DNA-directed RNA polymerase II subunit RPB7; trans | 98.1 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 98.09 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 98.05 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 98.04 | |
| 3h0g_G | 172 | DNA-directed RNA polymerase II subunit RPB7; trans | 98.04 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 98.01 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 97.99 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 97.98 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 97.89 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 97.78 | |
| 4i1u_A | 210 | Dephospho-COA kinase; structural genomics, niaid, | 97.76 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 97.73 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 97.72 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 97.7 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 97.7 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 97.69 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 97.68 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 97.66 | |
| 1m8p_A | 573 | Sulfate adenylyltransferase; rossmann fold, phosph | 97.6 | |
| 3sr0_A | 206 | Adenylate kinase; phosphoryl transfer analogue, AL | 97.6 | |
| 2id0_A | 644 | Exoribonuclease 2; RNAse, exonuclease, hydrolyase, | 97.59 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 97.58 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 97.52 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 97.52 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 97.5 | |
| 2asb_A | 251 | Transcription elongation protein NUSA; protein-RNA | 97.5 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 97.49 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 97.48 | |
| 3ayh_B | 203 | DNA-directed RNA polymerase III subunit RPC8; tran | 97.45 | |
| 2id0_A | 644 | Exoribonuclease 2; RNAse, exonuclease, hydrolyase, | 97.45 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 97.44 | |
| 2ckz_B | 218 | C25, DNA-directed RNA polymerase III 25 KD polypep | 97.37 | |
| 2nn6_H | 308 | Exosome complex exonuclease RRP4; RNA, exosome, PM | 97.36 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 97.33 | |
| 2bx2_L | 517 | Ribonuclease E, RNAse E; RNA-binding, RNA turnover | 97.31 | |
| 3ayh_B | 203 | DNA-directed RNA polymerase III subunit RPC8; tran | 97.3 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 97.27 | |
| 1k0r_A | 366 | NUSA; two component arrangement, S1 domain, two K- | 97.27 | |
| 1k0r_A | 366 | NUSA; two component arrangement, S1 domain, two K- | 97.21 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 97.14 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 97.14 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 97.12 | |
| 1x6v_B | 630 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 97.1 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 97.1 | |
| 2bx2_L | 517 | Ribonuclease E, RNAse E; RNA-binding, RNA turnover | 97.08 | |
| 2ckz_B | 218 | C25, DNA-directed RNA polymerase III 25 KD polypep | 97.08 | |
| 2vnu_D | 760 | Exosome complex exonuclease RRP44; hydrolase-RNA c | 97.06 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 97.05 | |
| 2wp8_J | 977 | Exosome complex exonuclease DIS3; nucleus, hydrola | 96.98 | |
| 2asb_A | 251 | Transcription elongation protein NUSA; protein-RNA | 96.95 | |
| 2nn6_H | 308 | Exosome complex exonuclease RRP4; RNA, exosome, PM | 96.94 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 96.89 | |
| 2ja9_A | 175 | Exosome complex exonuclease RRP40; RNA-binding pro | 96.86 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 96.83 | |
| 2vnu_D | 760 | Exosome complex exonuclease RRP44; hydrolase-RNA c | 96.79 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 96.78 | |
| 2wp8_J | 977 | Exosome complex exonuclease DIS3; nucleus, hydrola | 96.72 | |
| 2ja9_A | 175 | Exosome complex exonuclease RRP40; RNA-binding pro | 96.67 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 96.67 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 96.6 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 96.58 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 96.35 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 96.34 | |
| 3gmt_A | 230 | Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle | 96.23 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 96.2 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 95.99 | |
| 2gks_A | 546 | Bifunctional SAT/APS kinase; transferase, sulfuryl | 95.74 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 95.57 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 95.48 | |
| 3hjn_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 95.37 | |
| 3ch4_B | 202 | Pmkase, phosphomevalonate kinase; parallel beta-sh | 95.35 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 95.05 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 94.66 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 94.21 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 93.94 | |
| 2nn6_G | 289 | Exosome complex exonuclease RRP40; RNA, exosome, P | 93.88 | |
| 4hlc_A | 205 | DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri | 93.84 | |
| 2nn6_G | 289 | Exosome complex exonuclease RRP40; RNA, exosome, P | 93.74 | |
| 3v9p_A | 227 | DTMP kinase, thymidylate kinase; ssgcid, STRU geno | 93.36 | |
| 4edh_A | 213 | DTMP kinase, thymidylate kinase; structural genomi | 93.04 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 92.88 | |
| 3lv8_A | 236 | DTMP kinase, thymidylate kinase; structural genomi | 92.83 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 91.82 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 91.21 | |
| 1p5z_B | 263 | DCK, deoxycytidine kinase; nucleoside kinase, P-lo | 91.14 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 90.93 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 90.67 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 90.49 | |
| 1g8f_A | 511 | Sulfate adenylyltransferase; alpha-beta protein, b | 89.43 | |
| 3tmk_A | 216 | Thymidylate kinase; phosphotransferase; HET: T5A; | 89.23 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 88.87 | |
| 4tmk_A | 213 | Protein (thymidylate kinase); ATP:DTMP phosphotran | 88.69 | |
| 1gxr_A | 337 | ESG1, transducin-like enhancer protein 1; transcri | 88.19 | |
| 3ld9_A | 223 | DTMP kinase, thymidylate kinase; ssgcid, NIH, niai | 87.66 | |
| 2ocp_A | 241 | DGK, deoxyguanosine kinase; protein-nucleotide com | 87.07 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 84.67 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 84.59 | |
| 1r5m_A | 425 | SIR4-interacting protein SIF2; transcription corep | 84.41 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 81.87 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 81.79 |
| >1zvu_A Topoisomerase IV subunit A; beta-pinwheel, ATPase, supercoiling, decatenation, DNA bindi topology; 3.00A {Escherichia coli} | Back alignment and structure |
|---|
Probab=100.00 E-value=4.4e-176 Score=1620.73 Aligned_cols=684 Identities=32% Similarity=0.559 Sum_probs=625.6
Q ss_pred ccccCCCCccCCCcchhHHHHHHHhcCCCCCCCceeEEEehhhhccCcCCCCcchHHHHHHHHhhcCccccccccCCCCC
Q psy14505 30 VGRALPDVRDGLKPVHRRVLFAMHEMNNLWNRPFVKCARVVGETMGKYHPHGDVSIYDALVRMAQSFSLRCTLVDGQGNF 109 (1619)
Q Consensus 30 ~~Ralp~~~DGlKp~qRril~~~~~~~~~~~~~~~K~a~~~g~v~~~yhphgd~s~~~~~v~maq~~~~~~pl~~~~Gnf 109 (1619)
++|||||+|||||||||||||+|+++|++++++|+||||+||+|||+||||||+|+|||||||||+||||||||||||||
T Consensus 1 ~~RAlPdvrDGLKPvqRRILyam~~~~l~~~~~~~K~ArivG~V~gkYHPHGD~SiydaiVrmAQ~fs~r~pLldg~GNF 80 (716)
T 1zvu_A 1 MDRALPFIGDGLKPVQRRIVYAMSELGLNASAKFKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNW 80 (716)
T ss_dssp -CCCCCBTTTCCCHHHHHHHHHHSTTCC----------CCHHHHHTTTSCTTCHHHHHHHHHHTSTTSCSSCSEEECSCC
T ss_pred CCCCCCchhcCCChHHHHHHHHHhhhCCcCCCCceeeHHHHHHHHHhcCCccHHHHHHHHHHHhhcccccceeeecCCCC
Confidence 47999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCCCcc-cccccccccccHHHHHhhccCCCCccccccCCCCCcCCcceecCCCceeeecCCcceeeeeecCCCCCChH
Q psy14505 110 GSIDGDSA-AAMRYTECRLNKISNELLIDLDKETIDFISNYDGKEKEPSVLPTRIPNLLINGSSGIAVGMATNIPPHNLT 188 (1619)
Q Consensus 110 Gs~~g~~~-aa~RY~~~~ls~~~~~~~~~~d~~~~~~~~n~d~~~~eP~~~~~~~P~~L~ng~~Gia~G~at~ip~~n~~ 188 (1619)
||++||+| |||||||||||++|+.||+++|+++|+|+|||||+.+||+||||+|||||||||+|||||||||||||||.
T Consensus 81 GS~dgd~a~AA~RYte~rLs~ia~~ll~~~d~~tvdf~~n~Dg~~~EP~vlp~~iP~lLvNGa~GIavGmaT~IPphNl~ 160 (716)
T 1zvu_A 81 GAPDDPKSFAAMRYTESRLSKYSELLLSELGQGTADWVPNFDGTLQEPKMLPARLPNILLNGTTGIAVGMATDIPPHNLR 160 (716)
T ss_dssp SSSSSCCCTTSSCGGGEEECGGGHHHHTTTTSSCSCEEECTTSSSEEESSCCCSSCHHHHHCCCSCCSSCSCBCCCBCHH
T ss_pred CCCCCCccccccCceEEcchHHHHHHHhhcCccccccccCCCCCcCCchhccccccHHHHcCCCccccceecCCCCCCHH
Confidence 99999999 99999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHhcCCCCChHHHhccCCCCCCCCceEEe-ccccccccceecccEEEEeEEEEEEEeccCCccEEEEEecCCc
Q psy14505 189 EVIDGVLYVLHNPECSINDLIKIIPAPDFPTAGIIY-GLSSVHDGYYTGKGRVIIRAKTHIEEFNRENRTAIIIDELPYQ 267 (1619)
Q Consensus 189 ev~~~~~~~l~~~~~~~~~l~~~~~~p~~p~g~~i~-~~~~~~~~y~~g~G~~~~~~~~~~~~~~~~~~~~i~itelP~~ 267 (1619)
|||+||+++|+||+++.++||+++|||||||||+|. +.+|+.++|+||+|+|++||+|++++ ++|+||||||+
T Consensus 161 Evi~a~~~li~~~~~~~~~l~~~i~gPdFptgG~I~~~~~gI~~aY~tGrG~i~~rg~~~ie~------~~ivITElPy~ 234 (716)
T 1zvu_A 161 EVAQAAIALIDQPKTTLDQLLDIVQGPDYPTEAEIITSRAEIRKIYENGRGSVRMRAVWKKED------GAVVISALPHQ 234 (716)
T ss_dssp HHHHHHHHHHHCTTCCHHHHTTTCCSBCCSSSSEECSCTTHHHHHHHHTEEEEEEECEEEEET------TEEEEEECCTT
T ss_pred HHHHHHHHHhcCCCCCHHHHHhhCCCCCCCCceEEecCchHHHHHhhcCCceEEEEEEEEEEC------CEEEEEeCCCC
Confidence 999999999999999999999999999999999997 58999999999999999999999872 58999999999
Q ss_pred ccHHHHHHHHHHHHhccCcCCcceeecccCC-cceEEEEEecC-CCCHHHHHHHHHhhcccccceeeeEEEE-ECCeeee
Q psy14505 268 VNKKSLLEKISQLVKEKKLECISNLRDESDK-SGMRIVIELKR-NEIPEIVLNKLYKQTQLQNTFGMNMLAL-VNGQPKL 344 (1619)
Q Consensus 268 ~~~~~~~~~i~~~~~~~~~~~i~~~~d~s~~-~~~~i~i~lk~-~~~~~~~~~~l~k~t~l~~~~~~n~~~~-~~~~p~~ 344 (1619)
+|+++|+|+|++++++||+++|+|+||||++ +|+||||++|+ +++++.++++|||+|+||++|++||++| .+|+|++
T Consensus 235 v~~~~lie~I~~l~~~kki~~I~d~rDes~~~~gvrivI~lk~~~~~~~~vl~~L~k~T~Lq~sf~~Nm~~l~~~g~p~~ 314 (716)
T 1zvu_A 235 VSGARVLEQIAAQMRNKKLPMVDDLRDESDHENPTRLVIVPRSNRVDMDQVMNHLFATTDLEKSYRINLNMIGLDGRPAV 314 (716)
T ss_dssp CCHHHHHHHHHHHHHTTSCTTEEEEEECCCSSSTTCEEEEESSSSCCHHHHHHHHHHHSTTEEEEEEECEEECTTSCEEE
T ss_pred CCHHHHHHHHHHHHhcCCCccccchhhccCCCCcEEEEEEECccCCCHHHHHHHHHHhcchhheeeceeEEEccCCeeeE
Confidence 9999999999999999999999999999998 59999999998 6999999999999999999999999999 5999999
Q ss_pred eCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhchhHHHHHHHcCCCHHHHHHHHHhhcCCCCchhhhh
Q psy14505 345 LNLKEILYYFILHRKEVIKRRTIFELRKAREYAHILEGLTIALTNIDNFIQIIRSTSTPQEAKNKIIESTWNLPDVSKII 424 (1619)
Q Consensus 345 ~~l~~il~~f~~~R~~~~~rR~~~~l~k~~~r~~ileg~~~a~~~id~vi~iir~s~~~~~a~~~L~~~~~~~~~~~~~~ 424 (1619)
+|+++||++|++||+++|+||++|+|+|+++|+|+|+||++|++|||+||++||+|+++ +.+||++
T Consensus 315 ~~l~~iL~~f~~~R~~v~~rR~~~~L~k~~~r~hiLegl~ia~~~iDeVI~iIR~s~~~---k~~L~~~----------- 380 (716)
T 1zvu_A 315 KNLLEILSEWLVFRRDTVRRRLNYRLEKVLKRLHILEGLLVAFLNIDEVIEIIRNEDEP---KPALMSR----------- 380 (716)
T ss_dssp CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHHHHHSSSH---HHHHHHS-----------
T ss_pred CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHhhHHHHHHHHHhcCch---HHHHHHh-----------
Confidence 99999999999999999999999999999999999999999999999999999999986 6889975
Q ss_pred hcccccccccccccccccccCCCccccCHHHHHHhhccchhhcchHHHHHHHHHHHHHHHHHHHHHHHhcCHHHHHHHHH
Q psy14505 425 GFNKKNYNTISKINNISKLQNNDMYKLSDIQAQEILKMPLQRLTNMEQKKIINKYENVIKKVIDLTDILSNSKRIIEIIT 504 (1619)
Q Consensus 425 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Qa~aIL~m~L~~Lt~~e~~~l~~e~~~l~~~i~~l~~iL~~~~~~~~~i~ 504 (1619)
|+|||.||+|||+|||||||+||++||++|+++|+++|++|++||+|+++++++|+
T Consensus 381 ------------------------f~lse~QA~aIL~mrL~rLt~le~~kl~~E~~eL~~~i~~l~~iL~~~~~l~~~i~ 436 (716)
T 1zvu_A 381 ------------------------FGLTETQAEAILELKLRHLAKLEEMKIRGEQSELEKERDQLQGILASERKMNNLLK 436 (716)
T ss_dssp ------------------------TTCCTTHHHHHHTCCGGGGSHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHH
T ss_pred ------------------------cCCCHHHHHHHHhhHHHHhhhhHHHHHHHHHHHHHHHHHHHHHHhCCHHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHhCCCCCCCCcccccc--ccCCCCccccccCcceEEEEccCccEEeccCchhhhcccCCCCccccccCCCCe
Q psy14505 505 DELNIIKNKYGSHKKNIRRSEIIL--NAINPSTEDLIASQDMVITLSNLGYIKSQPISEYRAQKRGGRGKKAMMTKDEDW 582 (1619)
Q Consensus 505 ~el~~ik~~f~~~~~~~RrT~I~~--~~~~~~~~~li~~e~~~v~ls~~GyiKr~~~~~~~~~~r~g~g~~~~~~k~~D~ 582 (1619)
+||.+++++||+ +|||+|.+ +..+++.+++|++|+++|++|++|||||+ .++|.|.+++++|++|.
T Consensus 437 ~EL~~i~~kygd----~RRT~I~~~~~~~~~~~edli~~e~v~v~ls~~GyiKr~--------~g~~~~~~~~~~k~~D~ 504 (716)
T 1zvu_A 437 KELQADAQAYGD----DRRSPLQEREEAKAMSEHDMLPSEPVTIVLSQMGWVRSA--------KGHDIDAPGLNYKAGDS 504 (716)
T ss_dssp HHHHHHHHHHCC----CCCSCBCCCCCCCCCCSSTTSCCCCCCEEEETTTEEEEC--------CC---------------
T ss_pred HHHHHHHHHhCC----CccccccccccchhcchhhccCCceEEEEEecCCeEecc--------CCCCcCccccccCCCCe
Confidence 999999999999 99999985 34578899999999999999999999994 44556668899999999
Q ss_pred EEEEEEeeCccEEEEEeeCceEEEEEcccCCCCCccCCCccceecccCCCCceEEEEEecCCCCCCCCCCcEEEEEeCCc
Q psy14505 583 INQLFIANTHDYILCFSNYGRLYWLKVWQIPQGSRNSRGKPIINMFSLKNKEKITVILPLSNNKRDFPKNNYVFMSTSLG 662 (1619)
Q Consensus 583 ~~~~~~~~t~d~llifT~~Gkv~~i~v~elp~~~~~~~G~~i~~ll~l~~~e~i~~i~~~~~~~~~~~~e~~~v~iT~~G 662 (1619)
+.+++.|+|||+||||||.|++|++++|+||++ +++|.|+.+++++++||+|+++++. .++.+++++|++|
T Consensus 505 ~~~~~~~~t~d~ll~ft~~Gr~y~~~~~~lP~~--~~~G~~i~~ll~l~~~e~i~~~~~~-------~~~~~l~~~T~~G 575 (716)
T 1zvu_A 505 FKAAVKGKSNQPVVFVDSTGRSYAIDPITLPSA--RGQGEPLTGKLTLPPGATVDHMLME-------SDDQKLLMASDAG 575 (716)
T ss_dssp CCEEECCCSSSCEEEEETTSEEEEECTTTSCCC--C---CBSTTTSCCCTTCCEEEEECC-------CTTCEEEEEBTTS
T ss_pred EEEEEEecCCCEEEEEecCCcEEEEEeeecccc--cccCeeHHhccCCCCCCeEEEEEEe-------cCCceEEEEeCCc
Confidence 999999999999999999999999999999997 5799999999999999999999987 3567899999999
Q ss_pred eEEEeeCCCCcCCCCCCceeeecCCCCeEEEEEEe-cCCCeEEEEeCCceEEEEecccccccCCCCCCccceecC-----
Q psy14505 663 IVKKTLLSNFSNPRKSGIIAVNLSNEDFLIGAALT-DGSYDIMLFSDSGKAVRFNENSVRAMGRSARGVIGMRLE----- 736 (1619)
Q Consensus 663 ~iKr~~~~~~~~~~r~G~~~~~lke~D~l~~~~~~-~~~d~lll~T~~G~~~~~~~~eIp~~~r~a~Gv~~i~L~----- 736 (1619)
++||+++++|.+.+++|+.+++|++||+++.+..+ +++++|+++|++|++++|+..+||++|| ++||++|+|.
T Consensus 576 ~vk~~~l~~~~~~~~~g~~ai~L~~~d~lv~~~~~~~~~~~v~l~t~~g~~lrf~~~~v~~~gr-~~GV~~i~l~~~~~k 654 (716)
T 1zvu_A 576 YGFVCTFNDLVARNRAGKALITLPENAHVMPPVVIEDASDMLLAITQAGRMLMFPVSDLPQLSK-GKGNKIINIPSAEAA 654 (716)
T ss_dssp EEEEEEGGGGCCCSTTCEECBCCCTTCCBCCCEECCCTTCEEEEEETTSEEEEEESTTSCBCSS-BSCEESSCCCHHHHH
T ss_pred eEEEecHHHhcccCccceEEEeeCCCCEEEEEEEecCCCCEEEEEeCCCeEEEEEHHHCCccCc-ccCeEEEEecccccC
Confidence 99999999999999999999999999999999888 6788999999999999999999999999 9999999999
Q ss_pred -CCCEEEEEEEecCCCCcEEEEEecCc--eeEEecccccccccccccc
Q psy14505 737 -KKQKVIALLVSNNQKQSVLTATENGY--GKRTLIKEYTKHNRGTKGI 781 (1619)
Q Consensus 737 -~~e~Iv~~~~~~~~~~~ll~~T~~G~--~Kr~~l~e~~~~~R~~kG~ 781 (1619)
+||+|+++.++.+ +..+++.+.+|. +|++++++|. ++|+++|+
T Consensus 655 ~~~d~v~~~~~~~~-~~~l~~~~gk~~~~~k~~~~~~~~-~~Rg~~G~ 700 (716)
T 1zvu_A 655 RGEDGLAQLYVLPP-QSTLTIHVGKRKIKLRPEELQKVT-GERGRRGT 700 (716)
T ss_dssp TTSSCEEEEEEECS-SCCEEEEETTEEEEECHHHHTTSB-CCTTSCCE
T ss_pred CCCCEEEEEEEecC-CCeEEEEECCcccccccchhhHhc-cCCCCCCC
Confidence 9999999988765 445666665555 6666999997 78999998
|
| >3lpx_A GYRA, DNA gyrase, A subunit; topoisomraseii, ATP-binding, isomerase, nucleo binding; HET: DNA; 2.60A {Colwellia psychrerythraea} SCOP: e.11.1.1 PDB: 2wl2_A* 2y3p_A* 3nuh_A* 1ab4_A | Back alignment and structure |
|---|
| >2inr_A DNA topoisomerase 4 subunit A; topoisomerase II fold; HET: DNA; 2.80A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2nov_A DNA topoisomerase 4 subunit A; protein, PARC, TOPO IV, GRAM-positive bacteria, quinolone target, DNA binding, DNA cleavage; HET: DNA; 2.67A {Streptococcus pneumoniae} PDB: 3foe_A* 3fof_A* 3k9f_A* 3ksa_A* 3ksb_A* 3ltn_A* 3rad_A* 3rae_A* 3raf_A* | Back alignment and structure |
|---|
| >3ilw_A DNA gyrase subunit A; DNA topology, topoisomerase, antibiotic resistance, breakage-reunion domain, struct genomics; HET: DNA; 1.60A {Mycobacterium tuberculosis} SCOP: e.11.1.0 PDB: 3ifz_A* | Back alignment and structure |
|---|
| >2xcs_B DNA gyrase subunit B, DNA gyrase subunit A; isomerase, type IIA topoisomerase; HET: DNA 5UA RXV; 2.10A {Staphylococcus aureus} PDB: 2xct_B* 2xcr_B* 2xcq_A* 2xco_A* | Back alignment and structure |
|---|
| >2xkj_E Topoisomerase IV; type IIA topoisomerase; 2.20A {Acinetobacter baumannii} PDB: 2xkk_A* | Back alignment and structure |
|---|
| >3l4j_A DNA topoisomerase 2; topoisomerase, protein-DNA complex, covalently linked comple supercoiling; HET: DNA PTR TSP; 2.48A {Saccharomyces cerevisiae} SCOP: e.11.1.1 PDB: 3l4k_A* 1bjt_A 1bgw_A 2rgr_A* | Back alignment and structure |
|---|
| >3qx3_A DNA topoisomerase 2-beta; toprim domain, winged-helix domain, coiled-coil domain, DNA and cleavage, nucleus; HET: DNA EVP; 2.16A {Homo sapiens} PDB: 4fm9_A* | Back alignment and structure |
|---|
| >4gfh_A DNA topoisomerase 2; topoisomerase, protein-DNA complex, DNA supercoiling, DNA replication; HET: DNA PTR TSP ANP; 4.41A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3uc1_A DNA gyrase subunit A; DNA binding protein, topoisomerase, isomerase; HET: DNA; 1.65A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3l6v_A GYRA, DNA gyrase subunit A; gyrase A C-terminal domain, GYRA C-terminal domain, DNA wrapping, beta-strand-bearing proline, ATP-binding; HET: DNA; 2.19A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1zi0_A DNA gyrase subunit A; beta pinwheel, topoisomerase, spiralling beta pinwheel, DNA wrapping, isomerase, DNA bindng protein; HET: DNA; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >1wp5_A Topoisomerase IV; broken beta-propeller, hairpin-invaded beta-propeller, six- bladed beta-propeller; 1.79A {Geobacillus stearothermophilus} SCOP: b.68.10.1 | Back alignment and structure |
|---|
| >1suu_A DNA gyrase subunit A; topoisomerase,DNA gyrase, beta-propeller, beta-pinwheel, ISO; HET: DNA; 1.75A {Borrelia burgdorferi} SCOP: b.68.10.1 | Back alignment and structure |
|---|
| >3no0_A DNA gyrase subunit A; DNA topology, topoisomerase, C-terminal DO gyrase, DNA binding protein, isomerase; HET: DNA GOL; 1.30A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >3l6v_A GYRA, DNA gyrase subunit A; gyrase A C-terminal domain, GYRA C-terminal domain, DNA wrapping, beta-strand-bearing proline, ATP-binding; HET: DNA; 2.19A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1zi0_A DNA gyrase subunit A; beta pinwheel, topoisomerase, spiralling beta pinwheel, DNA wrapping, isomerase, DNA bindng protein; HET: DNA; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >1wp5_A Topoisomerase IV; broken beta-propeller, hairpin-invaded beta-propeller, six- bladed beta-propeller; 1.79A {Geobacillus stearothermophilus} SCOP: b.68.10.1 | Back alignment and structure |
|---|
| >1zvt_A Topoisomerase IV subunit A; beta-pinwheel, ATPase, supercoiling, decatenation, DNA bindi topology; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >1suu_A DNA gyrase subunit A; topoisomerase,DNA gyrase, beta-propeller, beta-pinwheel, ISO; HET: DNA; 1.75A {Borrelia burgdorferi} SCOP: b.68.10.1 | Back alignment and structure |
|---|
| >3uc1_A DNA gyrase subunit A; DNA binding protein, topoisomerase, isomerase; HET: DNA; 1.65A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3go5_A Multidomain protein with S1 RNA-binding domains; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.40A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >1zvt_A Topoisomerase IV subunit A; beta-pinwheel, ATPase, supercoiling, decatenation, DNA bindi topology; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >3go5_A Multidomain protein with S1 RNA-binding domains; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.40A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3no0_A DNA gyrase subunit A; DNA topology, topoisomerase, C-terminal DO gyrase, DNA binding protein, isomerase; HET: DNA GOL; 1.30A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1zvu_A Topoisomerase IV subunit A; beta-pinwheel, ATPase, supercoiling, decatenation, DNA bindi topology; 3.00A {Escherichia coli} | Back alignment and structure |
|---|
| >3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >1kl9_A Eukaryotic translation initiation factor 2 subuni; OB fold, helical domain; 1.90A {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 | Back alignment and structure |
|---|
| >2khi_A 30S ribosomal protein S1; acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1kl9_A Eukaryotic translation initiation factor 2 subuni; OB fold, helical domain; 1.90A {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 | Back alignment and structure |
|---|
| >2khi_A 30S ribosomal protein S1; acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2a19_A EIF-2- alpha, eukaryotic translation initiation factor 2 alpha; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Saccharomyces cerevisiae} PDB: 2a1a_A* 1q46_A | Back alignment and structure |
|---|
| >2a19_A EIF-2- alpha, eukaryotic translation initiation factor 2 alpha; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Saccharomyces cerevisiae} PDB: 2a1a_A* 1q46_A | Back alignment and structure |
|---|
| >2khj_A 30S ribosomal protein S1; OB fold, acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2khj_A 30S ribosomal protein S1; OB fold, acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1q8k_A Eukaryotic translation initiation factor 2 subunit 1; NMR {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 d.58.51.1 | Back alignment and structure |
|---|
| >1q8k_A Eukaryotic translation initiation factor 2 subunit 1; NMR {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 d.58.51.1 | Back alignment and structure |
|---|
| >2cqo_A Nucleolar protein of 40 kDa; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k4k_A GSP13, general stress protein 13; cytoplasm, stress response, RNA binding protein; NMR {Bacillus subtilis} | Back alignment and structure |
|---|
| >2cqo_A Nucleolar protein of 40 kDa; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eqs_A ATP-dependent RNA helicase DHX8; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3aev_A Translation initiation factor 2 subunit alpha; proteins-rRNA complex, 16S rRNA, RNA-binding; 2.80A {Pyrococcus horikoshii} PDB: 1yz6_A | Back alignment and structure |
|---|
| >2eqs_A ATP-dependent RNA helicase DHX8; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k52_A Uncharacterized protein MJ1198; metal-binding, zinc, zinc-finger, structural genomics, PSI-2, protein structure initiative; NMR {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2k4k_A GSP13, general stress protein 13; cytoplasm, stress response, RNA binding protein; NMR {Bacillus subtilis} | Back alignment and structure |
|---|
| >3aev_A Translation initiation factor 2 subunit alpha; proteins-rRNA complex, 16S rRNA, RNA-binding; 2.80A {Pyrococcus horikoshii} PDB: 1yz6_A | Back alignment and structure |
|---|
| >1luz_A Protein K3, protein K2; stranded anti-parallel beta barrel, viral protein; 1.80A {Vaccinia virus} SCOP: b.40.4.5 | Back alignment and structure |
|---|
| >2k52_A Uncharacterized protein MJ1198; metal-binding, zinc, zinc-finger, structural genomics, PSI-2, protein structure initiative; NMR {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1luz_A Protein K3, protein K2; stranded anti-parallel beta barrel, viral protein; 1.80A {Vaccinia virus} SCOP: b.40.4.5 | Back alignment and structure |
|---|
| >1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A | Back alignment and structure |
|---|
| >1wi5_A RRP5 protein homolog; S1 domain, OB-fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.40.4.5 | Back alignment and structure |
|---|
| >3cw2_C Translation initiation factor 2 subunit alpha; AIF2, intact AIF2, initiation factor 2 alpha subunit, initiation factor 2 beta subunit; 2.80A {Sulfolobus solfataricus} PDB: 2aho_B 3v11_B* | Back alignment and structure |
|---|
| >3cw2_C Translation initiation factor 2 subunit alpha; AIF2, intact AIF2, initiation factor 2 alpha subunit, initiation factor 2 beta subunit; 2.80A {Sulfolobus solfataricus} PDB: 2aho_B 3v11_B* | Back alignment and structure |
|---|
| >1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A | Back alignment and structure |
|---|
| >1wi5_A RRP5 protein homolog; S1 domain, OB-fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.40.4.5 | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A | Back alignment and structure |
|---|
| >3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A | Back alignment and structure |
|---|
| >3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >1go3_E DNA-directed RNA polymerase subunit E; transferase, transferase, transcription; 1.75A {Methanococcus jannaschii} SCOP: b.40.4.5 d.230.1.1 | Back alignment and structure |
|---|
| >3bzc_A TEX; helix-turn-helix, helix-hairpin-helix, S1 domain, YQGF domain, transcription, RNA binding protein; 2.27A {Pseudomonas aeruginosa} SCOP: a.60.2.6 a.60.2.6 a.294.1.1 b.40.4.5 c.55.3.13 PDB: 3bzk_A 2oce_A | Back alignment and structure |
|---|
| >3psf_A Transcription elongation factor SPT6; nucleus; 2.59A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1go3_E DNA-directed RNA polymerase subunit E; transferase, transferase, transcription; 1.75A {Methanococcus jannaschii} SCOP: b.40.4.5 d.230.1.1 | Back alignment and structure |
|---|
| >3bzc_A TEX; helix-turn-helix, helix-hairpin-helix, S1 domain, YQGF domain, transcription, RNA binding protein; 2.27A {Pseudomonas aeruginosa} SCOP: a.60.2.6 a.60.2.6 a.294.1.1 b.40.4.5 c.55.3.13 PDB: 3bzk_A 2oce_A | Back alignment and structure |
|---|
| >3psf_A Transcription elongation factor SPT6; nucleus; 2.59A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4ayb_E DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2y0s_E 4b1o_E 4b1p_T 2waq_E 2wb1_E 2pmz_E 3hkz_E | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2nn6_I 3'-5' exoribonuclease CSL4 homolog; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: b.40.4.5 b.84.4.2 | Back alignment and structure |
|---|
| >2nn6_I 3'-5' exoribonuclease CSL4 homolog; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: b.40.4.5 b.84.4.2 | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1hh2_P NUSA, N utilization substance protein A; transcription regulation, termination; 2.1A {Thermotoga maritima} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 PDB: 1l2f_A | Back alignment and structure |
|---|
| >2bh8_A 1B11; transcription, molecular evolution, unique architecture, transcription regulation, phosphorylation; 1.9A {Escherichia coli} | Back alignment and structure |
|---|
| >2b8k_G B16, DNA-directed RNA polymerase II 19 kDa polypeptide; DNA-dependent RNA polymerase, cellular RNA polymerase; 4.15A {Saccharomyces cerevisiae} SCOP: b.40.4.5 d.230.1.1 | Back alignment and structure |
|---|
| >3m7n_A Putative uncharacterized protein AF_0206; exosome, RNA, exonuclease, hydrolase, nuclease, hydrolase-RN; 2.40A {Archaeoglobus fulgidus} PDB: 2ba1_A 3m85_A | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >1y14_B B16, RPB7, DNA-directed RNA polymerase II 19 kDa polypeptide; transferase; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.5 d.230.1.1 PDB: 1nt9_G 1wcm_G 1pqv_G 1y1v_G 1y1w_G 1y1y_G 1y77_G* 2b63_G* 2ja5_G* 2ja6_G* 2ja7_G* 2ja8_G* 2r7z_G 2r92_G 2r93_G 2vum_G* 3fki_G 3h3v_H 3hou_G* 3hov_G* ... | Back alignment and structure |
|---|
| >2b8k_G B16, DNA-directed RNA polymerase II 19 kDa polypeptide; DNA-dependent RNA polymerase, cellular RNA polymerase; 4.15A {Saccharomyces cerevisiae} SCOP: b.40.4.5 d.230.1.1 | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >1y14_B B16, RPB7, DNA-directed RNA polymerase II 19 kDa polypeptide; transferase; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.5 d.230.1.1 PDB: 1nt9_G 1wcm_G 1pqv_G 1y1v_G 1y1w_G 1y1y_G 1y77_G* 2b63_G* 2ja5_G* 2ja6_G* 2ja7_G* 2ja8_G* 2r7z_G 2r92_G 2r93_G 2vum_G* 3fki_G 3h3v_H 3hou_G* 3hov_G* ... | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1hh2_P NUSA, N utilization substance protein A; transcription regulation, termination; 2.1A {Thermotoga maritima} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 PDB: 1l2f_A | Back alignment and structure |
|---|
| >3m7n_A Putative uncharacterized protein AF_0206; exosome, RNA, exonuclease, hydrolase, nuclease, hydrolase-RN; 2.40A {Archaeoglobus fulgidus} PDB: 2ba1_A 3m85_A | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4ayb_E DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2y0s_E 4b1o_E 4b1p_T 2waq_E 2wb1_E 2pmz_E 3hkz_E | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >2c35_B Human RPB7, DNA-directed RNA polymerase II 19 kDa polypeptide; transcription, nucleotidyltransferase; 2.70A {Homo sapiens} SCOP: b.40.4.5 d.230.1.1 | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >2je6_I RRP4, exosome complex RNA-binding protein 1; nuclease, hydrolase, exonuclease, phosphorolytic, exoribonuclease, RNA degradation; HET: 1PE; 1.6A {Sulfolobus solfataricus} SCOP: b.40.4.5 b.84.4.2 d.51.1.1 PDB: 2jea_I* 2jeb_I* 3l7z_C | Back alignment and structure |
|---|
| >2bh8_A 1B11; transcription, molecular evolution, unique architecture, transcription regulation, phosphorylation; 1.9A {Escherichia coli} | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >2z0s_A Probable exosome complex RNA-binding protein 1; alpha/beta protein, cytoplasm, structural genomics, NPPSFA; 3.20A {Aeropyrum pernix} SCOP: b.40.4.5 d.51.1.1 | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >2c35_B Human RPB7, DNA-directed RNA polymerase II 19 kDa polypeptide; transcription, nucleotidyltransferase; 2.70A {Homo sapiens} SCOP: b.40.4.5 d.230.1.1 | Back alignment and structure |
|---|
| >2z0s_A Probable exosome complex RNA-binding protein 1; alpha/beta protein, cytoplasm, structural genomics, NPPSFA; 3.20A {Aeropyrum pernix} SCOP: b.40.4.5 d.51.1.1 | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >2ba0_A Archeal exosome RNA binding protein RRP4; RNAse PH, RNA degradation, exoribonuclease, S1domain, KH domain, archaeal; 2.70A {Archaeoglobus fulgidus} SCOP: b.40.4.5 b.84.4.2 d.51.1.1 | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >2ba0_A Archeal exosome RNA binding protein RRP4; RNAse PH, RNA degradation, exoribonuclease, S1domain, KH domain, archaeal; 2.70A {Archaeoglobus fulgidus} SCOP: b.40.4.5 b.84.4.2 d.51.1.1 | Back alignment and structure |
|---|
| >2je6_I RRP4, exosome complex RNA-binding protein 1; nuclease, hydrolase, exonuclease, phosphorolytic, exoribonuclease, RNA degradation; HET: 1PE; 1.6A {Sulfolobus solfataricus} SCOP: b.40.4.5 b.84.4.2 d.51.1.1 PDB: 2jea_I* 2jeb_I* 3l7z_C | Back alignment and structure |
|---|
| >3h0g_G DNA-directed RNA polymerase II subunit RPB7; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >3h0g_G DNA-directed RNA polymerase II subunit RPB7; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* | Back alignment and structure |
|---|
| >3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* | Back alignment and structure |
|---|
| >2id0_A Exoribonuclease 2; RNAse, exonuclease, hydrolyase, mRNA decay, RNR family, hydrolase; 2.35A {Escherichia coli} SCOP: b.40.4.5 b.40.4.5 b.40.4.5 b.40.4.16 PDB: 2ix0_A* 2ix1_A | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >2asb_A Transcription elongation protein NUSA; protein-RNA complex, transcription/RNA complex; 1.50A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 PDB: 2atw_A | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >3ayh_B DNA-directed RNA polymerase III subunit RPC8; transcription; 2.19A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2id0_A Exoribonuclease 2; RNAse, exonuclease, hydrolyase, mRNA decay, RNR family, hydrolase; 2.35A {Escherichia coli} SCOP: b.40.4.5 b.40.4.5 b.40.4.5 b.40.4.16 PDB: 2ix0_A* 2ix1_A | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2ckz_B C25, DNA-directed RNA polymerase III 25 KD polypeptide; multiprotein complex, nucleotidyltransferase, nuclear protein, hypothetical protein; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2nn6_H Exosome complex exonuclease RRP4; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: b.40.4.5 b.84.4.2 d.51.1.1 | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2bx2_L Ribonuclease E, RNAse E; RNA-binding, RNA turnover, RNA processing, hydrolase, endonu nuclease; 2.85A {Escherichia coli} PDB: 2c0b_L 2c4r_L 2vmk_A 2vrt_A 1slj_A 1smx_A 1sn8_A | Back alignment and structure |
|---|
| >3ayh_B DNA-directed RNA polymerase III subunit RPC8; transcription; 2.19A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >1k0r_A NUSA; two component arrangement, S1 domain, two K-homology domains., structural genomics, PSI, protein structure initiative; 1.70A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 | Back alignment and structure |
|---|
| >1k0r_A NUSA; two component arrangement, S1 domain, two K-homology domains., structural genomics, PSI, protein structure initiative; 1.70A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >2bx2_L Ribonuclease E, RNAse E; RNA-binding, RNA turnover, RNA processing, hydrolase, endonu nuclease; 2.85A {Escherichia coli} PDB: 2c0b_L 2c4r_L 2vmk_A 2vrt_A 1slj_A 1smx_A 1sn8_A | Back alignment and structure |
|---|
| >2ckz_B C25, DNA-directed RNA polymerase III 25 KD polypeptide; multiprotein complex, nucleotidyltransferase, nuclear protein, hypothetical protein; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2vnu_D Exosome complex exonuclease RRP44; hydrolase-RNA complex, RNA degradation, RNA-binding, RNA Pro; HET: 1PE; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.5 b.40.4.5 b.40.4.5 b.40.4.16 | Back alignment and structure |
|---|
| >2wp8_J Exosome complex exonuclease DIS3; nucleus, hydrolase, RNA-binding, exonucle binding, mitochondrion, rRNA processing; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2asb_A Transcription elongation protein NUSA; protein-RNA complex, transcription/RNA complex; 1.50A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 PDB: 2atw_A | Back alignment and structure |
|---|
| >2nn6_H Exosome complex exonuclease RRP4; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: b.40.4.5 b.84.4.2 d.51.1.1 | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >2ja9_A Exosome complex exonuclease RRP40; RNA-binding protein, RNA, S1 domain, KH domain, hydrolase, RNA-binding, nuclear protein; 2.20A {Saccharomyces cerevisiae} SCOP: b.40.4.5 d.51.1.1 | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2vnu_D Exosome complex exonuclease RRP44; hydrolase-RNA complex, RNA degradation, RNA-binding, RNA Pro; HET: 1PE; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.5 b.40.4.5 b.40.4.5 b.40.4.16 | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >2wp8_J Exosome complex exonuclease DIS3; nucleus, hydrolase, RNA-binding, exonucle binding, mitochondrion, rRNA processing; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ja9_A Exosome complex exonuclease RRP40; RNA-binding protein, RNA, S1 domain, KH domain, hydrolase, RNA-binding, nuclear protein; 2.20A {Saccharomyces cerevisiae} SCOP: b.40.4.5 d.51.1.1 | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >2nn6_G Exosome complex exonuclease RRP40; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: b.40.4.5 b.84.4.2 d.51.1.1 | Back alignment and structure |
|---|
| >4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* | Back alignment and structure |
|---|
| >2nn6_G Exosome complex exonuclease RRP40; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: b.40.4.5 b.84.4.2 d.51.1.1 | Back alignment and structure |
|---|
| >3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* | Back alignment and structure |
|---|
| >3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* | Back alignment and structure |
|---|
| >1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A | Back alignment and structure |
|---|
| >3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 1619 | ||||
| d1ab4a_ | 493 | e.11.1.1 (A:) DNA Gyrase A {Escherichia coli [TaxI | 1e-178 | |
| d1bjta_ | 760 | e.11.1.1 (A:) DNA topoisomerase II, C-terminal fra | 4e-73 | |
| d1suua_ | 304 | b.68.10.1 (A:) DNA gyrase A C-terminal domain {Lym | 1e-64 | |
| d1wp5a_ | 323 | b.68.10.1 (A:) Topoisomerase IV subunit A, ParC, C | 2e-56 | |
| d1q3ta_ | 223 | c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae | 9e-40 | |
| d1ckea_ | 225 | c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: | 2e-35 | |
| d1x75a1 | 132 | e.11.1.1 (A:363-494) DNA Gyrase A {Escherichia col | 4e-29 | |
| d3bzka4 | 94 | b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas ae | 7e-19 | |
| d3bzka4 | 94 | b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas ae | 1e-16 | |
| d3bzka4 | 94 | b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas ae | 1e-16 | |
| d3bzka4 | 94 | b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas ae | 3e-04 | |
| d1sroa_ | 76 | b.40.4.5 (A:) S1 RNA-binding domain of polyribonuc | 1e-18 | |
| d1sroa_ | 76 | b.40.4.5 (A:) S1 RNA-binding domain of polyribonuc | 6e-16 | |
| d1sroa_ | 76 | b.40.4.5 (A:) S1 RNA-binding domain of polyribonuc | 7e-16 | |
| d1sroa_ | 76 | b.40.4.5 (A:) S1 RNA-binding domain of polyribonuc | 5e-04 | |
| d1e3pa2 | 62 | b.40.4.5 (A:656-717) S1 RNA-binding domain of poly | 1e-16 | |
| d1e3pa2 | 62 | b.40.4.5 (A:656-717) S1 RNA-binding domain of poly | 1e-14 | |
| d1e3pa2 | 62 | b.40.4.5 (A:656-717) S1 RNA-binding domain of poly | 2e-13 | |
| d1e3pa2 | 62 | b.40.4.5 (A:656-717) S1 RNA-binding domain of poly | 0.002 | |
| d1go3e1 | 106 | b.40.4.5 (E:79-184) C-terminal domain of RNA polym | 3e-15 | |
| d1go3e1 | 106 | b.40.4.5 (E:79-184) C-terminal domain of RNA polym | 5e-15 | |
| d1go3e1 | 106 | b.40.4.5 (E:79-184) C-terminal domain of RNA polym | 9e-13 | |
| d1kl9a2 | 86 | b.40.4.5 (A:3-88) Eukaryotic initiation factor 2al | 5e-14 | |
| d1kl9a2 | 86 | b.40.4.5 (A:3-88) Eukaryotic initiation factor 2al | 1e-13 | |
| d1kl9a2 | 86 | b.40.4.5 (A:3-88) Eukaryotic initiation factor 2al | 1e-13 | |
| d1wi5a_ | 119 | b.40.4.5 (A:) S1-domain of RRP5 protein homolog (P | 1e-13 | |
| d1wi5a_ | 119 | b.40.4.5 (A:) S1-domain of RRP5 protein homolog (P | 1e-11 | |
| d1wi5a_ | 119 | b.40.4.5 (A:) S1-domain of RRP5 protein homolog (P | 4e-11 | |
| d2ba0a1 | 83 | b.40.4.5 (A:53-135) S1-domain of exosome complex R | 1e-13 | |
| d2ba0a1 | 83 | b.40.4.5 (A:53-135) S1-domain of exosome complex R | 2e-12 | |
| d2ba0a1 | 83 | b.40.4.5 (A:53-135) S1-domain of exosome complex R | 3e-12 | |
| d2ahob2 | 84 | b.40.4.5 (B:1-84) Eukaryotic initiation factor 2al | 2e-13 | |
| d2ahob2 | 84 | b.40.4.5 (B:1-84) Eukaryotic initiation factor 2al | 2e-12 | |
| d2ahob2 | 84 | b.40.4.5 (B:1-84) Eukaryotic initiation factor 2al | 7e-12 | |
| d2z0sa1 | 88 | b.40.4.5 (A:60-147) S1-domain of exosome complex R | 2e-13 | |
| d2z0sa1 | 88 | b.40.4.5 (A:60-147) S1-domain of exosome complex R | 8e-13 | |
| d2z0sa1 | 88 | b.40.4.5 (A:60-147) S1-domain of exosome complex R | 9e-13 | |
| d2je6i1 | 87 | b.40.4.5 (I:66-152) S1-domain of exosome complex R | 4e-13 | |
| d2je6i1 | 87 | b.40.4.5 (I:66-152) S1-domain of exosome complex R | 6e-13 | |
| d2je6i1 | 87 | b.40.4.5 (I:66-152) S1-domain of exosome complex R | 2e-12 | |
| d1y14b1 | 91 | b.40.4.5 (B:81-171) C-terminal domain of RNA polym | 2e-11 | |
| d1y14b1 | 91 | b.40.4.5 (B:81-171) C-terminal domain of RNA polym | 1e-09 | |
| d1y14b1 | 91 | b.40.4.5 (B:81-171) C-terminal domain of RNA polym | 2e-08 | |
| d2nn6h1 | 95 | b.40.4.5 (H:73-167) S1-domain of Ribosomal RNA-pro | 1e-10 | |
| d2nn6h1 | 95 | b.40.4.5 (H:73-167) S1-domain of Ribosomal RNA-pro | 4e-10 | |
| d2nn6h1 | 95 | b.40.4.5 (H:73-167) S1-domain of Ribosomal RNA-pro | 3e-09 | |
| d2ix0a3 | 87 | b.40.4.5 (A:558-644) Exoribonuclease 2, RNB {Esche | 6e-10 | |
| d2ix0a3 | 87 | b.40.4.5 (A:558-644) Exoribonuclease 2, RNB {Esche | 2e-09 | |
| d2ix0a3 | 87 | b.40.4.5 (A:558-644) Exoribonuclease 2, RNB {Esche | 2e-04 | |
| d2c35b1 | 94 | b.40.4.5 (B:78-171) C-terminal domain of RNA polym | 9e-10 | |
| d2c35b1 | 94 | b.40.4.5 (B:78-171) C-terminal domain of RNA polym | 2e-07 | |
| d2c35b1 | 94 | b.40.4.5 (B:78-171) C-terminal domain of RNA polym | 1e-05 | |
| d1teva_ | 194 | c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) | 1e-05 | |
| d2nn6g1 | 88 | b.40.4.5 (G:107-194) S1-domain of exosome componen | 1e-05 | |
| d2nn6g1 | 88 | b.40.4.5 (G:107-194) S1-domain of exosome componen | 0.002 | |
| d2nn6g1 | 88 | b.40.4.5 (G:107-194) S1-domain of exosome componen | 0.004 | |
| d1qf9a_ | 194 | c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoi | 2e-05 | |
| d1ukza_ | 196 | c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Sac | 4e-05 | |
| d1zina1 | 182 | c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bac | 6e-04 | |
| d1rkba_ | 173 | c.37.1.1 (A:) Adenylate kinase {Human (Homo sapien | 8e-04 | |
| d1zaka1 | 189 | c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Mai | 0.001 | |
| d1s3ga1 | 182 | c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bac | 0.001 | |
| d2cdna1 | 181 | c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium | 0.001 | |
| d2ak3a1 | 189 | c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow | 0.001 | |
| d1ak2a1 | 190 | c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Co | 0.001 | |
| d1e4va1 | 179 | c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Esc | 0.002 | |
| d3adka_ | 194 | c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [ | 0.002 | |
| d2ja9a1 | 90 | b.40.4.5 (A:62-151) S1-domain of exosome component | 0.003 | |
| d1akya1 | 180 | c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Bak | 0.003 |
| >d1ab4a_ e.11.1.1 (A:) DNA Gyrase A {Escherichia coli [TaxId: 562]} Length = 493 | Back information, alignment and structure |
|---|
class: Multi-domain proteins (alpha and beta) fold: Type II DNA topoisomerase superfamily: Type II DNA topoisomerase family: Type II DNA topoisomerase domain: DNA Gyrase A species: Escherichia coli [TaxId: 562]
Score = 541 bits (1395), Expect = e-178
Identities = 277/497 (55%), Positives = 376/497 (75%), Gaps = 5/497 (1%)
Query: 30 VGRALPDVRDGLKPVHRRVLFAMHEMNNLWNRPFVKCARVVGETMGKYHPHGDVSIYDAL 89
VGRALPDVRDGLKPVHRRVL+AM+ + N WN+ + K ARVVG+ +GKYHPHGD ++YD +
Sbjct: 1 VGRALPDVRDGLKPVHRRVLYAMNVLGNDWNKAYKKSARVVGDVIGKYHPHGDSAVYDTI 60
Query: 90 VRMAQSFSLRCTLVDGQGNFGSIDGDSAAAMRYTECRLNKISNELLIDLDKETIDFISNY 149
VRMAQ FSLR LVDGQGNFGSIDGDSAAAMRYTE RL KI++EL+ DL+KET+DF+ NY
Sbjct: 61 VRMAQPFSLRYMLVDGQGNFGSIDGDSAAAMRYTEIRLAKIAHELMADLEKETVDFVDNY 120
Query: 150 DGKEKEPSVLPTRIPNLLINGSSGIAVGMATNIPPHNLTEVIDGVLYVLHNPECSINDLI 209
DG EK P V+PT+IPNLL+NGSSGIAVGMATNIPPHNLTEVI+G L + + + SI L+
Sbjct: 121 DGTEKIPDVMPTKIPNLLVNGSSGIAVGMATNIPPHNLTEVINGCLAYIDDEDISIEGLM 180
Query: 210 KIIPAPDFPTAGIIYGLSSVHDGYYTGKGRVIIRAKTHIEEFNRENRTAIIIDELPYQVN 269
+ IP PDFPTA II G + + Y TG+G+V IRA+ +E + R II+ E+PYQVN
Sbjct: 181 EHIPGPDFPTAAIINGRRGIEEAYRTGRGKVYIRARAEVEVDAKTGRETIIVHEIPYQVN 240
Query: 270 KKSLLEKISQLVKEKKLECISNLRDESDKSGMRIVIELKRNEIPEIVLNKLYKQTQLQNT 329
K L+EKI++LVKEK++E IS LRDESDK GMRIVIE+KR+ + E+VLN LY QTQLQ +
Sbjct: 241 KARLIEKIAELVKEKRVEGISALRDESDKDGMRIVIEVKRDAVGEVVLNNLYSQTQLQVS 300
Query: 330 FGMNMLALVNGQPKLLNLKEILYYFILHRKEVIKRRTIFELRKAREYAHILEGLTIALTN 389
FG+NM+AL +GQPK++NLK+I+ F+ HR+EV+ RRTIFELRKAR+ AHILE L +AL N
Sbjct: 301 FGINMVALHHGQPKIMNLKDIIAAFVRHRREVVTRRTIFELRKARDRAHILEALAVALAN 360
Query: 390 IDNFIQIIRSTSTPQEAKNKIIESTWNLPDVSKIIGFNKKNYNTISKINNISKLQNNDMY 449
ID I++IR TP EAK ++ + W L +V+ ++ + + ++ + +Y
Sbjct: 361 IDPIIELIRHAPTPAEAKTALVANPWQLGNVAAMLERAGDDAARPEWLEPEFGVR-DGLY 419
Query: 450 KLSDIQAQEILKMPLQRLTNMEQKKIINKYENVIKKVIDLTDILSNSKRIIEIITDELNI 509
L++ QAQ IL + LQ+LT +E +K++++Y+ ++ ++ +L IL ++ R++E+I +EL +
Sbjct: 420 YLTEQQAQAILDLRLQKLTGLEHEKLLDEYKELLDQIAELLRILGSADRLMEVIREELEL 479
Query: 510 IKNKYGSHKKNIRRSEI 526
++ ++G RR+EI
Sbjct: 480 VREQFGDK----RRTEI 492
|
| >d1bjta_ e.11.1.1 (A:) DNA topoisomerase II, C-terminal fragment (residues 410-1202) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 760 | Back information, alignment and structure |
|---|
| >d1suua_ b.68.10.1 (A:) DNA gyrase A C-terminal domain {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Length = 304 | Back information, alignment and structure |
|---|
| >d1wp5a_ b.68.10.1 (A:) Topoisomerase IV subunit A, ParC, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Length = 323 | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Length = 223 | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Length = 225 | Back information, alignment and structure |
|---|
| >d1x75a1 e.11.1.1 (A:363-494) DNA Gyrase A {Escherichia coli [TaxId: 562]} Length = 132 | Back information, alignment and structure |
|---|
| >d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} Length = 94 | Back information, alignment and structure |
|---|
| >d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} Length = 94 | Back information, alignment and structure |
|---|
| >d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} Length = 94 | Back information, alignment and structure |
|---|
| >d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} Length = 94 | Back information, alignment and structure |
|---|
| >d1sroa_ b.40.4.5 (A:) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
| >d1sroa_ b.40.4.5 (A:) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
| >d1sroa_ b.40.4.5 (A:) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
| >d1sroa_ b.40.4.5 (A:) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
| >d1e3pa2 b.40.4.5 (A:656-717) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Streptomyces antibioticus [TaxId: 1890]} Length = 62 | Back information, alignment and structure |
|---|
| >d1e3pa2 b.40.4.5 (A:656-717) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Streptomyces antibioticus [TaxId: 1890]} Length = 62 | Back information, alignment and structure |
|---|
| >d1e3pa2 b.40.4.5 (A:656-717) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Streptomyces antibioticus [TaxId: 1890]} Length = 62 | Back information, alignment and structure |
|---|
| >d1e3pa2 b.40.4.5 (A:656-717) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Streptomyces antibioticus [TaxId: 1890]} Length = 62 | Back information, alignment and structure |
|---|
| >d1go3e1 b.40.4.5 (E:79-184) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 106 | Back information, alignment and structure |
|---|
| >d1go3e1 b.40.4.5 (E:79-184) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 106 | Back information, alignment and structure |
|---|
| >d1go3e1 b.40.4.5 (E:79-184) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 106 | Back information, alignment and structure |
|---|
| >d1kl9a2 b.40.4.5 (A:3-88) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 86 | Back information, alignment and structure |
|---|
| >d1kl9a2 b.40.4.5 (A:3-88) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 86 | Back information, alignment and structure |
|---|
| >d1kl9a2 b.40.4.5 (A:3-88) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 86 | Back information, alignment and structure |
|---|
| >d1wi5a_ b.40.4.5 (A:) S1-domain of RRP5 protein homolog (PDCD11, KIAA0185) {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
| >d1wi5a_ b.40.4.5 (A:) S1-domain of RRP5 protein homolog (PDCD11, KIAA0185) {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
| >d1wi5a_ b.40.4.5 (A:) S1-domain of RRP5 protein homolog (PDCD11, KIAA0185) {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
| >d2ba0a1 b.40.4.5 (A:53-135) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 83 | Back information, alignment and structure |
|---|
| >d2ba0a1 b.40.4.5 (A:53-135) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 83 | Back information, alignment and structure |
|---|
| >d2ba0a1 b.40.4.5 (A:53-135) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 83 | Back information, alignment and structure |
|---|
| >d2ahob2 b.40.4.5 (B:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ahob2 b.40.4.5 (B:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ahob2 b.40.4.5 (B:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} Length = 84 | Back information, alignment and structure |
|---|
| >d2z0sa1 b.40.4.5 (A:60-147) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 88 | Back information, alignment and structure |
|---|
| >d2z0sa1 b.40.4.5 (A:60-147) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 88 | Back information, alignment and structure |
|---|
| >d2z0sa1 b.40.4.5 (A:60-147) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 88 | Back information, alignment and structure |
|---|
| >d2je6i1 b.40.4.5 (I:66-152) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 87 | Back information, alignment and structure |
|---|
| >d2je6i1 b.40.4.5 (I:66-152) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 87 | Back information, alignment and structure |
|---|
| >d2je6i1 b.40.4.5 (I:66-152) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 87 | Back information, alignment and structure |
|---|
| >d1y14b1 b.40.4.5 (B:81-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 91 | Back information, alignment and structure |
|---|
| >d1y14b1 b.40.4.5 (B:81-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 91 | Back information, alignment and structure |
|---|
| >d1y14b1 b.40.4.5 (B:81-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 91 | Back information, alignment and structure |
|---|
| >d2nn6h1 b.40.4.5 (H:73-167) S1-domain of Ribosomal RNA-processing protein 4, RRP4 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2nn6h1 b.40.4.5 (H:73-167) S1-domain of Ribosomal RNA-processing protein 4, RRP4 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2nn6h1 b.40.4.5 (H:73-167) S1-domain of Ribosomal RNA-processing protein 4, RRP4 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2ix0a3 b.40.4.5 (A:558-644) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} Length = 87 | Back information, alignment and structure |
|---|
| >d2ix0a3 b.40.4.5 (A:558-644) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} Length = 87 | Back information, alignment and structure |
|---|
| >d2ix0a3 b.40.4.5 (A:558-644) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} Length = 87 | Back information, alignment and structure |
|---|
| >d2c35b1 b.40.4.5 (B:78-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d2c35b1 b.40.4.5 (B:78-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d2c35b1 b.40.4.5 (B:78-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 194 | Back information, alignment and structure |
|---|
| >d2nn6g1 b.40.4.5 (G:107-194) S1-domain of exosome component 3 (RRP40) {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d2nn6g1 b.40.4.5 (G:107-194) S1-domain of exosome component 3 (RRP40) {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d2nn6g1 b.40.4.5 (G:107-194) S1-domain of exosome component 3 (RRP40) {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Length = 194 | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 196 | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Length = 182 | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Length = 173 | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Length = 189 | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Length = 182 | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Length = 189 | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Length = 190 | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Length = 179 | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Length = 194 | Back information, alignment and structure |
|---|
| >d2ja9a1 b.40.4.5 (A:62-151) S1-domain of exosome component 3 (RRP40) {Saccharomyces cerevisiae [TaxId: 4932]} Length = 90 | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 180 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1619 | |||
| d1ab4a_ | 493 | DNA Gyrase A {Escherichia coli [TaxId: 562]} | 100.0 | |
| d1bjta_ | 760 | DNA topoisomerase II, C-terminal fragment (residue | 100.0 | |
| d1suua_ | 304 | DNA gyrase A C-terminal domain {Lyme disease spiro | 100.0 | |
| d1wp5a_ | 323 | Topoisomerase IV subunit A, ParC, C-terminal domai | 100.0 | |
| d1wp5a_ | 323 | Topoisomerase IV subunit A, ParC, C-terminal domai | 99.98 | |
| d1suua_ | 304 | DNA gyrase A C-terminal domain {Lyme disease spiro | 99.97 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 99.94 | |
| d1x75a1 | 132 | DNA Gyrase A {Escherichia coli [TaxId: 562]} | 99.94 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 99.68 | |
| d1sroa_ | 76 | S1 RNA-binding domain of polyribonucleotide phosph | 99.48 | |
| d1kl9a2 | 86 | Eukaryotic initiation factor 2alpha, eIF2alpha, N- | 99.47 | |
| d1sroa_ | 76 | S1 RNA-binding domain of polyribonucleotide phosph | 99.47 | |
| d3bzka4 | 94 | Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287] | 99.46 | |
| d3bzka4 | 94 | Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287] | 99.42 | |
| d2ahob2 | 84 | Eukaryotic initiation factor 2alpha, eIF2alpha, N- | 99.41 | |
| d1kl9a2 | 86 | Eukaryotic initiation factor 2alpha, eIF2alpha, N- | 99.4 | |
| d2ahob2 | 84 | Eukaryotic initiation factor 2alpha, eIF2alpha, N- | 99.36 | |
| d2ba0a1 | 83 | S1-domain of exosome complex RNA-binding protein 1 | 99.34 | |
| d2ba0a1 | 83 | S1-domain of exosome complex RNA-binding protein 1 | 99.28 | |
| d1wi5a_ | 119 | S1-domain of RRP5 protein homolog (PDCD11, KIAA018 | 99.24 | |
| d1wi5a_ | 119 | S1-domain of RRP5 protein homolog (PDCD11, KIAA018 | 99.22 | |
| d1go3e1 | 106 | C-terminal domain of RNA polymerase II subunit RBP | 99.21 | |
| d1go3e1 | 106 | C-terminal domain of RNA polymerase II subunit RBP | 99.15 | |
| d2je6i1 | 87 | S1-domain of exosome complex RNA-binding protein 1 | 99.14 | |
| d2je6i1 | 87 | S1-domain of exosome complex RNA-binding protein 1 | 99.1 | |
| d2z0sa1 | 88 | S1-domain of exosome complex RNA-binding protein 1 | 99.08 | |
| d2z0sa1 | 88 | S1-domain of exosome complex RNA-binding protein 1 | 99.05 | |
| d1e3pa2 | 62 | S1 RNA-binding domain of polyribonucleotide phosph | 98.99 | |
| d1e3pa2 | 62 | S1 RNA-binding domain of polyribonucleotide phosph | 98.88 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 98.87 | |
| d2nn6h1 | 95 | S1-domain of Ribosomal RNA-processing protein 4, R | 98.77 | |
| d2nn6h1 | 95 | S1-domain of Ribosomal RNA-processing protein 4, R | 98.72 | |
| d2ix0a3 | 87 | Exoribonuclease 2, RNB {Escherichia coli [TaxId: 5 | 98.71 | |
| d2ix0a3 | 87 | Exoribonuclease 2, RNB {Escherichia coli [TaxId: 5 | 98.57 | |
| d1y14b1 | 91 | C-terminal domain of RNA polymerase II subunit RBP | 98.45 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 98.41 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 98.4 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 98.32 | |
| d1y14b1 | 91 | C-terminal domain of RNA polymerase II subunit RBP | 98.3 | |
| d2c35b1 | 94 | C-terminal domain of RNA polymerase II subunit RBP | 98.3 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 98.27 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 98.21 | |
| d2c35b1 | 94 | C-terminal domain of RNA polymerase II subunit RBP | 98.16 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 98.16 | |
| d2nn6g1 | 88 | S1-domain of exosome component 3 (RRP40) {Human (H | 98.16 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 98.14 | |
| d2nn6g1 | 88 | S1-domain of exosome component 3 (RRP40) {Human (H | 98.12 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 98.1 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 98.02 | |
| d1hh2p1 | 72 | S1 domain of NusA {Thermotoga maritima [TaxId: 233 | 98.01 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 98.01 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 98.0 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 97.98 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 97.97 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 97.94 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 97.91 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 97.89 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 97.89 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 97.88 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 97.86 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 97.86 | |
| d2ja9a1 | 90 | S1-domain of exosome component 3 (RRP40) {Saccharo | 97.83 | |
| d1hh2p1 | 72 | S1 domain of NusA {Thermotoga maritima [TaxId: 233 | 97.8 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 97.78 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 97.75 | |
| d2ja9a1 | 90 | S1-domain of exosome component 3 (RRP40) {Saccharo | 97.71 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 97.71 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 97.66 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 97.64 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 97.62 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 97.6 | |
| d2asba1 | 76 | S1 domain of NusA {Mycobacterium tuberculosis [Tax | 97.2 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 97.17 | |
| d2asba1 | 76 | S1 domain of NusA {Mycobacterium tuberculosis [Tax | 97.16 | |
| d2nn6i1 | 125 | Exosome component 1, EXOSC1 {Human (Homo sapiens) | 97.13 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 97.12 | |
| d2nn6i1 | 125 | Exosome component 1, EXOSC1 {Human (Homo sapiens) | 97.07 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 96.99 | |
| d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 96.71 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 96.7 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 95.78 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 95.65 | |
| d1smxa_ | 87 | S1-domain of Ribonuclease E {Escherichia coli [Tax | 95.5 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 95.24 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 94.8 | |
| d1smxa_ | 87 | S1-domain of Ribonuclease E {Escherichia coli [Tax | 94.24 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 92.88 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 92.12 | |
| d1tbga_ | 340 | beta1-subunit of the signal-transducing G protein | 89.58 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 89.05 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 88.26 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 87.91 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 83.71 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 83.69 | |
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 82.82 |
| >d1ab4a_ e.11.1.1 (A:) DNA Gyrase A {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Multi-domain proteins (alpha and beta) fold: Type II DNA topoisomerase superfamily: Type II DNA topoisomerase family: Type II DNA topoisomerase domain: DNA Gyrase A species: Escherichia coli [TaxId: 562]
Probab=100.00 E-value=6.4e-135 Score=1255.28 Aligned_cols=492 Identities=56% Similarity=0.946 Sum_probs=457.6
Q ss_pred ccccCCCCccCCCcchhHHHHHHHhcCCCCCCCceeEEEehhhhccCcCCCCcchHHHHHHHHhhcCccccccccCCCCC
Q psy14505 30 VGRALPDVRDGLKPVHRRVLFAMHEMNNLWNRPFVKCARVVGETMGKYHPHGDVSIYDALVRMAQSFSLRCTLVDGQGNF 109 (1619)
Q Consensus 30 ~~Ralp~~~DGlKp~qRril~~~~~~~~~~~~~~~K~a~~~g~v~~~yhphgd~s~~~~~v~maq~~~~~~pl~~~~Gnf 109 (1619)
++|||||++||||||||||||+|+++|+.++++|+||||+||+|||+||||||+|+|+|||+|||+|+||+||++|||||
T Consensus 1 v~RaiP~~~DGlKp~qRril~~~~~~~l~~~~~~~k~a~~~g~v~~~yHpHGd~s~~~~iv~maq~~~~~~~ll~~~G~F 80 (493)
T d1ab4a_ 1 VGRALPDVRDGLKPVHRRVLYAMNVLGNDWNKAYKKSARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVDGQGNF 80 (493)
T ss_dssp CTTTSCBTTTCCCHHHHHHHHHHHHTTCCSSSCCEEHHHHHHHHHHHTCCSCHHHHHHHHHHTTCTTTCSSCSEEEESCC
T ss_pred CCCCCCccccCCcHHHHHHHHHHHhcCCCCCCCceeeeeeHHHHHhccCCCcHHHHHHHHHHHHHhhhhccccccCCCCC
Confidence 58999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCCCcccccccccccccHHHHHhhccCCCCccccccCCCCCcCCcceecCCCceeeecCCcceeeeeecCCCCCChHH
Q psy14505 110 GSIDGDSAAAMRYTECRLNKISNELLIDLDKETIDFISNYDGKEKEPSVLPTRIPNLLINGSSGIAVGMATNIPPHNLTE 189 (1619)
Q Consensus 110 Gs~~g~~~aa~RY~~~~ls~~~~~~~~~~d~~~~~~~~n~d~~~~eP~~~~~~~P~~L~ng~~Gia~G~at~ip~~n~~e 189 (1619)
||+|||+||||||||||||++|+.||+++|+++|+|+|||||+..||+||||+|||||||||+|||||||||||||||.|
T Consensus 81 Gs~~g~~~Aa~RYi~trLs~~~~~l~~~~d~~~~~~~~n~Dg~~~EP~~~p~~iP~lLvNG~~GIavG~sT~IP~hN~~e 160 (493)
T d1ab4a_ 81 GSIDGDSAAAMRYTEIRLAKIAHELMADLEKETVDFVDNYDGTEKIPDVMPTKIPNLLVNGSSGIAVGMATNIPPHNLTE 160 (493)
T ss_dssp CCTTCCCCCCTTTCEEEECTTHHHHSTTTTTTCSCEEECTTSSSEEESSCCCSSCHHHHHCEEECCSSCCEEECCCCHHH
T ss_pred CCCCCCCCcccchHHhhhhHHHHHHHhhcccccccCccCCCCCcccceeecccchhHHHhhcchhhhhhhhccCCCCHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHhcCCCCChHHHhccCCCCCCCCceEEeccccccccceecccEEEEeEEEEEEEeccCCccEEEEEecCCccc
Q psy14505 190 VIDGVLYVLHNPECSINDLIKIIPAPDFPTAGIIYGLSSVHDGYYTGKGRVIIRAKTHIEEFNRENRTAIIIDELPYQVN 269 (1619)
Q Consensus 190 v~~~~~~~l~~~~~~~~~l~~~~~~p~~p~g~~i~~~~~~~~~y~~g~G~~~~~~~~~~~~~~~~~~~~i~itelP~~~~ 269 (1619)
||+||+++|++++++.++|++++|||||||||+|.|+.|+.++|+||+|++.+||+++++...+.++++|+||||||++|
T Consensus 161 ii~~~~~~i~~~~~~~~~L~~~ipgPdfP~g~~~~g~~~~~~~y~~G~g~i~~r~~~~ie~~~k~~~~tI~ITELP~~~~ 240 (493)
T d1ab4a_ 161 VINGCLAYIDDEDISIEGLMEHIPGPDFPTAAIINGRRGIEEAYRTGRGKVYIRARAEVEVDAKTGRETIIVHEIPYQVN 240 (493)
T ss_dssp HHHHHHHHHHCTTCCHHHHTTTCCSCCCSSCCEECCSHHHHHHHHHSEEEEEEECEEEEEC------CEEEEEECCTTCC
T ss_pred HHHHHHhhhccccccHHHHHhcCCCCCCCCcceEECcccHHHHHhcCCceEEEEeeEEEEeeccCCceEEEEEecCCcCC
Confidence 99999999999999999999999999999999999999999999999999999999999854456788999999999999
Q ss_pred HHHHHHHHHHHHhccCcCCcceeecccCCcceEEEEEecCCCCHHHHHHHHHhhcccccceeeeEEEEECCeeeeeCHHH
Q psy14505 270 KKSLLEKISQLVKEKKLECISNLRDESDKSGMRIVIELKRNEIPEIVLNKLYKQTQLQNTFGMNMLALVNGQPKLLNLKE 349 (1619)
Q Consensus 270 ~~~~~~~i~~~~~~~~~~~i~~~~d~s~~~~~~i~i~lk~~~~~~~~~~~l~k~t~l~~~~~~n~~~~~~~~p~~~~l~~ 349 (1619)
+++|+|+|++++++|++++|+|++|+||++|+||+|+++++.+++.++++|||+|+||+||++||+++++|+|+++|+++
T Consensus 241 t~~~~E~i~~lv~~kki~~I~d~rDes~~~~vr~vI~lk~~~~~~~~~~~L~k~t~L~ss~s~n~~~l~d~~pk~~~l~e 320 (493)
T d1ab4a_ 241 KARLIEKIAELVKEKRVEGISALRDESDKDGMRIVIEVKRDAVGEVVLNNLYSQTQLQVSFGINMVALHHGQPKIMNLKD 320 (493)
T ss_dssp HHHHHHHHHHHHTTTCSSCCCCEEECCCSSSCCEEEC------CHHHHHHHHHHSTTEEEEEEECEEEETTEEEECCHHH
T ss_pred HHHHHHHHHHHHHcCCCCcccccccccCCcceEEEEecCCcchHHHHHHHHHHhhhhhhccceeeeeecCCeeeeccHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhchhHHHHHHHcCCCHHHHHHHHHhhcCCCCchhhhhhcccc
Q psy14505 350 ILYYFILHRKEVIKRRTIFELRKAREYAHILEGLTIALTNIDNFIQIIRSTSTPQEAKNKIIESTWNLPDVSKIIGFNKK 429 (1619)
Q Consensus 350 il~~f~~~R~~~~~rR~~~~l~k~~~r~~ileg~~~a~~~id~vi~iir~s~~~~~a~~~L~~~~~~~~~~~~~~~~~~~ 429 (1619)
||++|++||+++|+||++|+|+++++|+|+|+|+++|+.+||++|++||+|+++++|+..|+...|......+......+
T Consensus 321 IL~~f~~~R~e~~~kR~~y~L~kle~rl~iL~g~~~~i~~IdevI~iIr~s~~~~~ak~~L~~~~~~~~~~~~~~~~~~~ 400 (493)
T d1ab4a_ 321 IIAAFVRHRREVVTRRTIFELRKARDRAHILEALAVALANIDPIIELIRHAPTPAEAKTALVANPWQLGNVAAMLERAGD 400 (493)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHHHHHCSSHHHHHHHHHHSCEECCGGGTTCC----
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhHhhhhccccChHHHHHHHHhcccccchHHHHHHHhcc
Confidence 99999999999999999999999999999999999999999999999999999999999999998887776666555444
Q ss_pred cccccccccccccccCCCccccCHHHHHHhhccchhhcchHHHHHHHHHHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHH
Q psy14505 430 NYNTISKINNISKLQNNDMYKLSDIQAQEILKMPLQRLTNMEQKKIINKYENVIKKVIDLTDILSNSKRIIEIITDELNI 509 (1619)
Q Consensus 430 ~~~~~~~~~~~~~~~~~~~~~~~~~Qa~aIL~m~L~~Lt~~e~~~l~~e~~~l~~~i~~l~~iL~~~~~~~~~i~~el~~ 509 (1619)
+....+..++.++ ..+..|.||+.||+|||+|||||||++|+++|++|+++|++++++|++||+|++++|++|++||++
T Consensus 401 ~~~~~e~~~~~~~-~~~~~y~lse~Qa~~IL~MrL~~LT~le~~kL~~E~~~l~~ei~eL~~iL~s~~~l~~~i~~EL~~ 479 (493)
T d1ab4a_ 401 DAARPEWLEPEFG-VRDGLYYLTEQQAQAILDLRLQKLTGLEHEKLLDEYKELLDQIAELLRILGSADRLMEVIREELEL 479 (493)
T ss_dssp CCCSCTTSCTTSE-ESSSEEECCHHHHHHHHTCCGGGGSHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHH
T ss_pred ccccccccchhcc-ccCCcccCCHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCHHHHHHHHHHHHHH
Confidence 4444444443332 234468999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHhCCCCCCCCcccc
Q psy14505 510 IKNKYGSHKKNIRRSEI 526 (1619)
Q Consensus 510 ik~~f~~~~~~~RrT~I 526 (1619)
++++||+ +|||+|
T Consensus 480 lk~kfg~----~RrT~I 492 (493)
T d1ab4a_ 480 VREQFGD----KRRTEI 492 (493)
T ss_dssp HHHHHCC----CCCSEE
T ss_pred HHHHhCC----CCCCCC
Confidence 9999999 999998
|
| >d1bjta_ e.11.1.1 (A:) DNA topoisomerase II, C-terminal fragment (residues 410-1202) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1suua_ b.68.10.1 (A:) DNA gyrase A C-terminal domain {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} | Back information, alignment and structure |
|---|
| >d1wp5a_ b.68.10.1 (A:) Topoisomerase IV subunit A, ParC, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1wp5a_ b.68.10.1 (A:) Topoisomerase IV subunit A, ParC, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1suua_ b.68.10.1 (A:) DNA gyrase A C-terminal domain {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1x75a1 e.11.1.1 (A:363-494) DNA Gyrase A {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sroa_ b.40.4.5 (A:) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kl9a2 b.40.4.5 (A:3-88) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sroa_ b.40.4.5 (A:) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2ahob2 b.40.4.5 (B:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1kl9a2 b.40.4.5 (A:3-88) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ahob2 b.40.4.5 (B:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2ba0a1 b.40.4.5 (A:53-135) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2ba0a1 b.40.4.5 (A:53-135) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1wi5a_ b.40.4.5 (A:) S1-domain of RRP5 protein homolog (PDCD11, KIAA0185) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi5a_ b.40.4.5 (A:) S1-domain of RRP5 protein homolog (PDCD11, KIAA0185) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1go3e1 b.40.4.5 (E:79-184) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1go3e1 b.40.4.5 (E:79-184) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2je6i1 b.40.4.5 (I:66-152) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2je6i1 b.40.4.5 (I:66-152) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2z0sa1 b.40.4.5 (A:60-147) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2z0sa1 b.40.4.5 (A:60-147) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1e3pa2 b.40.4.5 (A:656-717) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Streptomyces antibioticus [TaxId: 1890]} | Back information, alignment and structure |
|---|
| >d1e3pa2 b.40.4.5 (A:656-717) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Streptomyces antibioticus [TaxId: 1890]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d2nn6h1 b.40.4.5 (H:73-167) S1-domain of Ribosomal RNA-processing protein 4, RRP4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nn6h1 b.40.4.5 (H:73-167) S1-domain of Ribosomal RNA-processing protein 4, RRP4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ix0a3 b.40.4.5 (A:558-644) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ix0a3 b.40.4.5 (A:558-644) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1y14b1 b.40.4.5 (B:81-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1y14b1 b.40.4.5 (B:81-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2c35b1 b.40.4.5 (B:78-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d2c35b1 b.40.4.5 (B:78-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d2nn6g1 b.40.4.5 (G:107-194) S1-domain of exosome component 3 (RRP40) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2nn6g1 b.40.4.5 (G:107-194) S1-domain of exosome component 3 (RRP40) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hh2p1 b.40.4.5 (P:127-198) S1 domain of NusA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d2ja9a1 b.40.4.5 (A:62-151) S1-domain of exosome component 3 (RRP40) {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hh2p1 b.40.4.5 (P:127-198) S1 domain of NusA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2ja9a1 b.40.4.5 (A:62-151) S1-domain of exosome component 3 (RRP40) {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2asba1 b.40.4.5 (A:108-183) S1 domain of NusA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2asba1 b.40.4.5 (A:108-183) S1 domain of NusA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2nn6i1 b.40.4.5 (I:61-185) Exosome component 1, EXOSC1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nn6i1 b.40.4.5 (I:61-185) Exosome component 1, EXOSC1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1smxa_ b.40.4.5 (A:) S1-domain of Ribonuclease E {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1smxa_ b.40.4.5 (A:) S1-domain of Ribonuclease E {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|