Psyllid ID: psy14680
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 78 | ||||||
| 242019024 | 319 | polyrC binding protein, putative [Pedicu | 0.653 | 0.159 | 0.730 | 1e-13 | |
| 322780737 | 483 | hypothetical protein SINV_05815 [Solenop | 0.641 | 0.103 | 0.666 | 2e-13 | |
| 345495410 | 533 | PREDICTED: hypothetical protein LOC10011 | 0.602 | 0.088 | 0.708 | 6e-13 | |
| 321468687 | 573 | hypothetical protein DAPPUDRAFT_225024 [ | 0.705 | 0.095 | 0.696 | 6e-13 | |
| 189239335 | 535 | PREDICTED: similar to pasilla CG16765-PK | 0.589 | 0.085 | 0.723 | 1e-12 | |
| 270009705 | 564 | hypothetical protein TcasGA2_TC008998 [T | 0.589 | 0.081 | 0.723 | 1e-12 | |
| 307213191 | 514 | RNA-binding protein Nova-1 [Harpegnathos | 0.589 | 0.089 | 0.702 | 1e-12 | |
| 332026626 | 514 | RNA-binding protein Nova-1 [Acromyrmex e | 0.589 | 0.089 | 0.702 | 1e-12 | |
| 307181420 | 514 | RNA-binding protein Nova-1 [Camponotus f | 0.589 | 0.089 | 0.702 | 2e-12 | |
| 328784994 | 514 | PREDICTED: RNA-binding protein Nova-2-li | 0.589 | 0.089 | 0.702 | 2e-12 |
| >gi|242019024|ref|XP_002429966.1| polyrC binding protein, putative [Pediculus humanus corporis] gi|212515021|gb|EEB17228.1| polyrC binding protein, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 80.5 bits (197), Expect = 1e-13, Method: Compositional matrix adjust.
Identities = 38/52 (73%), Positives = 45/52 (86%), Gaps = 1/52 (1%)
Query: 7 FIRADGVC-QIKILVPSYAAGAIIGKGGETIAQIQKDTGSKIKMSKANDFYP 57
F+ DG+ +KILVP AAGAIIGKGGETIAQ+QKDTG+++KMSKANDFYP
Sbjct: 60 FLGGDGIVYHLKILVPCIAAGAIIGKGGETIAQLQKDTGARMKMSKANDFYP 111
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|322780737|gb|EFZ09994.1| hypothetical protein SINV_05815 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|345495410|ref|XP_001602171.2| PREDICTED: hypothetical protein LOC100118119 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|321468687|gb|EFX79671.1| hypothetical protein DAPPUDRAFT_225024 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|189239335|ref|XP_973573.2| PREDICTED: similar to pasilla CG16765-PK [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|270009705|gb|EFA06153.1| hypothetical protein TcasGA2_TC008998 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|307213191|gb|EFN88688.1| RNA-binding protein Nova-1 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|332026626|gb|EGI66735.1| RNA-binding protein Nova-1 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|307181420|gb|EFN69015.1| RNA-binding protein Nova-1 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|328784994|ref|XP_003250531.1| PREDICTED: RNA-binding protein Nova-2-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 78 | ||||||
| UNIPROTKB|F8VWX1 | 173 | NOVA1 "RNA-binding protein Nov | 0.628 | 0.283 | 0.653 | 1e-13 | |
| UNIPROTKB|F8VYI3 | 121 | NOVA1 "RNA-binding protein Nov | 0.602 | 0.388 | 0.659 | 2.7e-13 | |
| UNIPROTKB|F8W659 | 211 | NOVA1 "RNA-binding protein Nov | 0.602 | 0.222 | 0.659 | 2.7e-13 | |
| UNIPROTKB|I3L2B5 | 152 | NOVA1 "RNA-binding protein Nov | 0.602 | 0.309 | 0.659 | 2.7e-13 | |
| UNIPROTKB|D4A6P7 | 155 | Nova1 "RNA-binding protein Nov | 0.602 | 0.303 | 0.659 | 2.7e-13 | |
| UNIPROTKB|J3KQU3 | 277 | NOVA1 "RNA-binding protein Nov | 0.602 | 0.169 | 0.659 | 3.3e-13 | |
| UNIPROTKB|F1NP95 | 345 | NOVA1 "Uncharacterized protein | 0.602 | 0.136 | 0.659 | 8.8e-13 | |
| RGD|621345 | 474 | Nova1 "neuro-oncological ventr | 0.602 | 0.099 | 0.659 | 1.9e-12 | |
| UNIPROTKB|F1LMZ7 | 474 | Nova1 "RNA-binding protein Nov | 0.602 | 0.099 | 0.659 | 1.9e-12 | |
| UNIPROTKB|D3DS81 | 483 | NOVA1 "Neuro-oncological ventr | 0.602 | 0.097 | 0.659 | 2e-12 |
| UNIPROTKB|F8VWX1 NOVA1 "RNA-binding protein Nova-1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Score = 178 (67.7 bits), Expect = 1.0e-13, P = 1.0e-13
Identities = 32/49 (65%), Positives = 42/49 (85%)
Query: 9 RADGVCQIKILVPSYAAGAIIGKGGETIAQIQKDTGSKIKMSKANDFYP 57
R DG +K+L+PSYAAG+IIGKGG+TI Q+QK+TG+ IK+SK+ DFYP
Sbjct: 8 REDGQYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYP 56
|
|
| UNIPROTKB|F8VYI3 NOVA1 "RNA-binding protein Nova-1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F8W659 NOVA1 "RNA-binding protein Nova-1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3L2B5 NOVA1 "RNA-binding protein Nova-1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4A6P7 Nova1 "RNA-binding protein Nova-1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J3KQU3 NOVA1 "RNA-binding protein Nova-1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NP95 NOVA1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| RGD|621345 Nova1 "neuro-oncological ventral antigen 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LMZ7 Nova1 "RNA-binding protein Nova-1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D3DS81 NOVA1 "Neuro-oncological ventral antigen 1, isoform CRA_a" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 78 | |||
| cd02396 | 65 | cd02396, PCBP_like_KH, K homology RNA-binding doma | 5e-13 | |
| cd00105 | 64 | cd00105, KH-I, K homology RNA-binding domain, type | 6e-10 | |
| pfam00013 | 59 | pfam00013, KH_1, KH domain | 4e-09 | |
| smart00322 | 68 | smart00322, KH, K homology RNA-binding domain | 5e-08 | |
| pfam13014 | 42 | pfam13014, KH_3, KH domain | 4e-07 | |
| PRK11824 | 693 | PRK11824, PRK11824, polynucleotide phosphorylase/p | 8e-05 | |
| cd02409 | 68 | cd02409, KH-II, KH-II (K homology RNA-binding doma | 5e-04 | |
| cd02394 | 62 | cd02394, vigilin_like_KH, K homology RNA-binding d | 0.001 | |
| cd02393 | 61 | cd02393, PNPase_KH, Polynucleotide phosphorylase ( | 0.002 | |
| TIGR03591 | 684 | TIGR03591, polynuc_phos, polyribonucleotide nucleo | 0.002 |
| >gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
Score = 57.1 bits (139), Expect = 5e-13
Identities = 21/37 (56%), Positives = 32/37 (86%)
Query: 15 QIKILVPSYAAGAIIGKGGETIAQIQKDTGSKIKMSK 51
+++LVPS AG+IIGKGG TI +I+++TG+KI++SK
Sbjct: 1 TLRLLVPSSQAGSIIGKGGSTIKEIREETGAKIRVSK 37
|
Members of this group possess KH domains in a tandem arrangement. Most members, similar to the poly(C) binding proteins (PCBPs) and Nova, containing three KH domains, with the first and second domains, which are represented here, in tandem arrangement, followed by a large spacer region, with the third domain near the C-terminal end of the protein. The poly(C) binding proteins (PCBPs) can be divided into two groups, hnRNPs K/J and the alphaCPs, which share a triple KH domain configuration and poly(C) binding specificity. They play roles in mRNA stabilization, translational activation, and translational silencing. Nova-1 and Nova-2 are nuclear RNA-binding proteins that regulate splicing. This group also contains plant proteins that seem to have two tandem repeat arrrangements, like Hen4, a protein that plays a role in AGAMOUS (AG) pre-mRNA processing and important step in plant development. In general, KH binds single-stranded RNA or DNA. It is found in a wide variety of proteins including ribosomal proteins, transcription factors and post-transcriptional modifiers of mRNA. Length = 65 |
| >gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
| >gnl|CDD|215657 pfam00013, KH_1, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|221895 pfam13014, KH_3, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|236995 PRK11824, PRK11824, polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239092 cd02409, KH-II, KH-II (K homology RNA-binding domain, type II) | Back alignment and domain information |
|---|
| >gnl|CDD|239087 cd02394, vigilin_like_KH, K homology RNA-binding domain_vigilin_like | Back alignment and domain information |
|---|
| >gnl|CDD|239086 cd02393, PNPase_KH, Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >gnl|CDD|234271 TIGR03591, polynuc_phos, polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 78 | |||
| KOG2191|consensus | 402 | 99.66 | ||
| cd02396 | 65 | PCBP_like_KH K homology RNA-binding domain, PCBP_l | 99.65 | |
| PF13014 | 43 | KH_3: KH domain | 99.53 | |
| cd02394 | 62 | vigilin_like_KH K homology RNA-binding domain_vigi | 99.46 | |
| cd00105 | 64 | KH-I K homology RNA-binding domain, type I. KH bin | 99.44 | |
| PF00013 | 60 | KH_1: KH domain syndrome, contains KH motifs.; Int | 99.4 | |
| KOG2190|consensus | 485 | 99.38 | ||
| KOG1676|consensus | 600 | 99.37 | ||
| cd02393 | 61 | PNPase_KH Polynucleotide phosphorylase (PNPase) K | 99.36 | |
| KOG2191|consensus | 402 | 99.23 | ||
| KOG2193|consensus | 584 | 99.19 | ||
| smart00322 | 69 | KH K homology RNA-binding domain. | 99.16 | |
| KOG1676|consensus | 600 | 99.15 | ||
| KOG2192|consensus | 390 | 99.13 | ||
| KOG2193|consensus | 584 | 99.02 | ||
| cd02395 | 120 | SF1_like-KH Splicing factor 1 (SF1) K homology RNA | 98.91 | |
| KOG2190|consensus | 485 | 98.78 | ||
| KOG2192|consensus | 390 | 98.76 | ||
| TIGR03665 | 172 | arCOG04150 arCOG04150 universal archaeal KH domain | 98.57 | |
| PRK13763 | 180 | putative RNA-processing protein; Provisional | 98.5 | |
| KOG1588|consensus | 259 | 98.42 | ||
| KOG0336|consensus | 629 | 98.37 | ||
| PRK13763 | 180 | putative RNA-processing protein; Provisional | 98.34 | |
| TIGR03665 | 172 | arCOG04150 arCOG04150 universal archaeal KH domain | 98.3 | |
| KOG0119|consensus | 554 | 98.23 | ||
| cd02134 | 61 | NusA_KH NusA_K homology RNA-binding domain (KH). N | 98.16 | |
| TIGR02696 | 719 | pppGpp_PNP guanosine pentaphosphate synthetase I/p | 98.08 | |
| TIGR03591 | 684 | polynuc_phos polyribonucleotide nucleotidyltransfe | 98.03 | |
| COG5176 | 269 | MSL5 Splicing factor (branch point binding protein | 97.95 | |
| PRK00468 | 75 | hypothetical protein; Provisional | 97.7 | |
| PRK02821 | 77 | hypothetical protein; Provisional | 97.57 | |
| PRK01064 | 78 | hypothetical protein; Provisional | 97.5 | |
| COG1837 | 76 | Predicted RNA-binding protein (contains KH domain) | 97.43 | |
| KOG2113|consensus | 394 | 97.39 | ||
| KOG2279|consensus | 608 | 97.38 | ||
| COG1185 | 692 | Pnp Polyribonucleotide nucleotidyltransferase (pol | 97.24 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 97.2 | |
| PRK08406 | 140 | transcription elongation factor NusA-like protein; | 97.15 | |
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 97.13 | |
| KOG2814|consensus | 345 | 97.12 | ||
| PLN00207 | 891 | polyribonucleotide nucleotidyltransferase; Provisi | 97.11 | |
| COG1094 | 194 | Predicted RNA-binding protein (contains KH domains | 97.02 | |
| PRK00106 | 535 | hypothetical protein; Provisional | 97.0 | |
| cd02409 | 68 | KH-II KH-II (K homology RNA-binding domain, type I | 96.93 | |
| PRK08406 | 140 | transcription elongation factor NusA-like protein; | 96.91 | |
| PRK11824 | 693 | polynucleotide phosphorylase/polyadenylase; Provis | 96.67 | |
| cd02414 | 77 | jag_KH jag_K homology RNA-binding domain. The KH d | 96.49 | |
| PF13083 | 73 | KH_4: KH domain; PDB: 3GKU_B. | 96.48 | |
| PF13184 | 69 | KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW | 96.47 | |
| PRK04163 | 235 | exosome complex RNA-binding protein Rrp4; Provisio | 96.43 | |
| TIGR01952 | 141 | nusA_arch NusA family KH domain protein, archaeal. | 96.38 | |
| PRK12705 | 508 | hypothetical protein; Provisional | 96.35 | |
| KOG4369|consensus | 2131 | 96.31 | ||
| COG1094 | 194 | Predicted RNA-binding protein (contains KH domains | 96.18 | |
| PF07650 | 78 | KH_2: KH domain syndrome, contains KH motifs.; Int | 96.17 | |
| PRK12328 | 374 | nusA transcription elongation factor NusA; Provisi | 95.91 | |
| TIGR01953 | 341 | NusA transcription termination factor NusA. This m | 95.82 | |
| TIGR01952 | 141 | nusA_arch NusA family KH domain protein, archaeal. | 95.81 | |
| PRK13764 | 602 | ATPase; Provisional | 95.75 | |
| cd02413 | 81 | 40S_S3_KH K homology RNA-binding (KH) domain of th | 95.73 | |
| COG1855 | 604 | ATPase (PilT family) [General function prediction | 95.61 | |
| COG0195 | 190 | NusA Transcription elongation factor [Transcriptio | 95.5 | |
| PRK12327 | 362 | nusA transcription elongation factor NusA; Provisi | 95.2 | |
| PRK09202 | 470 | nusA transcription elongation factor NusA; Validat | 95.19 | |
| KOG2279|consensus | 608 | 95.1 | ||
| PRK06418 | 166 | transcription elongation factor NusA-like protein; | 94.85 | |
| KOG2208|consensus | 753 | 94.69 | ||
| cd02412 | 109 | 30S_S3_KH K homology RNA-binding (KH) domain of th | 94.67 | |
| cd02411 | 85 | archeal_30S_S3_KH K homology RNA-binding domain (K | 94.66 | |
| PRK12329 | 449 | nusA transcription elongation factor NusA; Provisi | 94.43 | |
| COG1097 | 239 | RRP4 RNA-binding protein Rrp4 and related proteins | 94.36 | |
| COG0092 | 233 | RpsC Ribosomal protein S3 [Translation, ribosomal | 93.95 | |
| cd02410 | 145 | archeal_CPSF_KH The archaeal cleavage and polyaden | 93.92 | |
| KOG2113|consensus | 394 | 93.82 | ||
| COG0195 | 190 | NusA Transcription elongation factor [Transcriptio | 93.44 | |
| TIGR00436 | 270 | era GTP-binding protein Era. Era is an essential G | 93.03 | |
| PRK15494 | 339 | era GTPase Era; Provisional | 92.15 | |
| PRK00089 | 292 | era GTPase Era; Reviewed | 91.78 | |
| COG1159 | 298 | Era GTPase [General function prediction only] | 90.36 | |
| TIGR01008 | 195 | rpsC_E_A ribosomal protein S3, eukaryotic/archaeal | 89.52 | |
| PRK04191 | 207 | rps3p 30S ribosomal protein S3P; Reviewed | 89.45 | |
| KOG3273|consensus | 252 | 89.11 | ||
| CHL00048 | 214 | rps3 ribosomal protein S3 | 89.04 | |
| PRK12327 | 362 | nusA transcription elongation factor NusA; Provisi | 88.46 | |
| KOG1423|consensus | 379 | 88.41 | ||
| PTZ00084 | 220 | 40S ribosomal protein S3; Provisional | 88.39 | |
| KOG2208|consensus | 753 | 88.37 | ||
| TIGR01953 | 341 | NusA transcription termination factor NusA. This m | 87.9 | |
| TIGR03675 | 630 | arCOG00543 arCOG00543 universal archaeal KH-domain | 86.88 | |
| COG1847 | 208 | Jag Predicted RNA-binding protein [General functio | 86.3 | |
| PRK12329 | 449 | nusA transcription elongation factor NusA; Provisi | 86.07 | |
| PRK12328 | 374 | nusA transcription elongation factor NusA; Provisi | 84.92 | |
| PRK09202 | 470 | nusA transcription elongation factor NusA; Validat | 83.81 | |
| TIGR01009 | 211 | rpsC_bact ribosomal protein S3, bacterial type. TI | 83.46 | |
| COG1782 | 637 | Predicted metal-dependent RNase, consists of a met | 82.13 |
| >KOG2191|consensus | Back alignment and domain information |
|---|
Probab=99.66 E-value=2e-16 Score=114.39 Aligned_cols=66 Identities=47% Similarity=0.752 Sum_probs=60.2
Q ss_pred CcccCCCeeEEEEEecCCceeeEEecCCchHHHHHHHhCCeEEEecCCCCCCCCceeEEEEeccCC
Q psy14680 6 PFIRADGVCQIKILVPSYAAGAIIGKGGETIAQIQKDTGSKIKMSKANDFYPVYQVITLFLLSRPG 71 (78)
Q Consensus 6 ~~~~~~~~~~~~l~vP~~~vG~IIGk~G~~Ik~i~~~Tga~I~i~~~~~~~~g~~er~v~I~G~p~ 71 (78)
++.-.++...++++||+..+|.||||||++|.+|+++|||+|++++..||+||++||+|.|+|+-+
T Consensus 31 ~n~ge~~~y~ikvLips~AaGsIIGKGG~ti~~lqk~tgariklSks~dfyPGTTeRvcli~Gt~e 96 (402)
T KOG2191|consen 31 TNTGEDGQYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGARIKLSKSKDFYPGTTERVCLIQGTVE 96 (402)
T ss_pred ccCCCCCceEEEEEeecccccceeccchHHHHHHHhccCcEEEeccccccCCCccceEEEEeccHH
Confidence 443345569999999999999999999999999999999999999999999999999999999854
|
|
| >cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
| >PF13014 KH_3: KH domain | Back alignment and domain information |
|---|
| >cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like | Back alignment and domain information |
|---|
| >cd00105 KH-I K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
| >PF00013 KH_1: KH domain syndrome, contains KH motifs | Back alignment and domain information |
|---|
| >KOG2190|consensus | Back alignment and domain information |
|---|
| >KOG1676|consensus | Back alignment and domain information |
|---|
| >cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >KOG2191|consensus | Back alignment and domain information |
|---|
| >KOG2193|consensus | Back alignment and domain information |
|---|
| >smart00322 KH K homology RNA-binding domain | Back alignment and domain information |
|---|
| >KOG1676|consensus | Back alignment and domain information |
|---|
| >KOG2192|consensus | Back alignment and domain information |
|---|
| >KOG2193|consensus | Back alignment and domain information |
|---|
| >cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >KOG2190|consensus | Back alignment and domain information |
|---|
| >KOG2192|consensus | Back alignment and domain information |
|---|
| >TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein | Back alignment and domain information |
|---|
| >PRK13763 putative RNA-processing protein; Provisional | Back alignment and domain information |
|---|
| >KOG1588|consensus | Back alignment and domain information |
|---|
| >KOG0336|consensus | Back alignment and domain information |
|---|
| >PRK13763 putative RNA-processing protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein | Back alignment and domain information |
|---|
| >KOG0119|consensus | Back alignment and domain information |
|---|
| >cd02134 NusA_KH NusA_K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase | Back alignment and domain information |
|---|
| >TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >COG5176 MSL5 Splicing factor (branch point binding protein) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK00468 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK02821 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK01064 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1837 Predicted RNA-binding protein (contains KH domain) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2113|consensus | Back alignment and domain information |
|---|
| >KOG2279|consensus | Back alignment and domain information |
|---|
| >COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >PRK08406 transcription elongation factor NusA-like protein; Validated | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >KOG2814|consensus | Back alignment and domain information |
|---|
| >PLN00207 polyribonucleotide nucleotidyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00106 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd02409 KH-II KH-II (K homology RNA-binding domain, type II) | Back alignment and domain information |
|---|
| >PRK08406 transcription elongation factor NusA-like protein; Validated | Back alignment and domain information |
|---|
| >PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >cd02414 jag_KH jag_K homology RNA-binding domain | Back alignment and domain information |
|---|
| >PF13083 KH_4: KH domain; PDB: 3GKU_B | Back alignment and domain information |
|---|
| >PF13184 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW_A 1K0R_B 2ASB_A | Back alignment and domain information |
|---|
| >PRK04163 exosome complex RNA-binding protein Rrp4; Provisional | Back alignment and domain information |
|---|
| >TIGR01952 nusA_arch NusA family KH domain protein, archaeal | Back alignment and domain information |
|---|
| >PRK12705 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG4369|consensus | Back alignment and domain information |
|---|
| >COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] | Back alignment and domain information |
|---|
| >PF07650 KH_2: KH domain syndrome, contains KH motifs | Back alignment and domain information |
|---|
| >PRK12328 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >TIGR01953 NusA transcription termination factor NusA | Back alignment and domain information |
|---|
| >TIGR01952 nusA_arch NusA family KH domain protein, archaeal | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >cd02413 40S_S3_KH K homology RNA-binding (KH) domain of the eukaryotic 40S small ribosomal subunit protein S3 | Back alignment and domain information |
|---|
| >COG1855 ATPase (PilT family) [General function prediction only] | Back alignment and domain information |
|---|
| >COG0195 NusA Transcription elongation factor [Transcription] | Back alignment and domain information |
|---|
| >PRK12327 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >PRK09202 nusA transcription elongation factor NusA; Validated | Back alignment and domain information |
|---|
| >KOG2279|consensus | Back alignment and domain information |
|---|
| >PRK06418 transcription elongation factor NusA-like protein; Validated | Back alignment and domain information |
|---|
| >KOG2208|consensus | Back alignment and domain information |
|---|
| >cd02412 30S_S3_KH K homology RNA-binding (KH) domain of the prokaryotic 30S small ribosomal subunit protein S3 | Back alignment and domain information |
|---|
| >cd02411 archeal_30S_S3_KH K homology RNA-binding domain (KH) of the archaeal 30S small ribosomal subunit S3 protein | Back alignment and domain information |
|---|
| >PRK12329 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >COG1097 RRP4 RNA-binding protein Rrp4 and related proteins (contain S1 domain and KH domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG0092 RpsC Ribosomal protein S3 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd02410 archeal_CPSF_KH The archaeal cleavage and polyadenylation specificity factor (CPSF) contains an N-terminal K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >KOG2113|consensus | Back alignment and domain information |
|---|
| >COG0195 NusA Transcription elongation factor [Transcription] | Back alignment and domain information |
|---|
| >TIGR00436 era GTP-binding protein Era | Back alignment and domain information |
|---|
| >PRK15494 era GTPase Era; Provisional | Back alignment and domain information |
|---|
| >PRK00089 era GTPase Era; Reviewed | Back alignment and domain information |
|---|
| >COG1159 Era GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01008 rpsC_E_A ribosomal protein S3, eukaryotic/archaeal type | Back alignment and domain information |
|---|
| >PRK04191 rps3p 30S ribosomal protein S3P; Reviewed | Back alignment and domain information |
|---|
| >KOG3273|consensus | Back alignment and domain information |
|---|
| >CHL00048 rps3 ribosomal protein S3 | Back alignment and domain information |
|---|
| >PRK12327 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >KOG1423|consensus | Back alignment and domain information |
|---|
| >PTZ00084 40S ribosomal protein S3; Provisional | Back alignment and domain information |
|---|
| >KOG2208|consensus | Back alignment and domain information |
|---|
| >TIGR01953 NusA transcription termination factor NusA | Back alignment and domain information |
|---|
| >TIGR03675 arCOG00543 arCOG00543 universal archaeal KH-domain/beta-lactamase-domain protein | Back alignment and domain information |
|---|
| >COG1847 Jag Predicted RNA-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12329 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >PRK12328 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >PRK09202 nusA transcription elongation factor NusA; Validated | Back alignment and domain information |
|---|
| >TIGR01009 rpsC_bact ribosomal protein S3, bacterial type | Back alignment and domain information |
|---|
| >COG1782 Predicted metal-dependent RNase, consists of a metallo-beta-lactamase domain and an RNA-binding KH domain [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 78 | ||||
| 2ann_A | 178 | Crystal Structure (I) Of Nova-1 Kh1KH2 DOMAIN TANDE | 6e-13 | ||
| 2anr_A | 178 | Crystal Structure (Ii) Of Nova-1 Kh1KH2 DOMAIN TAND | 7e-13 | ||
| 1ec6_A | 87 | Crystal Structure Of Nova-2 Kh3 K-Homology Rna-Bind | 1e-05 | ||
| 1dt4_A | 73 | Crystal Structure Of Nova-1 Kh3 K-Homology Rna-Bind | 2e-05 | ||
| 1dtj_A | 76 | Crystal Structure Of Nova-2 Kh3 K-Homology Rna-Bind | 2e-05 | ||
| 1ztg_A | 74 | Human Alpha Polyc Binding Protein Kh1 Length = 74 | 7e-04 |
| >pdb|2ANN|A Chain A, Crystal Structure (I) Of Nova-1 Kh1KH2 DOMAIN TANDEM WITH 25 NT RNA Hairpin Length = 178 | Back alignment and structure |
|
| >pdb|2ANR|A Chain A, Crystal Structure (Ii) Of Nova-1 Kh1KH2 DOMAIN TANDEM WITH 25NT RNA Hairpin Length = 178 | Back alignment and structure |
| >pdb|1EC6|A Chain A, Crystal Structure Of Nova-2 Kh3 K-Homology Rna-Binding Domain Bound To 20-Mer Rna Hairpin Length = 87 | Back alignment and structure |
| >pdb|1DT4|A Chain A, Crystal Structure Of Nova-1 Kh3 K-Homology Rna-Binding Domain Length = 73 | Back alignment and structure |
| >pdb|1DTJ|A Chain A, Crystal Structure Of Nova-2 Kh3 K-Homology Rna-Binding Domain Length = 76 | Back alignment and structure |
| >pdb|1ZTG|A Chain A, Human Alpha Polyc Binding Protein Kh1 Length = 74 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 78 | |||
| 1dtj_A | 76 | RNA-binding neurooncological ventral antigen 2; KH | 7e-15 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 7e-15 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 6e-11 | |
| 1ec6_A | 87 | RNA-binding protein NOVA-2; KH domain, alpha-beta | 1e-14 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 2e-14 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 5e-10 | |
| 2axy_A | 73 | Poly(RC)-binding protein 2; protein-DNA complex, D | 2e-13 | |
| 2hh3_A | 106 | KH-type splicing regulatory protein; KH-RNA bindin | 2e-13 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 4e-13 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 1e-10 | |
| 1x4m_A | 94 | FAR upstream element binding protein 1; KH domain, | 6e-13 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 6e-13 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 3e-10 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 1e-12 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 3e-10 | |
| 2opv_A | 85 | KHSRP protein; KH domain, RNA binding protein, KSR | 2e-12 | |
| 2hh2_A | 107 | KH-type splicing regulatory protein; KH-RNA bindin | 3e-12 | |
| 1zzk_A | 82 | Heterogeneous nuclear ribonucleoprotein K; KH domi | 4e-12 | |
| 1j5k_A | 89 | Heterogeneous nuclear ribonucleoprotein K; single- | 5e-12 | |
| 1wvn_A | 82 | Poly(RC)-binding protein 1; KH domain, RNA binding | 1e-11 | |
| 2p2r_A | 76 | Poly(RC)-binding protein 2; protein-DNA complex, R | 2e-11 | |
| 1x4n_A | 92 | FAR upstream element binding protein 1; KH domain, | 5e-11 | |
| 1we8_A | 104 | Tudor and KH domain containing protein; structural | 4e-10 | |
| 2dgr_A | 83 | Ring finger and KH domain-containing protein 1; st | 7e-09 | |
| 2cte_A | 94 | Vigilin; K homology type I domain, RNA-binding, ce | 8e-09 | |
| 2ctl_A | 97 | Vigilin; K homology type I domain, RNA-binding, ce | 1e-08 | |
| 2e3u_A | 219 | PH-DIM2P, hypothetical protein PH1566; PRE-ribosom | 5e-08 | |
| 2ctk_A | 104 | Vigilin; K homology type I domain, RNA-binding, ce | 4e-07 | |
| 1vig_A | 71 | Vigilin; RNA-binding protein, ribonucleoprotein; N | 6e-07 | |
| 1tua_A | 191 | Hypothetical protein APE0754; structural genomics, | 2e-06 | |
| 2ctm_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 3e-06 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 2e-05 | |
| 4aid_A | 726 | Polyribonucleotide nucleotidyltransferase; transfe | 4e-05 | |
| 2cxc_A | 144 | NUSA; transcription termination, RNA binding prote | 6e-05 | |
| 3u1k_A | 630 | Polyribonucleotide nucleotidyltransferase 1, MITO; | 6e-05 | |
| 3cdi_A | 723 | Polynucleotide phosphorylase; mRNA turnover, RNAse | 8e-05 | |
| 1e3p_A | 757 | Guanosine pentaphosphate synthetase; polyribonucle | 2e-04 |
| >1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 | Back alignment and structure |
|---|
Score = 61.9 bits (151), Expect = 7e-15
Identities = 18/43 (41%), Positives = 31/43 (72%)
Query: 15 QIKILVPSYAAGAIIGKGGETIAQIQKDTGSKIKMSKANDFYP 57
+++ VP GAI+GKGG+T+ + Q+ TG++I++SK +F P
Sbjct: 4 LVEMAVPENLVGAILGKGGKTLVEYQELTGARIQISKKGEFLP 46
|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 | Back alignment and structure |
|---|
| >1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 | Back alignment and structure |
|---|
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 | Back alignment and structure |
|---|
| >1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 | Back alignment and structure |
|---|
| >1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 | Back alignment and structure |
|---|
| >1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 | Back alignment and structure |
|---|
| >2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 | Back alignment and structure |
|---|
| >1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 | Back alignment and structure |
|---|
| >2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 83 | Back alignment and structure |
|---|
| >2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97 | Back alignment and structure |
|---|
| >2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Length = 219 | Back alignment and structure |
|---|
| >2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104 | Back alignment and structure |
|---|
| >1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71 | Back alignment and structure |
|---|
| >1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Length = 191 | Back alignment and structure |
|---|
| >2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 | Back alignment and structure |
|---|
| >4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Length = 726 | Back alignment and structure |
|---|
| >2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A Length = 144 | Back alignment and structure |
|---|
| >3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} Length = 630 | Back alignment and structure |
|---|
| >3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Length = 723 | Back alignment and structure |
|---|
| >1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Length = 757 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 78 | |||
| 1dtj_A | 76 | RNA-binding neurooncological ventral antigen 2; KH | 99.73 | |
| 1ec6_A | 87 | RNA-binding protein NOVA-2; KH domain, alpha-beta | 99.69 | |
| 1wvn_A | 82 | Poly(RC)-binding protein 1; KH domain, RNA binding | 99.68 | |
| 1zzk_A | 82 | Heterogeneous nuclear ribonucleoprotein K; KH domi | 99.67 | |
| 1x4m_A | 94 | FAR upstream element binding protein 1; KH domain, | 99.67 | |
| 2axy_A | 73 | Poly(RC)-binding protein 2; protein-DNA complex, D | 99.67 | |
| 2opv_A | 85 | KHSRP protein; KH domain, RNA binding protein, KSR | 99.66 | |
| 2p2r_A | 76 | Poly(RC)-binding protein 2; protein-DNA complex, R | 99.66 | |
| 2dgr_A | 83 | Ring finger and KH domain-containing protein 1; st | 99.65 | |
| 1x4n_A | 92 | FAR upstream element binding protein 1; KH domain, | 99.63 | |
| 1j5k_A | 89 | Heterogeneous nuclear ribonucleoprotein K; single- | 99.63 | |
| 2hh2_A | 107 | KH-type splicing regulatory protein; KH-RNA bindin | 99.62 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 99.59 | |
| 1we8_A | 104 | Tudor and KH domain containing protein; structural | 99.59 | |
| 2hh3_A | 106 | KH-type splicing regulatory protein; KH-RNA bindin | 99.57 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 99.54 | |
| 2ctl_A | 97 | Vigilin; K homology type I domain, RNA-binding, ce | 99.53 | |
| 1vig_A | 71 | Vigilin; RNA-binding protein, ribonucleoprotein; N | 99.53 | |
| 2cte_A | 94 | Vigilin; K homology type I domain, RNA-binding, ce | 99.48 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 99.48 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 99.46 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 99.45 | |
| 2ctm_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 99.42 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 99.42 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 99.41 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 99.39 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 99.38 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 99.37 | |
| 2ctk_A | 104 | Vigilin; K homology type I domain, RNA-binding, ce | 99.36 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 99.18 | |
| 2ctj_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 99.15 | |
| 1k1g_A | 131 | SF1-BO isoform; splicing, branch point sequence, p | 99.06 | |
| 3n89_A | 376 | Defective in GERM LINE development protein 3, ISO; | 99.05 | |
| 2ctf_A | 102 | Vigilin; K homology type I domain, RNA-binding, ce | 99.02 | |
| 2cpq_A | 91 | FragIle X mental retardation syndrome related prot | 98.89 | |
| 2yqr_A | 119 | KIAA0907 protein; structure genomics, KH domain, s | 98.81 | |
| 2bl5_A | 140 | MGC83862 protein, quaking protein; STAR proteins, | 98.78 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 98.61 | |
| 2e3u_A | 219 | PH-DIM2P, hypothetical protein PH1566; PRE-ribosom | 98.49 | |
| 2e3u_A | 219 | PH-DIM2P, hypothetical protein PH1566; PRE-ribosom | 98.36 | |
| 3n89_A | 376 | Defective in GERM LINE development protein 3, ISO; | 98.34 | |
| 1tua_A | 191 | Hypothetical protein APE0754; structural genomics, | 98.29 | |
| 3u1k_A | 630 | Polyribonucleotide nucleotidyltransferase 1, MITO; | 98.23 | |
| 3v69_A | 140 | Protein filia; RNA-binding, embryogenesis, KH doma | 98.21 | |
| 1tua_A | 191 | Hypothetical protein APE0754; structural genomics, | 98.12 | |
| 4aid_A | 726 | Polyribonucleotide nucleotidyltransferase; transfe | 97.73 | |
| 2cxc_A | 144 | NUSA; transcription termination, RNA binding prote | 96.59 | |
| 3cdi_A | 723 | Polynucleotide phosphorylase; mRNA turnover, RNAse | 96.47 | |
| 1e3p_A | 757 | Guanosine pentaphosphate synthetase; polyribonucle | 96.28 | |
| 2asb_A | 251 | Transcription elongation protein NUSA; protein-RNA | 95.63 | |
| 2cxc_A | 144 | NUSA; transcription termination, RNA binding prote | 95.54 | |
| 1hh2_P | 344 | NUSA, N utilization substance protein A; transcrip | 94.99 | |
| 1k0r_A | 366 | NUSA; two component arrangement, S1 domain, two K- | 94.69 | |
| 1wh9_A | 92 | 40S ribosomal protein S3; KH domain, structural ge | 92.91 | |
| 2pt7_G | 152 | HP1451, hypothetical protein; ATPase, protein-prot | 91.58 | |
| 3u5c_D | 240 | RP13, YS3, 40S ribosomal protein S3; translation, | 85.99 | |
| 3iev_A | 308 | GTP-binding protein ERA; ERA, GTPase, KH domain, a | 85.47 | |
| 3j20_C | 210 | 30S ribosomal protein S3P; archaea, archaeal, KINK | 85.13 | |
| 2asb_A | 251 | Transcription elongation protein NUSA; protein-RNA | 84.86 | |
| 3iz6_B | 227 | 40S ribosomal protein S3 (S3P); eukaryotic ribosom | 84.2 | |
| 2xzm_C | 243 | KH domain containing protein; ribosome, translatio | 83.73 | |
| 1k0r_A | 366 | NUSA; two component arrangement, S1 domain, two K- | 82.49 | |
| 3r8n_C | 206 | 30S ribosomal protein S3; protein biosynthesis, RN | 80.63 |
| >1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A | Back alignment and structure |
|---|
Probab=99.73 E-value=1.7e-18 Score=99.98 Aligned_cols=59 Identities=32% Similarity=0.559 Sum_probs=54.6
Q ss_pred eeEEEEEecCCceeeEEecCCchHHHHHHHhCCeEEEecCCCCCCCCceeEEEEeccCC
Q psy14680 13 VCQIKILVPSYAAGAIIGKGGETIAQIQKDTGSKIKMSKANDFYPVYQVITLFLLSRPG 71 (78)
Q Consensus 13 ~~~~~l~vP~~~vG~IIGk~G~~Ik~i~~~Tga~I~i~~~~~~~~g~~er~v~I~G~p~ 71 (78)
..++++.||.+++|+||||+|++|++|+++|||+|+|++++++.++..+|.|+|+|+|+
T Consensus 2 ~~~~~i~Ip~~~vg~IIGkgG~~Ik~I~~~tga~I~i~~~~~~~~~~~~~~v~I~G~~~ 60 (76)
T 1dtj_A 2 KELVEMAVPENLVGAILGKGGKTLVEYQELTGARIQISKKGEFLPGTRNRRVTITGSPA 60 (76)
T ss_dssp CEEEEEEEETTTHHHHHCSTTHHHHHHHHHHCCEEEECCTTCCSTTCCEEEEEEEESHH
T ss_pred ceEEEEEEChHHcceEECCCchHHHHHHHHhCCEEEECcCCCCCCCCceeEEEEEeCHH
Confidence 46789999999999999999999999999999999999877677889999999999864
|
| >1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A | Back alignment and structure |
|---|
| >1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A | Back alignment and structure |
|---|
| >2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* | Back alignment and structure |
|---|
| >1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A | Back alignment and structure |
|---|
| >2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A | Back alignment and structure |
|---|
| >2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A | Back alignment and structure |
|---|
| >2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B | Back alignment and structure |
|---|
| >2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B | Back alignment and structure |
|---|
| >3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} | Back alignment and structure |
|---|
| >3v69_A Protein filia; RNA-binding, embryogenesis, KH domain, RNA binding, P binding; 2.20A {Mus musculus} | Back alignment and structure |
|---|
| >1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A | Back alignment and structure |
|---|
| >2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A | Back alignment and structure |
|---|
| >3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A | Back alignment and structure |
|---|
| >1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A | Back alignment and structure |
|---|
| >2asb_A Transcription elongation protein NUSA; protein-RNA complex, transcription/RNA complex; 1.50A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 PDB: 2atw_A | Back alignment and structure |
|---|
| >2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A | Back alignment and structure |
|---|
| >1hh2_P NUSA, N utilization substance protein A; transcription regulation, termination; 2.1A {Thermotoga maritima} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 PDB: 1l2f_A | Back alignment and structure |
|---|
| >1k0r_A NUSA; two component arrangement, S1 domain, two K-homology domains., structural genomics, PSI, protein structure initiative; 1.70A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 | Back alignment and structure |
|---|
| >1wh9_A 40S ribosomal protein S3; KH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, ribosome; NMR {Homo sapiens} SCOP: d.52.3.1 | Back alignment and structure |
|---|
| >2pt7_G HP1451, hypothetical protein; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3u5c_D RP13, YS3, 40S ribosomal protein S3; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_B 3o30_C 3o2z_C 3u5g_D 1s1h_C 3jyv_C* | Back alignment and structure |
|---|
| >3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* | Back alignment and structure |
|---|
| >3j20_C 30S ribosomal protein S3P; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2asb_A Transcription elongation protein NUSA; protein-RNA complex, transcription/RNA complex; 1.50A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 PDB: 2atw_A | Back alignment and structure |
|---|
| >3iz6_B 40S ribosomal protein S3 (S3P); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} | Back alignment and structure |
|---|
| >2xzm_C KH domain containing protein; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_C | Back alignment and structure |
|---|
| >1k0r_A NUSA; two component arrangement, S1 domain, two K-homology domains., structural genomics, PSI, protein structure initiative; 1.70A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 78 | ||||
| d2axya1 | 71 | d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum | 5e-11 | |
| d1j4wa1 | 74 | d.51.1.1 (A:1-74) Far upstream binding element, FB | 2e-10 | |
| d1dtja_ | 74 | d.51.1.1 (A:) Neuro-oncological ventral antigen 2, | 2e-10 | |
| d1x4na1 | 79 | d.51.1.1 (A:8-86) Far upstream binding element, FB | 1e-09 | |
| d2ctea1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 5e-09 | |
| d2ctla1 | 84 | d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T | 8e-09 | |
| d1j4wa2 | 71 | d.51.1.1 (A:104-174) Far upstream binding element, | 1e-08 | |
| d1x4ma1 | 81 | d.51.1.1 (A:8-88) Far upstream binding element, FB | 1e-08 | |
| d1wvna1 | 70 | d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma | 2e-08 | |
| d2ctka1 | 91 | d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T | 2e-08 | |
| d1zzka1 | 75 | d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie | 4e-08 | |
| d1viga_ | 71 | d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId | 3e-07 | |
| d1we8a_ | 104 | d.51.1.1 (A:) Tudor and KH domain containing prote | 4e-07 | |
| d2ctma1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 7e-07 | |
| d1tuaa1 | 84 | d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae | 2e-06 | |
| d1e3ha4 | 54 | d.52.3.1 (A:579-632) Polynucleotide phosphorylase/ | 6e-06 | |
| d2ba0a3 | 84 | d.51.1.1 (A:136-219) Exosome complex RNA-binding p | 4e-05 | |
| d2ctja1 | 82 | d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [T | 1e-04 | |
| d2cpqa1 | 78 | d.51.1.1 (A:212-289) Fragile X mental retardation | 2e-04 | |
| d2je6i3 | 69 | d.51.1.1 (I:153-221) Exosome complex RNA-binding p | 2e-04 | |
| d2ctfa1 | 90 | d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [T | 4e-04 | |
| d1tuaa2 | 104 | d.51.1.1 (A:85-188) Hypothetical protein APE0754 { | 5e-04 | |
| d2z0sa2 | 87 | d.51.1.1 (A:148-234) Exosome complex RNA-binding p | 6e-04 | |
| d2bl5a1 | 134 | d.51.1.1 (A:1-134) Quaking protein A (Xqua) {Afric | 0.004 |
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Eukaryotic type KH-domain (KH-domain type I) superfamily: Eukaryotic type KH-domain (KH-domain type I) family: Eukaryotic type KH-domain (KH-domain type I) domain: Poly(RC)-binding protein 2 species: Human (Homo sapiens) [TaxId: 9606]
Score = 50.5 bits (121), Expect = 5e-11
Identities = 13/39 (33%), Positives = 29/39 (74%)
Query: 16 IKILVPSYAAGAIIGKGGETIAQIQKDTGSKIKMSKAND 54
I++L+ G+IIGK GE++ ++++++G++I +S+ N
Sbjct: 6 IRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNC 44
|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 | Back information, alignment and structure |
|---|
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 | Back information, alignment and structure |
|---|
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
| >d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84 | Back information, alignment and structure |
|---|
| >d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54 | Back information, alignment and structure |
|---|
| >d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 69 | Back information, alignment and structure |
|---|
| >d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 104 | Back information, alignment and structure |
|---|
| >d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 87 | Back information, alignment and structure |
|---|
| >d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 134 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 78 | |||
| d1dtja_ | 74 | Neuro-oncological ventral antigen 2, nova-2, KH3 { | 99.75 | |
| d1j4wa2 | 71 | Far upstream binding element, FBP {Human (Homo sap | 99.75 | |
| d1x4ma1 | 81 | Far upstream binding element, FBP {Mouse (Mus musc | 99.72 | |
| d1wvna1 | 70 | Poly(RC)-binding protein 1 {Human (Homo sapiens) [ | 99.7 | |
| d1zzka1 | 75 | HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} | 99.69 | |
| d1j4wa1 | 74 | Far upstream binding element, FBP {Human (Homo sap | 99.69 | |
| d2axya1 | 71 | Poly(RC)-binding protein 2 {Human (Homo sapiens) [ | 99.68 | |
| d1we8a_ | 104 | Tudor and KH domain containing protein, Tdrkh {Mou | 99.63 | |
| d1x4na1 | 79 | Far upstream binding element, FBP {Mouse (Mus musc | 99.62 | |
| d2ctla1 | 84 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.54 | |
| d1viga_ | 71 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.5 | |
| d2ctea1 | 81 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.5 | |
| d2ctma1 | 81 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.46 | |
| d2ctja1 | 82 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.4 | |
| d2ctka1 | 91 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.38 | |
| d2cpqa1 | 78 | Fragile X mental retardation syndrome related prot | 99.32 | |
| d1e3ha4 | 54 | Polynucleotide phosphorylase/guanosine pentaphosph | 99.26 | |
| d2ba0a3 | 84 | Exosome complex RNA-binding protein 1, ECR1 {Archa | 99.26 | |
| d1tuaa1 | 84 | Hypothetical protein APE0754 {Aeropyrum pernix [Ta | 99.17 | |
| d2ctfa1 | 90 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.14 | |
| d2je6i3 | 69 | Exosome complex RNA-binding protein 1, ECR1 {Sulfo | 99.1 | |
| d2z0sa2 | 87 | Exosome complex RNA-binding protein 1, ECR1 {Aerop | 98.96 | |
| d1k1ga_ | 122 | RNA splicing factor 1 {Human (Homo sapiens) [TaxId | 98.76 | |
| d2bl5a1 | 134 | Quaking protein A (Xqua) {African clawed frog (Xen | 98.66 | |
| d1tuaa2 | 104 | Hypothetical protein APE0754 {Aeropyrum pernix [Ta | 98.5 | |
| d2asba3 | 67 | Transcription factor NusA, C-terminal domains {Myc | 97.39 | |
| d1hh2p3 | 68 | Transcription factor NusA, C-terminal domains {The | 97.36 | |
| d1wh9a_ | 92 | Ribosomal protein S3 N-terminal domain {Mouse (Mus | 95.45 | |
| d1egaa2 | 113 | GTPase Era C-terminal domain {Escherichia coli [Ta | 94.42 | |
| d2uubc1 | 105 | Ribosomal protein S3 N-terminal domain {Thermus th | 94.11 | |
| d1wf3a2 | 118 | GTPase Era C-terminal domain {Thermus thermophilus | 93.06 | |
| d2qalc1 | 105 | Ribosomal protein S3 N-terminal domain {Escherichi | 90.43 | |
| d2asba2 | 79 | Transcription factor NusA, C-terminal domains {Myc | 90.11 | |
| d1hh2p2 | 78 | Transcription factor NusA, C-terminal domains {The | 88.66 | |
| d2ja9a2 | 85 | Ribosomal RNA-processing protein 40, RRP40 {Saccha | 84.45 |
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Eukaryotic type KH-domain (KH-domain type I) superfamily: Eukaryotic type KH-domain (KH-domain type I) family: Eukaryotic type KH-domain (KH-domain type I) domain: Neuro-oncological ventral antigen 2, nova-2, KH3 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.75 E-value=2.6e-19 Score=102.20 Aligned_cols=59 Identities=32% Similarity=0.555 Sum_probs=54.5
Q ss_pred eEEEEEecCCceeeEEecCCchHHHHHHHhCCeEEEecCCCCCCCCceeEEEEeccCCC
Q psy14680 14 CQIKILVPSYAAGAIIGKGGETIAQIQKDTGSKIKMSKANDFYPVYQVITLFLLSRPGF 72 (78)
Q Consensus 14 ~~~~l~vP~~~vG~IIGk~G~~Ik~i~~~Tga~I~i~~~~~~~~g~~er~v~I~G~p~~ 72 (78)
..+++.||.+++|.||||+|++|++|+++|||+|+|+++.+..++..+|.|+|+|++++
T Consensus 3 ~~i~i~VP~~~vg~iIGk~G~~Ik~I~~~sga~I~i~~~~~~~~~~~~r~v~I~G~~~~ 61 (74)
T d1dtja_ 3 ELVEMAVPENLVGAILGKGGKTLVEYQELTGARIQISKKGEFLPGTRNRRVTITGSPAA 61 (74)
T ss_dssp EEEEEEEETTTHHHHHCSTTHHHHHHHHHHCCEEEECCTTCCSTTCCEEEEEEEESHHH
T ss_pred EEEEEEeCHHHcceeECCCChhHHHHHHHcCCEEEEccCCCCCCCCCceEEEEEeCHHH
Confidence 46899999999999999999999999999999999998877778899999999998753
|
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} | Back information, alignment and structure |
|---|
| >d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2asba3 d.52.3.1 (A:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1wh9a_ d.52.3.1 (A:) Ribosomal protein S3 N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1egaa2 d.52.3.1 (A:183-295) GTPase Era C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2uubc1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1wf3a2 d.52.3.1 (A:181-298) GTPase Era C-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2qalc1 d.52.3.1 (C:1-105) Ribosomal protein S3 N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2asba2 d.52.3.1 (A:184-262) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1hh2p2 d.52.3.1 (P:199-276) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2ja9a2 d.51.1.1 (A:152-236) Ribosomal RNA-processing protein 40, RRP40 {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|