Psyllid ID: psy14728


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------32
MDVETVPNTDEVDNDNLVTLNVEAVENTHGNQMSLDNPDEESEAETTESKAEDEESKEVCIERLLLRWNLIKKIENIHMLTTLKELELYDNQLTVIENLDTLINLEILDLSFNRIREIKGLDHLANLEKLYLCSNKISKIENVDHLKKLKVLELGDNKIRIIENLDGLTNLEELYLGKNKISRIDNLASLTKLNILSLQCNRLRTIENLEALTNLTQLYLSENGLTTIENLLSNEKLETLDVAYNKISIIQNIAHLTELQEFWINDNQVSDWNTVNVLENNKQLQTIYLDRNPVAQDPNYRRKIKLVCPWIVQIDATLA
ccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccEEEcccccccccccccccccccEEEcccccccccccccccccccEEEcccccccccccccccccccEEEcccccccccccccccccccEEEcccccccccccccccccccEEEcccccccccccccccccccEEEcccccccccccccccccccEEEcccccccccccccccccccEEEcccccccccccccccccccEEEccccccccccccccccccccccEEEcccccccccHHHHHHHHHHcccccEEccccc
cccHcccccHHHHHHccHHcccccccHHHHccccccHHHHHcccccccccccHHHHHcccccEEEcccccccccHHHHHcccccEEEcccccccccHHHHHcccccEEEcccccccccHHHHHcccccEEEcccccccccHHHcccccccEEEcccccccccHHHcccccccEEEcccccccccHHHHHcccccEEEcccccccccHHHHHcccccEEEcccccccccHHHHHcccccEEEcccccccEcHHHcccccccEEEcccccccccHHHHHcccccEEcEEEEccccccccHHHHHHHHHHcccccEEccccc
mdvetvpntdevdndnlVTLNVEAVEnthgnqmsldnpdeeseaetteskaedeeSKEVCIERLLLRWNLIKKIENIHMLTTLKELELYDNQLTVIENLDTLINLEILDLSFNRIREIKGLDHLANLEKLYLcsnkiskienvdhlkklkvlelgdnKIRIIENLdgltnleelylgknkisrIDNLASLTKLNILSLQCNRLRTIENLEALTNLTQLYLSENGLTTIENLLSNEKLETLDVAYNKISIIQNIAHLTELQEfwindnqvsdwntVNVLENNKQLQTiyldrnpvaqdpnyrrkiklvCPWIVQIDATLA
mdvetvpntdevdndnlVTLNVEAVEnthgnqmsldnpdeESEAEtteskaedeeskeVCIERLLLRWNLIKKIENIHMLTTLKELELYDNQLTVIENLDTLINLEILDLSFNRIREIKGLDHLANLEKLYLCSNKiskienvdhlkklkvlelgdnKIRIIenldgltnleeLYLGKNKISRIDNLASLTKLNILSLQCNRLRTIENLEALTNLTQLYLSENGLTTIENLLSNEKLETLDVAYNKISIIQNIAHLTELQEFWINDNQVSDWNTVNVLENNKQlqtiyldrnpvaqdpnyrrkiklvcpWIVQIDATLA
MDVETVPNTDEVDNDNLVTLNVEAVENTHGNQMSLDNPdeeseaetteskaedeeskeVCIERLLLRWNLIKKIENIHMLTTLKELELYDNQLTVIENLDTLINLEILDLSFNRIREIKGLDHLANLEKLYLCSNKISKIENVDHLKKLKVLELGDNKIRIIENLDGLTNLEELYLGKNKISRIDNLASLTKLNILSLQCNRLRTIENLEALTNLTQLYLSENGLTTIENLLSNEKLETLDVAYNKISIIQNIAHLTELQEFWINDNQVSDWNTVNVLENNKQLQTIYLDRNPVAQDPNYRRKIKLVCPWIVQIDATLA
**********************************************************VCIERLLLRWNLIKKIENIHMLTTLKELELYDNQLTVIENLDTLINLEILDLSFNRIREIKGLDHLANLEKLYLCSNKISKIENVDHLKKLKVLELGDNKIRIIENLDGLTNLEELYLGKNKISRIDNLASLTKLNILSLQCNRLRTIENLEALTNLTQLYLSENGLTTIENLLSNEKLETLDVAYNKISIIQNIAHLTELQEFWINDNQVSDWNTVNVLENNKQLQTIYLDRNPVAQDPNYRRKIKLVCPWIVQIDA***
****TVP***************************LDNPDEESEAE********EESKEVCIERLLLRWNLIKKIENIHMLTTLKELELYDNQLTVIENLDTLINLEILDLSFNRIREIKGLDHLANLEKLYLCSNKISKIENVDHLKKLKVLELGDNKIRIIENLDGLTNLEELYLGKNKISRIDNLASLTKLNILSLQCNRLRTIENLEALTNLTQLYLSENGLTTIENLLSNEKLETLDVAYNKISIIQNIAHLTELQEFWINDNQVSDWNTVNVLENNKQLQTIYLDRNPVAQDPNYRRKIKLVCPWIVQIDATLA
*********DEVDNDNLVTLNVEAVENTHGN**************************EVCIERLLLRWNLIKKIENIHMLTTLKELELYDNQLTVIENLDTLINLEILDLSFNRIREIKGLDHLANLEKLYLCSNKISKIENVDHLKKLKVLELGDNKIRIIENLDGLTNLEELYLGKNKISRIDNLASLTKLNILSLQCNRLRTIENLEALTNLTQLYLSENGLTTIENLLSNEKLETLDVAYNKISIIQNIAHLTELQEFWINDNQVSDWNTVNVLENNKQLQTIYLDRNPVAQDPNYRRKIKLVCPWIVQIDATLA
MDVETVPNTDEVDNDNLVTLNVEAVENTHGNQMSLDNPDEESEAETTESKAEDEESKEVCIERLLLRWNLIKKIENIHMLTTLKELELYDNQLTVIENLDTLINLEILDLSFNRIREIKGLDHLANLEKLYLCSNKISKIENVDHLKKLKVLELGDNKIRIIENLDGLTNLEELYLGKNKISRIDNLASLTKLNILSLQCNRLRTIENLEALTNLTQLYLSENGLTTIENLLSNEKLETLDVAYNKISIIQNIAHLTELQEFWINDNQVSDWNTVNVLENNKQLQTIYLDRNPVAQDPNYRRKIKLVCPWIVQID****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDVETVPNTDEVDNDNLVTLNVEAVENTHGNQMSLDNPDEESEAETTESKAEDEESKEVCIERLLLRWNLIKKIENIHMLTTLKELELYDNQLTVIENLDTLINLEILDLSFNRIREIKGLDHLANLEKLYLCSNKISKIENVDHLKKLKVLELGDNKIRIIENLDGLTNLEELYLGKNKISRIDNLASLTKLNILSLQCNRLRTIENLEALTNLTQLYLSENGLTTIENLLSNEKLETLDVAYNKISIIQNIAHLTELQEFWINDNQVSDWNTVNVLENNKQLQTIYLDRNPVAQDPNYRRKIKLVCPWIVQIDATLA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query319 2.2.26 [Sep-21-2011]
Q3T0W4360 Protein phosphatase 1 reg yes N/A 0.811 0.719 0.555 2e-76
Q3UM45361 Protein phosphatase 1 reg yes N/A 0.805 0.711 0.556 3e-76
Q15435360 Protein phosphatase 1 reg yes N/A 0.811 0.719 0.559 5e-76
Q5HZV9360 Protein phosphatase 1 reg yes N/A 0.811 0.719 0.548 2e-75
Q5RFS7360 Protein phosphatase 1 reg yes N/A 0.811 0.719 0.552 4e-75
Q6DIQ3346 Protein phosphatase 1 reg yes N/A 0.811 0.748 0.555 3e-74
Q32PL1345 Protein phosphatase 1 reg yes N/A 0.793 0.733 0.545 5e-69
P45969326 Uncharacterized protein T yes N/A 0.924 0.904 0.465 8e-58
P22194332 Protein phosphatase 1 reg yes N/A 0.802 0.771 0.461 5e-52
Q54Q39336 Protein phosphatase 1 reg yes N/A 0.808 0.767 0.448 9e-49
>sp|Q3T0W4|PP1R7_BOVIN Protein phosphatase 1 regulatory subunit 7 OS=Bos taurus GN=PPP1R7 PE=1 SV=1 Back     alignment and function desciption
 Score =  285 bits (730), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 144/259 (55%), Positives = 196/259 (75%)

Query: 61  IERLLLRWNLIKKIENIHMLTTLKELELYDNQLTVIENLDTLINLEILDLSFNRIREIKG 120
           ++ L LR NLIK IEN+  L +L+EL+LYDNQ+  IENLD L  LE+LD+SFN +R I+G
Sbjct: 100 VKTLCLRQNLIKCIENLEGLQSLRELDLYDNQIRRIENLDALTELEVLDISFNLLRNIEG 159

Query: 121 LDHLANLEKLYLCSNKISKIENVDHLKKLKVLELGDNKIRIIENLDGLTNLEELYLGKNK 180
           +D L  L+KL+L +NKI+KIEN+  L +L++LELG N+IR IEN+D LTNLE L+LGKNK
Sbjct: 160 IDKLTRLKKLFLVNNKINKIENISSLHQLQMLELGSNRIRAIENIDTLTNLESLFLGKNK 219

Query: 181 ISRIDNLASLTKLNILSLQCNRLRTIENLEALTNLTQLYLSENGLTTIENLLSNEKLETL 240
           I+++ NL +LT L +LS+Q NRL  IE L++L NL +LYLS NG+  IE L +N KL  L
Sbjct: 220 ITKLQNLDALTNLTVLSMQSNRLTKIEGLQSLVNLRELYLSHNGIEVIEGLDNNNKLTML 279

Query: 241 DVAYNKISIIQNIAHLTELQEFWINDNQVSDWNTVNVLENNKQLQTIYLDRNPVAQDPNY 300
           D+A N+I  I+N++HLTELQEFW+NDN +  W+ ++ L+  + L+T+YL+RNP+ +DP Y
Sbjct: 280 DIASNRIKKIENVSHLTELQEFWMNDNLLDCWSDLDELKGARSLETVYLERNPLQRDPQY 339

Query: 301 RRKIKLVCPWIVQIDATLA 319
           RRKI L  P + QIDAT  
Sbjct: 340 RRKIMLALPSVRQIDATFV 358




Regulatory subunit of protein phosphatase 1. Inactivates the PPP1CC isoform 2 during epididymal sperm maturation.
Bos taurus (taxid: 9913)
>sp|Q3UM45|PP1R7_MOUSE Protein phosphatase 1 regulatory subunit 7 OS=Mus musculus GN=Ppp1r7 PE=1 SV=2 Back     alignment and function description
>sp|Q15435|PP1R7_HUMAN Protein phosphatase 1 regulatory subunit 7 OS=Homo sapiens GN=PPP1R7 PE=1 SV=1 Back     alignment and function description
>sp|Q5HZV9|PP1R7_RAT Protein phosphatase 1 regulatory subunit 7 OS=Rattus norvegicus GN=Ppp1r7 PE=1 SV=1 Back     alignment and function description
>sp|Q5RFS7|PP1R7_PONAB Protein phosphatase 1 regulatory subunit 7 OS=Pongo abelii GN=PPP1R7 PE=2 SV=1 Back     alignment and function description
>sp|Q6DIQ3|PP1R7_XENTR Protein phosphatase 1 regulatory subunit 7 OS=Xenopus tropicalis GN=ppp1r7 PE=2 SV=1 Back     alignment and function description
>sp|Q32PL1|PP1R7_DANRE Protein phosphatase 1 regulatory subunit 7 OS=Danio rerio GN=ppp1r7 PE=2 SV=1 Back     alignment and function description
>sp|P45969|YNZ9_CAEEL Uncharacterized protein T09A5.9 OS=Caenorhabditis elegans GN=T09A5.9 PE=4 SV=1 Back     alignment and function description
>sp|P22194|SDS22_SCHPO Protein phosphatase 1 regulatory subunit SDS22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sds22 PE=1 SV=2 Back     alignment and function description
>sp|Q54Q39|PP1R7_DICDI Protein phosphatase 1 regulatory subunit pprA OS=Dictyostelium discoideum GN=pprA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query319
158298793329 AGAP009839-PA [Anopheles gambiae str. PE 0.811 0.787 0.648 5e-88
270012286322 hypothetical protein TcasGA2_TC006409 [T 0.811 0.804 0.652 1e-87
91088689320 PREDICTED: similar to phosphatase 1 regu 0.811 0.809 0.652 1e-87
157115257332 protein phosphatases pp1 regulatory subu 0.818 0.786 0.639 2e-87
312383578329 hypothetical protein AND_03257 [Anophele 0.811 0.787 0.629 2e-85
240849085329 protein phosphatases pp1 regulatory subu 0.811 0.787 0.644 8e-85
156548260318 PREDICTED: protein phosphatase 1 regulat 0.811 0.814 0.640 1e-84
170049759321 phosphatase 1 regulatory subunit 7 [Cule 0.818 0.813 0.609 6e-83
307213325322 Protein phosphatase 1 regulatory subunit 0.940 0.931 0.575 1e-81
307168558327 Protein phosphatase 1 regulatory subunit 0.811 0.792 0.633 2e-81
>gi|158298793|ref|XP_318952.3| AGAP009839-PA [Anopheles gambiae str. PEST] gi|157014056|gb|EAA14303.4| AGAP009839-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
 Score =  330 bits (846), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 168/259 (64%), Positives = 208/259 (80%)

Query: 61  IERLLLRWNLIKKIENIHMLTTLKELELYDNQLTVIENLDTLINLEILDLSFNRIREIKG 120
           +ERL LRWNLIKKIEN+  LT+L ELELYDNQ+T +ENLD L+NLE+LD+SFNR+ +IK 
Sbjct: 70  LERLYLRWNLIKKIENLDHLTSLLELELYDNQITELENLDNLVNLEMLDVSFNRLHQIKN 129

Query: 121 LDHLANLEKLYLCSNKISKIENVDHLKKLKVLELGDNKIRIIENLDGLTNLEELYLGKNK 180
           L  L NL KL+LC+N+IS IEN+DH   L +LELGDNKIR IENLD L++L  LYLGKNK
Sbjct: 130 LSALTNLRKLFLCANRISLIENLDHFSSLTMLELGDNKIRKIENLDNLSSLTHLYLGKNK 189

Query: 181 ISRIDNLASLTKLNILSLQCNRLRTIENLEALTNLTQLYLSENGLTTIENLLSNEKLETL 240
           I++I+NL  L KL  LSLQCNRL  IENL+ L NLT+LYLSENG+ TIENL  N++LETL
Sbjct: 190 ITKIENLDKLVKLECLSLQCNRLTKIENLDQLVNLTELYLSENGIETIENLDQNKQLETL 249

Query: 241 DVAYNKISIIQNIAHLTELQEFWINDNQVSDWNTVNVLENNKQLQTIYLDRNPVAQDPNY 300
           D+A N++  I+NI HL  L+EFW+NDN VS+W  V+ L +NK+L T+YL+RNPVA D NY
Sbjct: 250 DLAKNRVKRIENIEHLEMLEEFWMNDNGVSEWTCVDKLASNKKLATVYLERNPVASDVNY 309

Query: 301 RRKIKLVCPWIVQIDATLA 319
           RRK+KL  PW+ +IDATL 
Sbjct: 310 RRKLKLAVPWLQKIDATLC 328




Source: Anopheles gambiae str. PEST

Species: Anopheles gambiae

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270012286|gb|EFA08734.1| hypothetical protein TcasGA2_TC006409 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91088689|ref|XP_974981.1| PREDICTED: similar to phosphatase 1 regulatory subunit 7 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|157115257|ref|XP_001658167.1| protein phosphatases pp1 regulatory subunit [Aedes aegypti] gi|108883490|gb|EAT47715.1| AAEL001166-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|312383578|gb|EFR28617.1| hypothetical protein AND_03257 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|240849085|ref|NP_001155729.1| protein phosphatases pp1 regulatory subunit-like [Acyrthosiphon pisum] gi|239792184|dbj|BAH72462.1| ACYPI007814 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|156548260|ref|XP_001599951.1| PREDICTED: protein phosphatase 1 regulatory subunit 7-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|170049759|ref|XP_001858337.1| phosphatase 1 regulatory subunit 7 [Culex quinquefasciatus] gi|167871497|gb|EDS34880.1| phosphatase 1 regulatory subunit 7 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|307213325|gb|EFN88777.1| Protein phosphatase 1 regulatory subunit 7 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|307168558|gb|EFN61616.1| Protein phosphatase 1 regulatory subunit 7 [Camponotus floridanus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query319
FB|FBgn0028992326 sds22 "sds22" [Drosophila mela 0.808 0.791 0.581 2.7e-75
MGI|MGI:1913635361 Ppp1r7 "protein phosphatase 1, 0.805 0.711 0.556 4.5e-75
UNIPROTKB|Q15435360 PPP1R7 "Protein phosphatase 1 0.805 0.713 0.564 7.3e-75
UNIPROTKB|Q3T0W4360 PPP1R7 "Protein phosphatase 1 0.805 0.713 0.560 1.2e-74
RGD|1308169360 Ppp1r7 "protein phosphatase 1, 0.805 0.713 0.552 4e-74
ZFIN|ZDB-GENE-051113-288345 ppp1r7 "protein phosphatase 1, 0.789 0.730 0.547 1.2e-72
WB|WBGene00011637326 T09A5.9 [Caenorhabditis elegan 0.805 0.788 0.5 1.3e-59
ASPGD|ASPL0000056701355 AN10088 [Emericella nidulans ( 0.805 0.723 0.471 5.9e-57
WB|WBGene00015516349 C06A8.6 [Caenorhabditis elegan 0.805 0.736 0.447 1.2e-56
POMBASE|SPAC4A8.12c332 sds22 "protein phosphatase reg 0.802 0.771 0.461 6.1e-55
FB|FBgn0028992 sds22 "sds22" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 759 (272.2 bits), Expect = 2.7e-75, P = 2.7e-75
 Identities = 150/258 (58%), Positives = 195/258 (75%)

Query:    61 IERLLLRWNLIKKIENIHMLTTLKELELYDNQLTVIENLDTLINLEILDLSFNRIREIKG 120
             IERL LRWNLIKKIEN+  L TL ELELYDNQ+T IENLD L +LE+LD+SFNR+ +I+ 
Sbjct:    63 IERLFLRWNLIKKIENLSSLKTLIELELYDNQITKIENLDDLPHLEVLDISFNRLTKIEN 122

Query:   121 LDHLANLEKLYLCSNKISKIENVDHLKKLKVLELGDNKIRIIENLDGLTNLEELYLGKNK 180
             LD L  LEK+Y  SN+I++IEN+D L  L +LELGDNK++ IEN++ L NL +L+LGKNK
Sbjct:   123 LDKLVKLEKVYFVSNRITQIENLDMLTNLTMLELGDNKLKKIENIEMLVNLRQLFLGKNK 182

Query:   181 ISRIDNLASLTKLNILSLQCNRLRTIENLEALTNLTQLYLSENGLTTIENLLSNEKLETL 240
             I++I+NL +L  L ILSLQ NR+  IE LE L NL +LY+SENG+ TIENL  N KLETL
Sbjct:   183 IAKIENLDTLVNLEILSLQANRIVKIETLEKLANLRELYVSENGVETIENLSENTKLETL 242

Query:   241 DVAYNKISIIQNIAHLTELQEFWINDNQVSDWNTVNVLENNKQLQTIYLDRNPVAQDPNY 300
             D+A N++  I N+  L  L+E W+N N V DW  + +L+ NK LQTIYL+ NP+A+D  Y
Sbjct:   243 DLAKNRLKGIANLEKLELLEELWLNHNGVDDWKDIELLKVNKALQTIYLEYNPLAKDVRY 302

Query:   301 RRKIKLVCPWIVQIDATL 318
             R K++ + P + +IDATL
Sbjct:   303 RSKLRDILPQLQKIDATL 320


GO:0008599 "protein phosphatase type 1 regulator activity" evidence=ISS
GO:0016336 "establishment or maintenance of polarity of larval imaginal disc epithelium" evidence=IMP
GO:0016334 "establishment or maintenance of polarity of follicular epithelium" evidence=IMP
GO:0008285 "negative regulation of cell proliferation" evidence=IGI
GO:0000164 "protein phosphatase type 1 complex" evidence=IDA
MGI|MGI:1913635 Ppp1r7 "protein phosphatase 1, regulatory (inhibitor) subunit 7" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q15435 PPP1R7 "Protein phosphatase 1 regulatory subunit 7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T0W4 PPP1R7 "Protein phosphatase 1 regulatory subunit 7" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1308169 Ppp1r7 "protein phosphatase 1, regulatory subunit 7" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-051113-288 ppp1r7 "protein phosphatase 1, regulatory (inhibitor) subunit 7" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
WB|WBGene00011637 T09A5.9 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ASPGD|ASPL0000056701 AN10088 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
WB|WBGene00015516 C06A8.6 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
POMBASE|SPAC4A8.12c sds22 "protein phosphatase regulatory subunit Sds22" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P22194SDS22_SCHPONo assigned EC number0.46180.80250.7710yesN/A
Q6DIQ3PP1R7_XENTRNo assigned EC number0.55590.81190.7485yesN/A
Q3UM45PP1R7_MOUSENo assigned EC number0.55640.80560.7119yesN/A
Q15435PP1R7_HUMANNo assigned EC number0.55980.81190.7194yesN/A
Q5RFS7PP1R7_PONABNo assigned EC number0.55210.81190.7194yesN/A
P45969YNZ9_CAEELNo assigned EC number0.46510.92470.9049yesN/A
Q5HZV9PP1R7_RATNo assigned EC number0.54820.81190.7194yesN/A
P36047SDS22_YEASTNo assigned EC number0.47010.80250.7573yesN/A
Q3T0W4PP1R7_BOVINNo assigned EC number0.55590.81190.7194yesN/A
Q32PL1PP1R7_DANRENo assigned EC number0.54540.79310.7333yesN/A
Q54Q39PP1R7_DICDINo assigned EC number0.44860.80870.7678yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query319
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-10
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-10
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-08
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-05
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 3e-05
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 4e-05
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 6e-05
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 8e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-04
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 1e-04
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 1e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-04
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 8e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.002
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.004
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
 Score = 61.9 bits (150), Expect = 1e-10
 Identities = 75/224 (33%), Positives = 109/224 (48%), Gaps = 8/224 (3%)

Query: 72  KKIENIHMLTTLKELELYDNQLTV-IENLDTLINLEILDLSFNRIREIKGLDHL--ANLE 128
              EN+  L  L  L+L  N+L   I  L  L NL  LDL  N I +I  L  L  +NL+
Sbjct: 84  DGSENLLNLLPLPSLDLNLNRLRSNISELLELTNLTSLDLDNNNITDIPPLIGLLKSNLK 143

Query: 129 KLYLCSNKISKI-ENVDHLKKLKVLELGDNKIRIIENLDG-LTNLEELYLGKNKISRIDN 186
           +L L  NKI  +   + +L  LK L+L  N +  +  L   L+NL  L L  NKIS +  
Sbjct: 144 ELDLSDNKIESLPSPLRNLPNLKNLDLSFNDLSDLPKLLSNLSNLNNLDLSGNKISDLPP 203

Query: 187 LAS-LTKLNILSLQCNR-LRTIENLEALTNLTQLYLSENGLTTIENLLSNEK-LETLDVA 243
               L+ L  L L  N  +  + +L  L NL+ L LS N L  +   + N   LETLD++
Sbjct: 204 EIELLSALEELDLSNNSIIELLSSLSNLKNLSGLELSNNKLEDLPESIGNLSNLETLDLS 263

Query: 244 YNKISIIQNIAHLTELQEFWINDNQVSDWNTVNVLENNKQLQTI 287
            N+IS I ++  LT L+E  ++ N +S+   +  L        +
Sbjct: 264 NNQISSISSLGSLTNLRELDLSGNSLSNALPLIALLLLLLELLL 307


Length = 394

>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query319
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 1e-26
2omu_A 462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 5e-08
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 3e-26
2omt_A 462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 5e-08
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 5e-26
2omx_A 462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 9e-08
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 1e-25
2omv_A 461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 2e-06
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 2e-25
2omz_A 466 Crystal Structure Of Inla Y369a/hec1 Complex Length 1e-06
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 2e-25
1o6s_A 466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 1e-06
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 3e-25
2omy_A 461 Crystal Structure Of Inla S192n/hec1 Complex Length 2e-06
4fmz_A347 Crystal Structure Of An Internalin (Inlf) From List 1e-19
4fmz_A 347 Crystal Structure Of An Internalin (Inlf) From List 3e-04
4aw4_A311 Engineered Variant Of Listeria Monocytogenes Inlb I 2e-16
4aw4_A311 Engineered Variant Of Listeria Monocytogenes Inlb I 3e-13
4fho_A231 Crystal Structure Of An Internalin C2 (Inlc2) From 9e-16
4fho_A231 Crystal Structure Of An Internalin C2 (Inlc2) From 7e-09
1h6u_A308 Internalin H: Crystal Structure Of Fused N-Terminal 2e-15
1h6u_A308 Internalin H: Crystal Structure Of Fused N-Terminal 3e-14
1h6u_A 308 Internalin H: Crystal Structure Of Fused N-Terminal 6e-04
2y5q_A362 Listeria Monocytogenes Inlb (Internalin B) Residues 1e-13
2y5q_A362 Listeria Monocytogenes Inlb (Internalin B) Residues 4e-13
2y5q_A 362 Listeria Monocytogenes Inlb (Internalin B) Residues 1e-07
1h6t_A291 Internalin B: Crystal Structure Of Fused N-Terminal 2e-13
1h6t_A291 Internalin B: Crystal Structure Of Fused N-Terminal 5e-13
1h6t_A291 Internalin B: Crystal Structure Of Fused N-Terminal 2e-07
1m9s_A 605 Crystal Structure Of Internalin B (Inlb), A Listeri 2e-13
1m9s_A 605 Crystal Structure Of Internalin B (Inlb), A Listeri 6e-13
1m9s_A 605 Crystal Structure Of Internalin B (Inlb), A Listeri 9e-07
2uzx_A289 Structure Of The Human Receptor Tyrosine Kinase Met 2e-13
2uzx_A289 Structure Of The Human Receptor Tyrosine Kinase Met 5e-13
2uzx_A289 Structure Of The Human Receptor Tyrosine Kinase Met 1e-07
2wqx_A289 Inlb321_4r: S199r, D200r, G206r, A227r, C242a Mutan 2e-13
2wqx_A289 Inlb321_4r: S199r, D200r, G206r, A227r, C242a Mutan 3e-06
1otn_A236 Calcium-Binding Mutant Of The Internalin B Lrr Doma 3e-13
1otn_A236 Calcium-Binding Mutant Of The Internalin B Lrr Doma 6e-13
1oto_A236 Calcium-Binding Mutant Of The Internalin B Lrr Doma 3e-13
1oto_A236 Calcium-Binding Mutant Of The Internalin B Lrr Doma 6e-13
1oto_A236 Calcium-Binding Mutant Of The Internalin B Lrr Doma 6e-07
1otm_A236 Calcium-Binding Mutant Of The Internalin B Lrr Doma 3e-13
1otm_A236 Calcium-Binding Mutant Of The Internalin B Lrr Doma 6e-13
1otm_A236 Calcium-Binding Mutant Of The Internalin B Lrr Doma 6e-07
1d0b_A213 Internalin B Leucine Rich Repeat Domain Length = 21 3e-13
1d0b_A213 Internalin B Leucine Rich Repeat Domain Length = 21 6e-13
1d0b_A213 Internalin B Leucine Rich Repeat Domain Length = 21 7e-07
2wqw_A286 Double-Disulfide Cross-Linked Crystal Dimer Of The 7e-13
2wqw_A286 Double-Disulfide Cross-Linked Crystal Dimer Of The 1e-07
1xeu_A263 Crystal Structure Of Internalin C From Listeria Mon 5e-10
1xeu_A263 Crystal Structure Of Internalin C From Listeria Mon 2e-07
1xeu_A263 Crystal Structure Of Internalin C From Listeria Mon 4e-07
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 1e-09
3zyo_A 411 Crystal Structure Of The N-Terminal Leucine Rich Re 5e-09
3zyn_A321 Crystal Structure Of The N-Terminal Leucine Rich Re 6e-09
3zyj_A 440 Netring1 In Complex With Ngl1 Length = 440 8e-09
1m9l_A199 Relaxation-Based Refined Structure Of Chlamydomonas 4e-07
3zyi_A452 Netring2 In Complex With Ngl2 Length = 452 5e-07
3zyi_A 452 Netring2 In Complex With Ngl2 Length = 452 2e-05
1ds9_A198 Solution Structure Of Chlamydomonas Outer Arm Dynei 5e-07
2id5_A 477 Crystal Structure Of The Lingo-1 Ectodomain Length 9e-07
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 2e-06
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 3e-04
2ft3_A332 Crystal Structure Of The Biglycan Dimer Core Protei 2e-06
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 4e-06
1xku_A330 Crystal Structure Of The Dimeric Protein Core Of De 5e-06
1xcd_A329 Dimeric Bovine Tissue-Extracted Decorin, Crystal Fo 6e-06
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 9e-06
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 9e-06
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 4e-05
3ul7_A278 Crystal Structure Of The Tv3 Mutant F63w Length = 2 1e-04
3ula_A279 Crystal Structure Of The Tv3 Mutant F63w-Md-2-Erito 2e-04
3v47_A455 Crystal Structure Of The N-Tetminal Fragment Of Zeb 4e-04
3j0a_A 844 Homology Model Of Human Toll-Like Receptor 5 Fitted 5e-04
2o6r_A177 Structural Diversity Of The Hagfish Variable Lympho 6e-04
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure

Iteration: 1

Score = 117 bits (292), Expect = 1e-26, Method: Compositional matrix adjust. Identities = 84/220 (38%), Positives = 124/220 (56%) Query: 61 IERLLLRWNLIKKIENIHMLTTLKELELYDNQLTVIENLDTLINLEILDLSFNRIREIKG 120 + RL L N I I + LT+L++L NQ+T ++ L L LE LD+S N++ +I Sbjct: 131 LNRLELSSNTISDISALSGLTSLQQLSFSSNQVTDLKPLANLTTLERLDISSNKVSDISV 190 Query: 121 LDHLANLEKLYLCSNKISKIENVDHLKKLKVLELGDNKIRIIENLDGLTNLEELYLGKNK 180 L L NLE L +N+IS I + L L L L N+++ I L LTNL +L L N+ Sbjct: 191 LAKLTNLESLIATNNQISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQ 250 Query: 181 ISRIDNLASLTKLNILSLQCNRLRTIENLEALTNLTQLYLSENGLTTIENLLSNEKLETL 240 IS + L+ LTKL L L N++ I L LT LT L L+EN L I + + + L L Sbjct: 251 ISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYL 310 Query: 241 DVAYNKISIIQNIAHLTELQEFWINDNQVSDWNTVNVLEN 280 + +N IS I ++ LT+LQ + ++N+VSD +++ L N Sbjct: 311 TLYFNNISDISPVSSLTKLQRLFFSNNKVSDVSSLANLTN 350
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|4FMZ|A Chain A, Crystal Structure Of An Internalin (Inlf) From Listeria Monocytogenes Str. 4b F2365 At 1.91 A Resolution Length = 347 Back     alignment and structure
>pdb|4FMZ|A Chain A, Crystal Structure Of An Internalin (Inlf) From Listeria Monocytogenes Str. 4b F2365 At 1.91 A Resolution Length = 347 Back     alignment and structure
>pdb|4AW4|A Chain A, Engineered Variant Of Listeria Monocytogenes Inlb Internalin Domain With An Additional Leucine Rich Repeat Inserted Length = 311 Back     alignment and structure
>pdb|4AW4|A Chain A, Engineered Variant Of Listeria Monocytogenes Inlb Internalin Domain With An Additional Leucine Rich Repeat Inserted Length = 311 Back     alignment and structure
>pdb|4FHO|A Chain A, Crystal Structure Of An Internalin C2 (Inlc2) From Listeria Monocytogenes Str. 4b F2365 At 1.90 A Resolution Length = 231 Back     alignment and structure
>pdb|4FHO|A Chain A, Crystal Structure Of An Internalin C2 (Inlc2) From Listeria Monocytogenes Str. 4b F2365 At 1.90 A Resolution Length = 231 Back     alignment and structure
>pdb|1H6U|A Chain A, Internalin H: Crystal Structure Of Fused N-Terminal Domains Length = 308 Back     alignment and structure
>pdb|1H6U|A Chain A, Internalin H: Crystal Structure Of Fused N-Terminal Domains Length = 308 Back     alignment and structure
>pdb|1H6U|A Chain A, Internalin H: Crystal Structure Of Fused N-Terminal Domains Length = 308 Back     alignment and structure
>pdb|2Y5Q|A Chain A, Listeria Monocytogenes Inlb (Internalin B) Residues 36-392 Length = 362 Back     alignment and structure
>pdb|2Y5Q|A Chain A, Listeria Monocytogenes Inlb (Internalin B) Residues 36-392 Length = 362 Back     alignment and structure
>pdb|2Y5Q|A Chain A, Listeria Monocytogenes Inlb (Internalin B) Residues 36-392 Length = 362 Back     alignment and structure
>pdb|1H6T|A Chain A, Internalin B: Crystal Structure Of Fused N-Terminal Domains Length = 291 Back     alignment and structure
>pdb|1H6T|A Chain A, Internalin B: Crystal Structure Of Fused N-Terminal Domains Length = 291 Back     alignment and structure
>pdb|1H6T|A Chain A, Internalin B: Crystal Structure Of Fused N-Terminal Domains Length = 291 Back     alignment and structure
>pdb|1M9S|A Chain A, Crystal Structure Of Internalin B (Inlb), A Listeria Monocytogenes Virulence Protein Containing Sh3-Like Domains Length = 605 Back     alignment and structure
>pdb|1M9S|A Chain A, Crystal Structure Of Internalin B (Inlb), A Listeria Monocytogenes Virulence Protein Containing Sh3-Like Domains Length = 605 Back     alignment and structure
>pdb|1M9S|A Chain A, Crystal Structure Of Internalin B (Inlb), A Listeria Monocytogenes Virulence Protein Containing Sh3-Like Domains Length = 605 Back     alignment and structure
>pdb|2UZX|A Chain A, Structure Of The Human Receptor Tyrosine Kinase Met In Complex With The Listeria Monocytogenes Invasion Protein Inlb: Crystal Form I Length = 289 Back     alignment and structure
>pdb|2UZX|A Chain A, Structure Of The Human Receptor Tyrosine Kinase Met In Complex With The Listeria Monocytogenes Invasion Protein Inlb: Crystal Form I Length = 289 Back     alignment and structure
>pdb|2UZX|A Chain A, Structure Of The Human Receptor Tyrosine Kinase Met In Complex With The Listeria Monocytogenes Invasion Protein Inlb: Crystal Form I Length = 289 Back     alignment and structure
>pdb|2WQX|A Chain A, Inlb321_4r: S199r, D200r, G206r, A227r, C242a Mutant Of The Listeria Monocytogenes Inlb Internalin Domain Length = 289 Back     alignment and structure
>pdb|2WQX|A Chain A, Inlb321_4r: S199r, D200r, G206r, A227r, C242a Mutant Of The Listeria Monocytogenes Inlb Internalin Domain Length = 289 Back     alignment and structure
>pdb|1OTN|A Chain A, Calcium-Binding Mutant Of The Internalin B Lrr Domain Length = 236 Back     alignment and structure
>pdb|1OTN|A Chain A, Calcium-Binding Mutant Of The Internalin B Lrr Domain Length = 236 Back     alignment and structure
>pdb|1OTO|A Chain A, Calcium-Binding Mutant Of The Internalin B Lrr Domain Length = 236 Back     alignment and structure
>pdb|1OTO|A Chain A, Calcium-Binding Mutant Of The Internalin B Lrr Domain Length = 236 Back     alignment and structure
>pdb|1OTO|A Chain A, Calcium-Binding Mutant Of The Internalin B Lrr Domain Length = 236 Back     alignment and structure
>pdb|1OTM|A Chain A, Calcium-Binding Mutant Of The Internalin B Lrr Domain Length = 236 Back     alignment and structure
>pdb|1OTM|A Chain A, Calcium-Binding Mutant Of The Internalin B Lrr Domain Length = 236 Back     alignment and structure
>pdb|1OTM|A Chain A, Calcium-Binding Mutant Of The Internalin B Lrr Domain Length = 236 Back     alignment and structure
>pdb|1D0B|A Chain A, Internalin B Leucine Rich Repeat Domain Length = 213 Back     alignment and structure
>pdb|1D0B|A Chain A, Internalin B Leucine Rich Repeat Domain Length = 213 Back     alignment and structure
>pdb|1D0B|A Chain A, Internalin B Leucine Rich Repeat Domain Length = 213 Back     alignment and structure
>pdb|2WQW|A Chain A, Double-Disulfide Cross-Linked Crystal Dimer Of The Listeria Monocytogenes Inlb Internalin Domain Length = 286 Back     alignment and structure
>pdb|2WQW|A Chain A, Double-Disulfide Cross-Linked Crystal Dimer Of The Listeria Monocytogenes Inlb Internalin Domain Length = 286 Back     alignment and structure
>pdb|1XEU|A Chain A, Crystal Structure Of Internalin C From Listeria Monocytogenes Length = 263 Back     alignment and structure
>pdb|1XEU|A Chain A, Crystal Structure Of Internalin C From Listeria Monocytogenes Length = 263 Back     alignment and structure
>pdb|1XEU|A Chain A, Crystal Structure Of Internalin C From Listeria Monocytogenes Length = 263 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|3ZYO|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats And Immunoglobulin Domain Of Netrin-G Ligand-3 Length = 411 Back     alignment and structure
>pdb|3ZYN|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats Of Netrin-G Ligand-3 Length = 321 Back     alignment and structure
>pdb|3ZYJ|A Chain A, Netring1 In Complex With Ngl1 Length = 440 Back     alignment and structure
>pdb|1M9L|A Chain A, Relaxation-Based Refined Structure Of Chlamydomonas Outer Arm Dynein Light Chain 1 Length = 199 Back     alignment and structure
>pdb|3ZYI|A Chain A, Netring2 In Complex With Ngl2 Length = 452 Back     alignment and structure
>pdb|3ZYI|A Chain A, Netring2 In Complex With Ngl2 Length = 452 Back     alignment and structure
>pdb|1DS9|A Chain A, Solution Structure Of Chlamydomonas Outer Arm Dynein Light Chain 1 Length = 198 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|2FT3|A Chain A, Crystal Structure Of The Biglycan Dimer Core Protein Length = 332 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|1XKU|A Chain A, Crystal Structure Of The Dimeric Protein Core Of Decorin, The Archetypal Small Leucine-Rich Repeat Proteoglycan Length = 330 Back     alignment and structure
>pdb|1XCD|A Chain A, Dimeric Bovine Tissue-Extracted Decorin, Crystal Form 1 Length = 329 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|3UL7|A Chain A, Crystal Structure Of The Tv3 Mutant F63w Length = 278 Back     alignment and structure
>pdb|3ULA|A Chain A, Crystal Structure Of The Tv3 Mutant F63w-Md-2-Eritoran Complex Length = 279 Back     alignment and structure
>pdb|3V47|A Chain A, Crystal Structure Of The N-Tetminal Fragment Of Zebrafish Tlr5 In Complex With Salmonella Flagellin Length = 455 Back     alignment and structure
>pdb|3J0A|A Chain A, Homology Model Of Human Toll-Like Receptor 5 Fitted Into An Electron Microscopy Single Particle Reconstruction Length = 844 Back     alignment and structure
>pdb|2O6R|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B61 Length = 177 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query319
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-68
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-54
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-52
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-52
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-46
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-45
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 4e-26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-24
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-59
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-54
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-52
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-56
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-54
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-52
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-46
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-41
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 5e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-55
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-54
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-52
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-53
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-52
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-51
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-48
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-29
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-15
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-48
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-45
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-42
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-40
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-42
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-39
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-37
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-35
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-30
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-41
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-40
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 5e-31
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-40
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 9e-40
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-39
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-39
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-39
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-29
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-22
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-38
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-37
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-34
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-18
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-37
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-30
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-37
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-22
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-37
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-33
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-19
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-36
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-29
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-20
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-36
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-34
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-33
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-22
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-20
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-35
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-35
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-34
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-35
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-35
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-31
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-30
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 1e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-34
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-34
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-33
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-17
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-33
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-31
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 5e-28
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-33
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-29
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-27
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-26
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-23
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-20
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-19
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-16
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-32
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-32
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-24
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-23
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-22
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-13
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-09
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-32
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-30
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-29
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 4e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-31
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-28
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-28
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-24
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-20
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-18
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-31
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-31
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-29
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-26
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-24
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-22
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-17
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-31
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-31
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-30
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-29
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-29
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-28
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-27
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-27
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-26
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-31
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-26
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-25
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-25
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-22
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-16
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-15
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-30
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-24
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-23
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-21
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-11
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-29
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-24
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-23
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-15
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 9e-15
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-28
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-25
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-25
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-23
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-21
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-19
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-14
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-13
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-28
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-28
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-26
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-19
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-28
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-26
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-26
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-25
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-22
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-28
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-25
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-23
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-17
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-28
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-27
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-23
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-22
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-22
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-13
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-27
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-25
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-22
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-20
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-19
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-16
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-13
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-13
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 7e-27
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-26
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-25
3rfs_A 272 Internalin B, repeat modules, variable lymphocyte 2e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 9e-27
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-25
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-19
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-19
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-26
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-24
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-22
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-22
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-21
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-26
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-24
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-22
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-26
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-24
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-23
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-20
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-14
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-25
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-23
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-22
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-19
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-17
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-17
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-16
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-25
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-23
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-21
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-20
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-24
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-23
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-21
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-20
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-24
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-17
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-15
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-24
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-21
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-19
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-17
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-14
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-12
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-23
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-19
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-13
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-23
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-16
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-15
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-17
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-21
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-21
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-19
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-21
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-15
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-14
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-21
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-18
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-15
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-20
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-19
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-19
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-19
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 9e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-18
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-15
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-09
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-14
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-16
1w8a_A192 SLIT protein; signaling protein, secreted protein, 9e-16
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-12
1w8a_A192 SLIT protein; signaling protein, secreted protein, 8e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-15
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-11
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-10
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 6e-15
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-11
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-15
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-10
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 7e-14
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-12
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-11
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-13
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-12
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 9e-12
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 9e-11
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-09
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-09
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 5e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 5e-11
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-09
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-09
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 8e-10
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 4e-09
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 7e-07
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-06
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 9e-09
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 6e-08
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-06
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 7e-06
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 1e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 1e-08
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-07
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 1e-06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 7e-05
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 5e-08
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 6e-07
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 6e-06
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-07
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 9e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 4e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 9e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-04
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
 Score =  214 bits (548), Expect = 8e-68
 Identities = 65/235 (27%), Positives = 122/235 (51%), Gaps = 2/235 (0%)

Query: 61  IERLLLRWNLIKKIENIHMLTTLKELELYDNQLTVIENLDTLINLEILDLSFNR-IREIK 119
           +  L +  N I  I  +  LT L+EL L ++ ++ I  L  L  +  L+L  N  + ++ 
Sbjct: 90  LTNLYIGTNKITDISALQNLTNLRELYLNEDNISDISPLANLTKMYSLNLGANHNLSDLS 149

Query: 120 GLDHLANLEKLYLCSNKISKIENVDHLKKLKVLELGDNKIRIIENLDGLTNLEELYLGKN 179
            L ++  L  L +  +K+  +  + +L  L  L L  N+I  I  L  LT+L       N
Sbjct: 150 PLSNMTGLNYLTVTESKVKDVTPIANLTDLYSLSLNYNQIEDISPLASLTSLHYFTAYVN 209

Query: 180 KISRIDNLASLTKLNILSLQCNRLRTIENLEALTNLTQLYLSENGLTTIENLLSNEKLET 239
           +I+ I  +A++T+LN L +  N++  +  L  L+ LT L +  N ++ I  +    KL+ 
Sbjct: 210 QITDITPVANMTRLNSLKIGNNKITDLSPLANLSQLTWLEIGTNQISDINAVKDLTKLKM 269

Query: 240 LDVAYNKISIIQNIAHLTELQEFWINDNQVSDWNTVNVLENNKQLQTIYLDRNPV 294
           L+V  N+IS I  + +L++L   ++N+NQ+ + + + V+     L T++L +N +
Sbjct: 270 LNVGSNQISDISVLNNLSQLNSLFLNNNQLGNED-MEVIGGLTNLTTLFLSQNHI 323


>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query319
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A 466 Internalin A; bacterial infection, extracellular r 100.0
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.97
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.96
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.96
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.96
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.96
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.96
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.96
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.96
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.96
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.96
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.96
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.96
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.96
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.96
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.95
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.95
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.95
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.95
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.95
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.95
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.95
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.95
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.95
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.95
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.95
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.95
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.95
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.95
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.95
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.94
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.94
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.94
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.94
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.94
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.94
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.93
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.92
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.92
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.92
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.91
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.91
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.91
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.91
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.91
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.9
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.89
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.89
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.89
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.89
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.88
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.88
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.88
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.87
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.87
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.87
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.87
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.86
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.86
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.85
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.85
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.84
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.84
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.84
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.83
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.82
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.81
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.81
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.81
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.81
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.8
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.8
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.78
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.77
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.77
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.77
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.76
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.76
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.75
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.74
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.73
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.72
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.72
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.71
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.7
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.7
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.7
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.69
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.69
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.68
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.67
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.65
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.63
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.62
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.61
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.6
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.6
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.57
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.56
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.56
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.56
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.55
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.54
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.53
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.52
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.5
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.43
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.41
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.4
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.4
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.38
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.34
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.33
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.33
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.32
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.27
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.17
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.15
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.11
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.11
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.1
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.05
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.02
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.0
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.93
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.88
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.75
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.67
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.59
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.57
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.55
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.54
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.53
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.44
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.21
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.2
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.67
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.35
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.86
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.27
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
Probab=100.00  E-value=3.5e-34  Score=251.79  Aligned_cols=295  Identities=25%  Similarity=0.332  Sum_probs=224.1

Q ss_pred             CceEEEEEeeeccc----cccccccCCCCcchhhhhccCchhhcccccccceEEEecCCcccCccccccCCCCCEEEccC
Q psy14728         15 DNLVTLNVEAVENT----HGNQMSLDNPDEESEAETTESKAEDEESKEVCIERLLLRWNLIKKIENIHMLTTLKELELYD   90 (319)
Q Consensus        15 ~~l~~l~~~~~~~~----~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~l~~~~~~~~L~~L~l~~   90 (319)
                      ++++.++++.....    ......++.++++.+......    .+..+++|++|++++|.+..++.+..+++|++|++++
T Consensus        44 ~~L~~L~l~~~~i~~~~~~~~~~~L~~L~l~~n~i~~~~----~~~~l~~L~~L~L~~n~i~~~~~~~~l~~L~~L~l~~  119 (347)
T 4fmz_A           44 ESITKLVVAGEKVASIQGIEYLTNLEYLNLNGNQITDIS----PLSNLVKLTNLYIGTNKITDISALQNLTNLRELYLNE  119 (347)
T ss_dssp             TTCSEEECCSSCCCCCTTGGGCTTCCEEECCSSCCCCCG----GGTTCTTCCEEECCSSCCCCCGGGTTCTTCSEEECTT
T ss_pred             ccccEEEEeCCccccchhhhhcCCccEEEccCCccccch----hhhcCCcCCEEEccCCcccCchHHcCCCcCCEEECcC
Confidence            34455555443322    222334555666555443321    1667777777777777777776677777777777777


Q ss_pred             CCccCccCCCCCCCCcEEEccCC-CCccccCCCCCCCccEEEccCCcccccCCCCCCCCccEEEccCCcCcCccccCCCC
Q psy14728         91 NQLTVIENLDTLINLEILDLSFN-RIREIKGLDHLANLEKLYLCSNKISKIENVDHLKKLKVLELGDNKIRIIENLDGLT  169 (319)
Q Consensus        91 ~~~~~~~~~~~l~~L~~L~l~~~-~~~~l~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~l~~~~  169 (319)
                      |.++.++.+..+++|++|++++| ....++.+..+++|++|++++|.+...+.+..+++|++|++++|.+..++.+..++
T Consensus       120 n~i~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~l~  199 (347)
T 4fmz_A          120 DNISDISPLANLTKMYSLNLGANHNLSDLSPLSNMTGLNYLTVTESKVKDVTPIANLTDLYSLSLNYNQIEDISPLASLT  199 (347)
T ss_dssp             SCCCCCGGGTTCTTCCEEECTTCTTCCCCGGGTTCTTCCEEECCSSCCCCCGGGGGCTTCSEEECTTSCCCCCGGGGGCT
T ss_pred             CcccCchhhccCCceeEEECCCCCCcccccchhhCCCCcEEEecCCCcCCchhhccCCCCCEEEccCCcccccccccCCC
Confidence            77776665777777777777777 34445556777777778877777777666777788888888888777666677788


Q ss_pred             CccEEEcCCCCCccccCCCCCCCCCEEECCCCCCCCCcCCcCCCCCCeEeccCCcCcCccccCCCCCccEEEccCCCCCC
Q psy14728        170 NLEELYLGKNKISRIDNLASLTKLNILSLQCNRLRTIENLEALTNLTQLYLSENGLTTIENLLSNEKLETLDVAYNKISI  249 (319)
Q Consensus       170 ~L~~L~l~~~~l~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~L~~L~l~~~~~~~  249 (319)
                      +|+.+++++|.+.+.+.+..+++|++|++++|+++.++.+..+++|++|++++|.++.++.+..+++|++|++++|.++.
T Consensus       200 ~L~~L~l~~n~l~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~l~~L~~L~l~~n~l~~  279 (347)
T 4fmz_A          200 SLHYFTAYVNQITDITPVANMTRLNSLKIGNNKITDLSPLANLSQLTWLEIGTNQISDINAVKDLTKLKMLNVGSNQISD  279 (347)
T ss_dssp             TCCEEECCSSCCCCCGGGGGCTTCCEEECCSSCCCCCGGGTTCTTCCEEECCSSCCCCCGGGTTCTTCCEEECCSSCCCC
T ss_pred             ccceeecccCCCCCCchhhcCCcCCEEEccCCccCCCcchhcCCCCCEEECCCCccCCChhHhcCCCcCEEEccCCccCC
Confidence            88888888888777766788888999999999888877788889999999999998888888888999999999999988


Q ss_pred             ccccccCCCCcEEEcCCCcCCCCcccccccCCCCCcEEEcCCCcCcCChhhHHHHHHhCCceEEEecccC
Q psy14728        250 IQNIAHLTELQEFWINDNQVSDWNTVNVLENNKQLQTIYLDRNPVAQDPNYRRKIKLVCPWIVQIDATLA  319 (319)
Q Consensus       250 ~~~l~~~~~L~~L~l~~n~~~~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~~~~~~~L~~l~~~~C  319 (319)
                      ++.+..+++|++|++++|++++. .+..+..+++|+.|++++|+++..+.     +..+++|+.|++++|
T Consensus       280 ~~~~~~l~~L~~L~L~~n~l~~~-~~~~l~~l~~L~~L~L~~n~l~~~~~-----~~~l~~L~~L~l~~N  343 (347)
T 4fmz_A          280 ISVLNNLSQLNSLFLNNNQLGNE-DMEVIGGLTNLTTLFLSQNHITDIRP-----LASLSKMDSADFANQ  343 (347)
T ss_dssp             CGGGGGCTTCSEEECCSSCCCGG-GHHHHHTCTTCSEEECCSSSCCCCGG-----GGGCTTCSEESSSCC
T ss_pred             ChhhcCCCCCCEEECcCCcCCCc-ChhHhhccccCCEEEccCCccccccC-----hhhhhccceeehhhh
Confidence            88888899999999999998873 44667889999999999999988876     567999999999876



>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 319
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-26
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-24
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-24
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-22
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-11
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-09
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-09
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-08
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-13
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-13
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 5e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 7e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 4e-13
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 3e-12
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 3e-11
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-10
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 3e-09
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-12
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-11
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-10
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 7e-12
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 2e-10
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 3e-09
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 1e-07
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 4e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 6e-09
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 9e-08
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 6e-05
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 7e-05
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.001
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 8e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 9e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 0.001
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.002
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.003
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score =  104 bits (260), Expect = 4e-26
 Identities = 65/200 (32%), Positives = 110/200 (55%)

Query: 68  WNLIKKIENIHMLTTLKELELYDNQLTVIENLDTLINLEILDLSFNRIREIKGLDHLANL 127
            N +  I  +  LT L+ L   +NQ++ I  L  L NL+ L L+ N++++I  L  L NL
Sbjct: 184 SNKVSDISVLAKLTNLESLIATNNQISDITPLGILTNLDELSLNGNQLKDIGTLASLTNL 243

Query: 128 EKLYLCSNKISKIENVDHLKKLKVLELGDNKIRIIENLDGLTNLEELYLGKNKISRIDNL 187
             L L +N+IS +  +  L KL  L+LG N+I  I  L GLT L  L L +N++  I  +
Sbjct: 244 TDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISPI 303

Query: 188 ASLTKLNILSLQCNRLRTIENLEALTNLTQLYLSENGLTTIENLLSNEKLETLDVAYNKI 247
           ++L  L  L+L  N +  I  + +LT L +L+ + N ++ + +L +   +  L   +N+I
Sbjct: 304 SNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFANNKVSDVSSLANLTNINWLSAGHNQI 363

Query: 248 SIIQNIAHLTELQEFWINDN 267
           S +  +A+LT + +  +ND 
Sbjct: 364 SDLTPLANLTRITQLGLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query319
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.97
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.92
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.9
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.89
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.89
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.89
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.89
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.88
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.88
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.87
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.86
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.84
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.84
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.82
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.82
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.77
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.76
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.75
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.62
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.62
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.59
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.58
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.57
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.53
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.49
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.48
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.47
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.44
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.44
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.42
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.36
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.34
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.23
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.0
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.74
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.11
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.93
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.8
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.46
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.13
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.97  E-value=1.2e-28  Score=216.89  Aligned_cols=257  Identities=32%  Similarity=0.392  Sum_probs=179.2

Q ss_pred             cccccccceEEEecCCcccCccccccCCCCCEEEccCCCccCccCCCCCCCCcEEEccCCCCccccC-------------
Q psy14728         54 EESKEVCIERLLLRWNLIKKIENIHMLTTLKELELYDNQLTVIENLDTLINLEILDLSFNRIREIKG-------------  120 (319)
Q Consensus        54 ~~~~~~~L~~L~l~~~~~~~l~~~~~~~~L~~L~l~~~~~~~~~~~~~l~~L~~L~l~~~~~~~l~~-------------  120 (319)
                      .++.+++|++|++++|.+++++.++++++|++|++++|++..++.++++++|+.|+++++.+..++.             
T Consensus        61 gl~~L~nL~~L~Ls~N~l~~l~~l~~L~~L~~L~L~~n~i~~i~~l~~l~~L~~L~~~~~~~~~~~~~~~~~~~~~~~~~  140 (384)
T d2omza2          61 GVEYLNNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRLELS  140 (384)
T ss_dssp             TGGGCTTCCEEECCSSCCCCCGGGTTCTTCCEEECCSSCCCCCGGGTTCTTCCEEECCSSCCCCCGGGTTCTTCSEEEEE
T ss_pred             ccccCCCCCEEeCcCCcCCCCccccCCccccccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence            3455666666777666666666666666667777766666665556666666666666554432110             


Q ss_pred             ----------------------------------------------------CCCCCCccEEEccCCcccccCCCCCCCC
Q psy14728        121 ----------------------------------------------------LDHLANLEKLYLCSNKISKIENVDHLKK  148 (319)
Q Consensus       121 ----------------------------------------------------~~~l~~L~~L~l~~~~~~~~~~~~~~~~  148 (319)
                                                                          ...+++++.++++++.++.++....+++
T Consensus       141 ~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~l~l~~n~i~~~~~~~~~~~  220 (384)
T d2omza2         141 SNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDITPLGILTN  220 (384)
T ss_dssp             EEEECCCGGGTTCTTCSEEEEEESCCCCGGGTTCTTCCEEECCSSCCCCCGGGGGCTTCSEEECCSSCCCCCGGGGGCTT
T ss_pred             cccccccccccccccccccccccccchhhhhccccccccccccccccccccccccccccceeeccCCccCCCCcccccCC
Confidence                                                                1122445555555555554444445566


Q ss_pred             ccEEEccCCcCcCccccCCCCCccEEEcCCCCCccccCCCCCCCCCEEECCCCCCCCCcCCcCCCCCCeEeccCCcCcCc
Q psy14728        149 LKVLELGDNKIRIIENLDGLTNLEELYLGKNKISRIDNLASLTKLNILSLQCNRLRTIENLEALTNLTQLYLSENGLTTI  228 (319)
Q Consensus       149 L~~L~l~~~~~~~~~~l~~~~~L~~L~l~~~~l~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~  228 (319)
                      |++|+++++.+..++.+..+++|+.+++.+|.+.+++.+..+++|++++++++++..++.+..++.++.+.+..|.++++
T Consensus       221 L~~L~l~~n~l~~~~~l~~l~~L~~L~l~~n~l~~~~~~~~~~~L~~L~l~~~~l~~~~~~~~~~~l~~l~~~~n~l~~~  300 (384)
T d2omza2         221 LDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDI  300 (384)
T ss_dssp             CCEEECCSSCCCCCGGGGGCTTCSEEECCSSCCCCCGGGTTCTTCSEEECCSSCCCCCGGGTTCTTCSEEECCSSCCSCC
T ss_pred             CCEEECCCCCCCCcchhhcccccchhccccCccCCCCcccccccCCEeeccCcccCCCCccccccccccccccccccccc
Confidence            66666666666655556666677777777766666655666677777777777766666666667777777777777777


Q ss_pred             cccCCCCCccEEEccCCCCCCccccccCCCCcEEEcCCCcCCCCcccccccCCCCCcEEEcCCCcCcCChhhHHHHHHhC
Q psy14728        229 ENLLSNEKLETLDVAYNKISIIQNIAHLTELQEFWINDNQVSDWNTVNVLENNKQLQTIYLDRNPVAQDPNYRRKIKLVC  308 (319)
Q Consensus       229 ~~~~~~~~L~~L~l~~~~~~~~~~l~~~~~L~~L~l~~n~~~~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~~~~~  308 (319)
                      +.+..+++++.|++++|++++++.+..+++|++|++++|++++.   ..+..+++|+.|++++|+++..++     +..+
T Consensus       301 ~~~~~~~~l~~L~ls~n~l~~l~~l~~l~~L~~L~L~~n~l~~l---~~l~~l~~L~~L~l~~N~l~~l~~-----l~~l  372 (384)
T d2omza2         301 SPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFANNKVSDV---SSLANLTNINWLSAGHNQISDLTP-----LANL  372 (384)
T ss_dssp             GGGGGCTTCSEEECCSSCCSCCGGGGGCTTCCEEECCSSCCCCC---GGGGGCTTCCEEECCSSCCCBCGG-----GTTC
T ss_pred             cccchhcccCeEECCCCCCCCCcccccCCCCCEEECCCCCCCCC---hhHcCCCCCCEEECCCCcCCCChh-----hccC
Confidence            66777888999999999998887788999999999999998874   347789999999999999998876     4678


Q ss_pred             CceEEEeccc
Q psy14728        309 PWIVQIDATL  318 (319)
Q Consensus       309 ~~L~~l~~~~  318 (319)
                      ++|+.|++++
T Consensus       373 ~~L~~L~L~~  382 (384)
T d2omza2         373 TRITQLGLND  382 (384)
T ss_dssp             TTCSEEECCC
T ss_pred             CCCCEeeCCC
Confidence            9999999874



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure