Psyllid ID: psy14827
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 220 | ||||||
| 242022130 | 84 | anaphase-promoting complex subunit, puta | 0.35 | 0.916 | 0.870 | 4e-36 | |
| 442761713 | 88 | Putative anaphase promoting complex subu | 0.35 | 0.875 | 0.857 | 1e-35 | |
| 346466005 | 106 | hypothetical protein [Amblyomma maculatu | 0.35 | 0.726 | 0.844 | 2e-35 | |
| 390340571 | 85 | PREDICTED: anaphase-promoting complex su | 0.35 | 0.905 | 0.844 | 8e-35 | |
| 427793949 | 86 | Putative anaphase promoting complex subu | 0.35 | 0.895 | 0.844 | 9e-35 | |
| 348521029 | 84 | PREDICTED: anaphase-promoting complex su | 0.35 | 0.916 | 0.844 | 1e-34 | |
| 390340594 | 91 | PREDICTED: anaphase-promoting complex su | 0.359 | 0.868 | 0.822 | 1e-34 | |
| 47223961 | 84 | unnamed protein product [Tetraodon nigro | 0.35 | 0.916 | 0.844 | 2e-34 | |
| 443725234 | 82 | hypothetical protein CAPTEDRAFT_198714 [ | 0.35 | 0.939 | 0.844 | 6e-34 | |
| 332018555 | 84 | Anaphase-promoting complex subunit 11 [A | 0.35 | 0.916 | 0.831 | 1e-33 |
| >gi|242022130|ref|XP_002431494.1| anaphase-promoting complex subunit, putative [Pediculus humanus corporis] gi|212516788|gb|EEB18756.1| anaphase-promoting complex subunit, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 157 bits (396), Expect = 4e-36, Method: Compositional matrix adjust.
Identities = 67/77 (87%), Positives = 72/77 (93%)
Query: 144 WTGVATWRWVANDDTCGICRIAFEGCCSDCKLPGDDCPLVWGQCSHCFHIHCIMKWLNSQ 203
W GVATWRWVANDD CGICR+ F+ CC+DCKLPGDDCPLVWGQCSHCFHIHCIMKWLNSQ
Sbjct: 8 WNGVATWRWVANDDNCGICRMPFDACCTDCKLPGDDCPLVWGQCSHCFHIHCIMKWLNSQ 67
Query: 204 QVHHQCPMCRQEWKFKE 220
Q++H CPMCRQEWKFKE
Sbjct: 68 QINHHCPMCRQEWKFKE 84
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|442761713|gb|JAA73015.1| Putative anaphase promoting complex subunit 11, partial [Ixodes ricinus] | Back alignment and taxonomy information |
|---|
| >gi|346466005|gb|AEO32847.1| hypothetical protein [Amblyomma maculatum] | Back alignment and taxonomy information |
|---|
| >gi|390340571|ref|XP_781978.3| PREDICTED: anaphase-promoting complex subunit 11-like [Strongylocentrotus purpuratus] | Back alignment and taxonomy information |
|---|
| >gi|427793949|gb|JAA62426.1| Putative anaphase promoting complex subunit 11, partial [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|348521029|ref|XP_003448029.1| PREDICTED: anaphase-promoting complex subunit 11-like [Oreochromis niloticus] | Back alignment and taxonomy information |
|---|
| >gi|390340594|ref|XP_001185921.2| PREDICTED: anaphase-promoting complex subunit 11-like [Strongylocentrotus purpuratus] | Back alignment and taxonomy information |
|---|
| >gi|47223961|emb|CAG06138.1| unnamed protein product [Tetraodon nigroviridis] | Back alignment and taxonomy information |
|---|
| >gi|443725234|gb|ELU12914.1| hypothetical protein CAPTEDRAFT_198714 [Capitella teleta] | Back alignment and taxonomy information |
|---|
| >gi|332018555|gb|EGI59144.1| Anaphase-promoting complex subunit 11 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 220 | ||||||
| UNIPROTKB|Q3ZCF6 | 84 | ANAPC11 "Anaphase-promoting co | 0.35 | 0.916 | 0.818 | 4.8e-39 | |
| UNIPROTKB|E2R4W0 | 84 | ANAPC11 "Uncharacterized prote | 0.35 | 0.916 | 0.818 | 4.8e-39 | |
| MGI|MGI:1913406 | 84 | Anapc11 "anaphase promoting co | 0.35 | 0.916 | 0.818 | 4.8e-39 | |
| RGD|1561880 | 84 | Anapc11 "anaphase promoting co | 0.35 | 0.916 | 0.818 | 4.8e-39 | |
| ZFIN|ZDB-GENE-061013-383 | 88 | anapc11 "APC11 anaphase promot | 0.35 | 0.875 | 0.818 | 6.1e-39 | |
| UNIPROTKB|Q9NYG5 | 84 | ANAPC11 "Anaphase-promoting co | 0.35 | 0.916 | 0.805 | 1.6e-38 | |
| UNIPROTKB|Q5R8A2 | 84 | ANAPC11 "Anaphase-promoting co | 0.35 | 0.916 | 0.805 | 1.6e-38 | |
| UNIPROTKB|I3L933 | 84 | ANAPC11 "Uncharacterized prote | 0.327 | 0.857 | 0.791 | 4e-35 | |
| FB|FBgn0250903 | 85 | lmgA "lemming A" [Drosophila m | 0.340 | 0.882 | 0.746 | 8.3e-35 | |
| DICTYBASE|DDB_G0286909 | 87 | anapc11 "anaphase promoting co | 0.340 | 0.862 | 0.631 | 2.3e-30 |
| UNIPROTKB|Q3ZCF6 ANAPC11 "Anaphase-promoting complex subunit 11" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Score = 417 (151.9 bits), Expect = 4.8e-39, P = 4.8e-39
Identities = 63/77 (81%), Positives = 69/77 (89%)
Query: 144 WTGVATWRWVANDDTCGICRIAFEGCCSDCKLPGDDCPLVWGQCSHCFHIHCIMKWLNSQ 203
W GVATW WVAND+ CGICR+AF GCC DCK+PGDDCPLVWGQCSHCFH+HCI+KWLN+Q
Sbjct: 8 WNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLNAQ 67
Query: 204 QVHHQCPMCRQEWKFKE 220
QV CPMCRQEWKFKE
Sbjct: 68 QVQQHCPMCRQEWKFKE 84
|
|
| UNIPROTKB|E2R4W0 ANAPC11 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1913406 Anapc11 "anaphase promoting complex subunit 11" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1561880 Anapc11 "anaphase promoting complex subunit 11" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-061013-383 anapc11 "APC11 anaphase promoting complex subunit 11 homolog (yeast)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9NYG5 ANAPC11 "Anaphase-promoting complex subunit 11" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5R8A2 ANAPC11 "Anaphase-promoting complex subunit 11" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3L933 ANAPC11 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0250903 lmgA "lemming A" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0286909 anapc11 "anaphase promoting complex subunit 11" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 220 | |||
| pfam12861 | 85 | pfam12861, zf-Apc11, Anaphase-promoting complex su | 1e-41 | |
| pfam12678 | 73 | pfam12678, zf-rbx1, RING-H2 zinc finger | 5e-33 | |
| COG5194 | 88 | COG5194, APC11, Component of SCF ubiquitin ligase | 3e-25 | |
| pfam13639 | 46 | pfam13639, zf-RING_2, Ring finger domain | 4e-08 | |
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 4e-07 | |
| COG5243 | 491 | COG5243, HRD1, HRD ubiquitin ligase complex, ER me | 3e-06 | |
| COG5219 | 1525 | COG5219, COG5219, Uncharacterized conserved protei | 4e-05 | |
| COG5540 | 374 | COG5540, COG5540, RING-finger-containing ubiquitin | 3e-04 | |
| smart00184 | 40 | smart00184, RING, Ring finger | 0.002 |
| >gnl|CDD|193335 pfam12861, zf-Apc11, Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
Score = 136 bits (343), Expect = 1e-41
Identities = 46/78 (58%), Positives = 56/78 (71%), Gaps = 1/78 (1%)
Query: 144 WTGVATWRW-VANDDTCGICRIAFEGCCSDCKLPGDDCPLVWGQCSHCFHIHCIMKWLNS 202
W VATW W +DD CGICR++F+G C CK PGDDCPLVWG+C H FH+HCI+KWL +
Sbjct: 8 WNAVATWTWDTPSDDVCGICRVSFDGTCPQCKFPGDDCPLVWGKCKHNFHMHCILKWLAT 67
Query: 203 QQVHHQCPMCRQEWKFKE 220
+ CPMCRQ + F E
Sbjct: 68 ETSKGLCPMCRQTFVFAE 85
|
Apc11 is one of the subunits of the anaphase-promoting complex or cyclosome. The APC subunits are cullin family proteins with ubiquitin ligase activity. Polyubiquitination marks proteins for degradation by the 26S proteasome and is carried out by a cascade of enzymes that includes ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s), and ubiquitin ligases (E3s). Apc11 acts as an E3 enzyme and is responsible for recruiting E2s to the APC and for mediating the subsequent transfer of ubiquitin to APC substrates in vivo. In Saccharomyces cerevisiae this RING-H2 finger protein defines the minimal ubiquitin ligase activity of the APC, and the integrity of the RING-H2 finger is essential for budding yeast cell viability. Length = 85 |
| >gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|227521 COG5194, APC11, Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain | Back alignment and domain information |
|---|
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|227544 COG5219, COG5219, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|214546 smart00184, RING, Ring finger | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 220 | |||
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 99.89 | |
| KOG1493|consensus | 84 | 99.85 | ||
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 99.85 | |
| KOG2930|consensus | 114 | 99.81 | ||
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 99.8 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 99.5 | |
| KOG0317|consensus | 293 | 99.45 | ||
| KOG4628|consensus | 348 | 99.34 | ||
| KOG0823|consensus | 230 | 99.26 | ||
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 99.26 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 99.1 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 99.09 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 99.08 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 99.07 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 99.0 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 98.96 | |
| KOG0320|consensus | 187 | 98.95 | ||
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 98.91 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 98.85 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 98.83 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 98.82 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 98.8 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 98.73 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 98.72 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 98.62 | |
| KOG0802|consensus | 543 | 98.59 | ||
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 98.49 | |
| KOG2164|consensus | 513 | 98.49 | ||
| KOG0287|consensus | 442 | 98.48 | ||
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 98.43 | |
| KOG1734|consensus | 328 | 98.42 | ||
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 98.37 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 98.24 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 98.15 | |
| KOG0804|consensus | 493 | 98.11 | ||
| KOG2177|consensus | 386 | 98.08 | ||
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 98.08 | |
| KOG0828|consensus | 636 | 98.03 | ||
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 98.01 | |
| KOG0825|consensus | 1134 | 97.99 | ||
| KOG0978|consensus | 698 | 97.76 | ||
| KOG0311|consensus | 381 | 97.7 | ||
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 97.63 | |
| KOG4445|consensus | 368 | 97.41 | ||
| KOG4172|consensus | 62 | 97.39 | ||
| KOG0297|consensus | 391 | 97.36 | ||
| KOG1039|consensus | 344 | 97.35 | ||
| PHA02862 | 156 | 5L protein; Provisional | 97.22 | |
| KOG4265|consensus | 349 | 97.19 | ||
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 97.17 | |
| KOG1645|consensus | 463 | 97.15 | ||
| PHA02825 | 162 | LAP/PHD finger-like protein; Provisional | 97.05 | |
| KOG1785|consensus | 563 | 96.9 | ||
| KOG4159|consensus | 398 | 96.83 | ||
| KOG3970|consensus | 299 | 96.71 | ||
| KOG1952|consensus | 950 | 96.43 | ||
| KOG1813|consensus | 313 | 96.42 | ||
| KOG1941|consensus | 518 | 96.36 | ||
| KOG1428|consensus | 3738 | 96.07 | ||
| PHA03096 | 284 | p28-like protein; Provisional | 96.02 | |
| KOG2660|consensus | 331 | 95.95 | ||
| KOG2114|consensus | 933 | 95.89 | ||
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 95.87 | |
| KOG2879|consensus | 298 | 95.68 | ||
| PF12906 | 47 | RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. | 95.66 | |
| KOG0826|consensus | 357 | 95.55 | ||
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 95.51 | |
| KOG1002|consensus | 791 | 95.39 | ||
| KOG1571|consensus | 355 | 94.87 | ||
| PF05883 | 134 | Baculo_RING: Baculovirus U-box/Ring-like domain; I | 94.84 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 94.81 | |
| KOG3268|consensus | 234 | 94.58 | ||
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 94.29 | |
| KOG0309|consensus | 1081 | 93.9 | ||
| KOG2034|consensus | 911 | 93.44 | ||
| PF10272 | 358 | Tmpp129: Putative transmembrane protein precursor; | 93.42 | |
| KOG4275|consensus | 350 | 93.04 | ||
| KOG0827|consensus | 465 | 92.68 | ||
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 92.63 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 92.42 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 91.97 | |
| KOG1001|consensus | 674 | 91.78 | ||
| KOG3039|consensus | 303 | 91.67 | ||
| KOG1814|consensus | 445 | 91.52 | ||
| PF05290 | 140 | Baculo_IE-1: Baculovirus immediate-early protein ( | 91.0 | |
| KOG4692|consensus | 489 | 90.87 | ||
| COG5183 | 1175 | SSM4 Protein involved in mRNA turnover and stabili | 90.79 | |
| PF08746 | 43 | zf-RING-like: RING-like domain; InterPro: IPR01485 | 90.74 | |
| KOG0298|consensus | 1394 | 89.78 | ||
| KOG1940|consensus | 276 | 89.64 | ||
| KOG0801|consensus | 205 | 89.3 | ||
| KOG3899|consensus | 381 | 87.55 | ||
| PF14446 | 54 | Prok-RING_1: Prokaryotic RING finger family 1 | 87.53 | |
| KOG3053|consensus | 293 | 87.27 | ||
| PF07800 | 162 | DUF1644: Protein of unknown function (DUF1644); In | 87.2 | |
| KOG2817|consensus | 394 | 87.16 | ||
| KOG3002|consensus | 299 | 86.63 | ||
| KOG1812|consensus | 384 | 84.59 | ||
| KOG4718|consensus | 235 | 83.66 | ||
| KOG2932|consensus | 389 | 82.85 | ||
| KOG4362|consensus | 684 | 82.76 | ||
| KOG1829|consensus | 580 | 81.61 | ||
| KOG3039|consensus | 303 | 80.67 |
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
Probab=99.89 E-value=7.9e-24 Score=156.89 Aligned_cols=82 Identities=68% Similarity=1.609 Sum_probs=76.8
Q ss_pred Cccccccccceeccc-CCCcccccccccccccCCCCCCCCCCCCceecCCCCcchHHHHHHHHHhCCCCCCCCCcCcccc
Q psy14827 139 NPMVGWTGVATWRWV-ANDDTCGICRIAFEGCCSDCKLPGDDCPLVWGQCSHCFHIHCIMKWLNSQQVHHQCPMCRQEWK 217 (220)
Q Consensus 139 ~~~~~~~~~~~~~~~-~~~~~CaICLe~f~~~~~~~~~p~~~~~~~~~~CgHvFH~~CI~~WL~~~~~~~sCPvCR~e~~ 217 (220)
+.+++|++|+.|.|+ ..++.|.||+..|+..+..++.||+++|++++.|+|.||.+||.+||.+++.+..||+||++|+
T Consensus 3 v~i~~w~~va~W~Wd~~~dd~CgICr~~fdg~Cp~Ck~Pgd~Cplv~g~C~H~FH~hCI~kWl~~~~~~~~CPmCR~~w~ 82 (85)
T PF12861_consen 3 VKIKEWHAVATWKWDVANDDVCGICRMPFDGCCPDCKFPGDDCPLVWGKCSHNFHMHCILKWLSTQSSKGQCPMCRQPWK 82 (85)
T ss_pred eEEEEEEEEEEEEEecCCCCceeeEecccccCCCCccCCCCCCceeeccCccHHHHHHHHHHHccccCCCCCCCcCCeee
Confidence 568899999999996 5799999999999999999999999999999999999999999999998556899999999999
Q ss_pred ccC
Q psy14827 218 FKE 220 (220)
Q Consensus 218 ~~~ 220 (220)
|||
T Consensus 83 ~k~ 85 (85)
T PF12861_consen 83 FKE 85 (85)
T ss_pred eCC
Confidence 997
|
|
| >KOG1493|consensus | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2930|consensus | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >KOG0317|consensus | Back alignment and domain information |
|---|
| >KOG4628|consensus | Back alignment and domain information |
|---|
| >KOG0823|consensus | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0320|consensus | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >KOG0802|consensus | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2164|consensus | Back alignment and domain information |
|---|
| >KOG0287|consensus | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >KOG1734|consensus | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >KOG0804|consensus | Back alignment and domain information |
|---|
| >KOG2177|consensus | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >KOG0828|consensus | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >KOG0825|consensus | Back alignment and domain information |
|---|
| >KOG0978|consensus | Back alignment and domain information |
|---|
| >KOG0311|consensus | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >KOG4445|consensus | Back alignment and domain information |
|---|
| >KOG4172|consensus | Back alignment and domain information |
|---|
| >KOG0297|consensus | Back alignment and domain information |
|---|
| >KOG1039|consensus | Back alignment and domain information |
|---|
| >PHA02862 5L protein; Provisional | Back alignment and domain information |
|---|
| >KOG4265|consensus | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1645|consensus | Back alignment and domain information |
|---|
| >PHA02825 LAP/PHD finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG1785|consensus | Back alignment and domain information |
|---|
| >KOG4159|consensus | Back alignment and domain information |
|---|
| >KOG3970|consensus | Back alignment and domain information |
|---|
| >KOG1952|consensus | Back alignment and domain information |
|---|
| >KOG1813|consensus | Back alignment and domain information |
|---|
| >KOG1941|consensus | Back alignment and domain information |
|---|
| >KOG1428|consensus | Back alignment and domain information |
|---|
| >PHA03096 p28-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG2660|consensus | Back alignment and domain information |
|---|
| >KOG2114|consensus | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >KOG2879|consensus | Back alignment and domain information |
|---|
| >PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A | Back alignment and domain information |
|---|
| >KOG0826|consensus | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >KOG1002|consensus | Back alignment and domain information |
|---|
| >KOG1571|consensus | Back alignment and domain information |
|---|
| >PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3268|consensus | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0309|consensus | Back alignment and domain information |
|---|
| >KOG2034|consensus | Back alignment and domain information |
|---|
| >PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans | Back alignment and domain information |
|---|
| >KOG4275|consensus | Back alignment and domain information |
|---|
| >KOG0827|consensus | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >KOG1001|consensus | Back alignment and domain information |
|---|
| >KOG3039|consensus | Back alignment and domain information |
|---|
| >KOG1814|consensus | Back alignment and domain information |
|---|
| >PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 | Back alignment and domain information |
|---|
| >KOG4692|consensus | Back alignment and domain information |
|---|
| >COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) | Back alignment and domain information |
|---|
| >KOG0298|consensus | Back alignment and domain information |
|---|
| >KOG1940|consensus | Back alignment and domain information |
|---|
| >KOG0801|consensus | Back alignment and domain information |
|---|
| >KOG3899|consensus | Back alignment and domain information |
|---|
| >PF14446 Prok-RING_1: Prokaryotic RING finger family 1 | Back alignment and domain information |
|---|
| >KOG3053|consensus | Back alignment and domain information |
|---|
| >PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG2817|consensus | Back alignment and domain information |
|---|
| >KOG3002|consensus | Back alignment and domain information |
|---|
| >KOG1812|consensus | Back alignment and domain information |
|---|
| >KOG4718|consensus | Back alignment and domain information |
|---|
| >KOG2932|consensus | Back alignment and domain information |
|---|
| >KOG4362|consensus | Back alignment and domain information |
|---|
| >KOG1829|consensus | Back alignment and domain information |
|---|
| >KOG3039|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 220 | ||||
| 1u6g_B | 108 | Crystal Structure Of The Cand1-Cul1-Roc1 Complex Le | 9e-12 | ||
| 3dqv_R | 106 | Structural Insights Into Nedd8 Activation Of Cullin | 1e-11 | ||
| 4a0k_B | 117 | Structure Of Ddb1-Ddb2-Cul4a-Rbx1 Bound To A 12 Bp | 1e-11 | ||
| 3dpl_R | 106 | Structural Insights Into Nedd8 Activation Of Cullin | 1e-11 | ||
| 4a0c_D | 98 | Structure Of The Cand1-Cul4b-Rbx1 Complex Length = | 2e-11 | ||
| 1ldj_B | 90 | Structure Of The Cul1-rbx1-skp1-f Boxskp2 Scf Ubiqu | 2e-11 | ||
| 2lgv_A | 100 | Rbx1 Length = 100 | 6e-09 | ||
| 2ecl_A | 81 | Solution Structure Of The Ring Domain Of The Human | 1e-07 |
| >pdb|1U6G|B Chain B, Crystal Structure Of The Cand1-Cul1-Roc1 Complex Length = 108 | Back alignment and structure |
|
| >pdb|3DQV|R Chain R, Structural Insights Into Nedd8 Activation Of Cullin-Ring Ligases: Conformational Control Of Conjugation Length = 106 | Back alignment and structure |
| >pdb|4A0K|B Chain B, Structure Of Ddb1-Ddb2-Cul4a-Rbx1 Bound To A 12 Bp Abasic Site Containing Dna-Duplex Length = 117 | Back alignment and structure |
| >pdb|3DPL|R Chain R, Structural Insights Into Nedd8 Activation Of Cullin-Ring Ligases: Conformational Control Of Conjugation. Length = 106 | Back alignment and structure |
| >pdb|4A0C|D Chain D, Structure Of The Cand1-Cul4b-Rbx1 Complex Length = 98 | Back alignment and structure |
| >pdb|1LDJ|B Chain B, Structure Of The Cul1-rbx1-skp1-f Boxskp2 Scf Ubiquitin Ligase Complex Length = 90 | Back alignment and structure |
| >pdb|2LGV|A Chain A, Rbx1 Length = 100 | Back alignment and structure |
| >pdb|2ECL|A Chain A, Solution Structure Of The Ring Domain Of The Human Ring-Box Protein 2 Length = 81 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 220 | |||
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 1e-30 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 1e-24 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 3e-24 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 5e-10 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 6e-10 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 3e-09 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 7e-09 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 1e-08 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 1e-08 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 3e-08 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 4e-08 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 4e-08 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 8e-08 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 1e-07 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 1e-07 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 2e-07 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 2e-06 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 6e-06 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 2e-05 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 3e-05 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 4e-05 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 2e-04 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 2e-04 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 6e-04 |
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
Score = 106 bits (267), Expect = 1e-30
Identities = 26/79 (32%), Positives = 41/79 (51%), Gaps = 5/79 (6%)
Query: 144 WTGVATWRWVANDDTCGICRIAFEGCCSDCKLPG--DDCPLVWGQCSHCFHIHCIMKWLN 201
W W DTC ICR+ C C+ +DC +VWG+C+H FH C+ W+
Sbjct: 3 SGSSGMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVK 62
Query: 202 SQQVHHQCPMCRQEWKFKE 220
+++CP+C+Q+W +
Sbjct: 63 Q---NNRCPLCQQDWVVQR 78
|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117 | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106 | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 220 | |||
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 99.85 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 99.84 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 99.77 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 99.49 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 99.49 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 99.49 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 99.47 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 99.47 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 99.47 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 99.46 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 99.45 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 99.44 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 99.42 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 99.42 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 99.42 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 99.41 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 99.39 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 99.34 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 99.34 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 99.31 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 99.3 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 99.29 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 99.29 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 99.28 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 99.27 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 99.26 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 99.25 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 99.24 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 99.24 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 99.22 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 99.22 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 99.19 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 99.19 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 99.18 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 99.18 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 99.17 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 99.16 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 99.14 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 99.14 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 99.13 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 99.12 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 99.1 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 99.04 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 99.03 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 99.01 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 99.0 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 98.99 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 98.94 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 98.94 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 98.94 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 98.94 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 98.93 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 98.92 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 98.91 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 98.88 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 98.86 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 98.84 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 98.83 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 98.78 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 98.73 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 98.72 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 98.7 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 98.62 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 98.61 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 98.59 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 98.58 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 98.51 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 98.38 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 98.35 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 98.18 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 98.16 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 98.06 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 94.12 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 89.96 | |
| 1z2q_A | 84 | LM5-1; membrane protein, FYVE domain, zinc-finger; | 85.2 | |
| 2ko5_A | 99 | Ring finger protein Z; lassa fever virus-Z, negati | 83.37 |
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
Probab=99.85 E-value=1.9e-22 Score=154.82 Aligned_cols=85 Identities=34% Similarity=0.982 Sum_probs=73.3
Q ss_pred ccCCCCCccccccccceecccCCCcccccccccccccCCCCC-----CCCCCCCceecCCCCcchHHHHHHHHHhCCCCC
Q psy14827 133 SKATPFNPMVGWTGVATWRWVANDDTCGICRIAFEGCCSDCK-----LPGDDCPLVWGQCSHCFHIHCIMKWLNSQQVHH 207 (220)
Q Consensus 133 s~~~~~~~~~~~~~~~~~~~~~~~~~CaICLe~f~~~~~~~~-----~p~~~~~~~~~~CgHvFH~~CI~~WL~~~~~~~ 207 (220)
....+++.+++|++++.|+|+..++.|+||++.|++.+..|+ .++++++++++.|||+||.+||..||.. +.
T Consensus 14 ~~~~~r~~ik~~~~v~~w~~d~~~d~CaIC~~~~~~~c~~C~~~~~~~~~~~~~~~~~~C~H~FH~~Ci~~Wl~~---~~ 90 (106)
T 3dpl_R 14 GAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKT---RQ 90 (106)
T ss_dssp ---CCSEEEEEEEEEEEEEESSCSCCCSSSCSCTTSCCTTHHHHTTCC---CCCEEEETTSCEEEHHHHHHHHTT---CS
T ss_pred ccccCceeEEEEEEeeEeecCCCCCCCccCChhHhCcCchhhccccccCCccceEeecccCcEECHHHHHHHHHc---CC
Confidence 345678999999999999999999999999999999887766 3667788999999999999999999999 99
Q ss_pred CCCCcCccccccC
Q psy14827 208 QCPMCRQEWKFKE 220 (220)
Q Consensus 208 sCPvCR~e~~~~~ 220 (220)
+||+||++|.|++
T Consensus 91 ~CP~Cr~~~~~~~ 103 (106)
T 3dpl_R 91 VCPLDNREWEFQK 103 (106)
T ss_dssp BCSSSCSBCCEEE
T ss_pred cCcCCCCcceeec
Confidence 9999999999873
|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1z2q_A LM5-1; membrane protein, FYVE domain, zinc-finger; NMR {Leishmania major} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 220 | ||||
| d3dplr1 | 88 | g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S | 1e-22 | |
| d1iyma_ | 55 | g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati | 6e-09 | |
| d1vyxa_ | 60 | g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do | 5e-08 | |
| d1v87a_ | 114 | g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou | 2e-07 | |
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 2e-06 | |
| d1g25a_ | 65 | g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi | 4e-06 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 5e-06 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 3e-05 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 0.001 | |
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 0.002 | |
| d1ur6b_ | 52 | g.44.1.1 (B:) Not-4 N-terminal RING finger domain | 0.002 |
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex species: Human (Homo sapiens) [TaxId: 9606]
Score = 85.6 bits (211), Expect = 1e-22
Identities = 29/82 (35%), Positives = 40/82 (48%), Gaps = 8/82 (9%)
Query: 144 WTGVATWRWVANDDTCGICRIAFEGCCSDCKLPGDD-----CPLVWGQCSHCFHIHCIMK 198
W VA W W D C ICR C +C+ C + WG C+H FH HCI +
Sbjct: 9 WNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISR 68
Query: 199 WLNSQQVHHQCPMCRQEWKFKE 220
WL + CP+ +EW+F++
Sbjct: 69 WL---KTRQVCPLDNREWEFQK 87
|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 220 | |||
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 99.83 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 99.59 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 99.55 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 99.48 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 99.48 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 99.47 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 99.4 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 99.4 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 99.38 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.23 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 99.23 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.08 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 99.05 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 98.98 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 98.94 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 98.79 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 98.38 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 91.23 | |
| d1wila_ | 89 | Hypothetical protein KIAA1045 {Human (Homo sapiens | 87.16 | |
| d1fp0a1 | 70 | Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo | 80.76 |
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.83 E-value=4.3e-22 Score=145.83 Aligned_cols=81 Identities=36% Similarity=1.024 Sum_probs=68.9
Q ss_pred CCCccccccccceecccCCCcccccccccccccCCCCCCC-----CCCCCceecCCCCcchHHHHHHHHHhCCCCCCCCC
Q psy14827 137 PFNPMVGWTGVATWRWVANDDTCGICRIAFEGCCSDCKLP-----GDDCPLVWGQCSHCFHIHCIMKWLNSQQVHHQCPM 211 (220)
Q Consensus 137 ~~~~~~~~~~~~~~~~~~~~~~CaICLe~f~~~~~~~~~p-----~~~~~~~~~~CgHvFH~~CI~~WL~~~~~~~sCPv 211 (220)
+++.+++|.+++.|+|+..++.|+||++.+.+.+..+..+ ....+++.+.|||+||.+||.+||+. +.+||+
T Consensus 2 ~~~~ik~~~av~~w~~d~~~d~C~IC~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~H~FH~~Ci~~Wl~~---~~~CP~ 78 (88)
T d3dplr1 2 KRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKT---RQVCPL 78 (88)
T ss_dssp CSEEEEEEEEEEEEEESSCSCCCSSSCSCTTSCCTTHHHHTTCC---CCCEEEETTSCEEEHHHHHHHHTT---CSBCSS
T ss_pred CceEEeeEEEEEEEeecCCCCcCEEccchhhCccccccccccccccccCCeEEccccCcccHHHHHHHHHH---CCcCCC
Confidence 4678899999999999999999999999998876654332 23346677789999999999999999 899999
Q ss_pred cCccccccC
Q psy14827 212 CRQEWKFKE 220 (220)
Q Consensus 212 CR~e~~~~~ 220 (220)
||++|.||+
T Consensus 79 CR~~~~~~~ 87 (88)
T d3dplr1 79 DNREWEFQK 87 (88)
T ss_dssp SCSBCCEEE
T ss_pred CCCcccccc
Confidence 999999974
|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|