Psyllid ID: psy14916

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130
MFGSNLNSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAYHNSSQTKKDKVDLKWVGLDLLEGVVRDNKKAGVLEPAMSKIKSLKFATEAAITILRIDDMIKLDPEQQGGRSYKNAYDSGELDC
ccccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccccccccEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccc
cccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHccEEEEEEcccccccHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHcccccc
MFGSNLNSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAYhnssqtkkdkvdlkwVGLDLLEGvvrdnkkagvlepaMSKIKSLKFATEAAITILRIDdmikldpeqqggrsyknaydsgeldc
MFGSNLNSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAyhnssqtkkdkvdlkWVGLDLlegvvrdnkkagvlepamskikslkFATEAAITILRIDDmikldpeqqggrsyknaydsgeldc
MFGSNLNSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAYHNSSQTKKDKVDLKWVGLDLLEGVVRDNKKAGVLEPAMSKIKSLKFATEAAITILRIDDMIKLDPEQQGGRSYKNAYDSGELDC
***********LAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAYHN*****KDKVDLKWVGLDLLEGVVRDNKKAGVLEPAMSKIKSLKFATEAAITILRIDDMIK**********************
MFGSNLNSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAYHNSS****DKVDLKWVGLDLLEGVVRDNKKAGVLEPAMSKIKSLKFATEAAITILRIDD*************************
********REQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAY*********KVDLKWVGLDLLEGVVRDNKKAGVLEPAMSKIKSLKFATEAAITILRIDDMIKLDPEQQGGRSYKNAYDSGELDC
MFGSNLNSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAYHNSSQTKKDKVDLKWVGLDLLEGVVRDNKKAGVLEPAMSKIKSLKFATEAAITILRIDDMIKLDP*******Y**********C
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFGSNLNSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAYHNSSQTKKDKVDLKWVGLDLLEGVVRDNKKAGVLEPAMSKIKSLKFATEAAITILRIDDMIKLDPEQQGGRSYKNAYDSGELDC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query130 2.2.26 [Sep-21-2011]
P12613557 T-complex protein 1 subun yes N/A 0.984 0.229 0.804 8e-56
P11983556 T-complex protein 1 subun yes N/A 0.984 0.230 0.684 5e-46
P18279556 T-complex protein 1 subun yes N/A 0.984 0.230 0.684 6e-46
P50157173 T-complex protein 1 subun N/A N/A 0.984 0.739 0.697 7e-46
P28480556 T-complex protein 1 subun yes N/A 0.969 0.226 0.681 1e-45
Q4R5G2556 T-complex protein 1 subun N/A N/A 0.984 0.230 0.669 2e-44
P17987556 T-complex protein 1 subun yes N/A 0.984 0.230 0.669 3e-44
Q9XT06557 T-complex protein 1 subun yes N/A 0.984 0.229 0.641 3e-44
Q32L40556 T-complex protein 1 subun yes N/A 0.969 0.226 0.666 3e-44
Q9W790559 T-complex protein 1 subun N/A N/A 0.984 0.228 0.653 6e-44
>sp|P12613|TCPA_DROME T-complex protein 1 subunit alpha OS=Drosophila melanogaster GN=T-cp1 PE=2 SV=2 Back     alignment and function desciption
 Score =  214 bits (546), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 118/128 (92%)

Query: 2   FGSNLNSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAYHNSSQTKKDKVDLKW 61
           F ++L SREQLAIAEFA+SLLVIPKTL+VNAA+D+TDLVAKLR+YHNSSQTK ++ DLKW
Sbjct: 429 FATSLASREQLAIAEFAKSLLVIPKTLSVNAAKDATDLVAKLRSYHNSSQTKPERSDLKW 488

Query: 62  VGLDLLEGVVRDNKKAGVLEPAMSKIKSLKFATEAAITILRIDDMIKLDPEQQGGRSYKN 121
            GLDL+EGVVRDNKKAGVLEPAMSKIKSLKFATEAAITILRIDDMIKL+PE + G+SY +
Sbjct: 489 TGLDLIEGVVRDNKKAGVLEPAMSKIKSLKFATEAAITILRIDDMIKLNPEDKSGKSYAD 548

Query: 122 AYDSGELD 129
           A  +GELD
Sbjct: 549 ACAAGELD 556
Molecular chaperone; assists the folding of proteins upon ATP hydrolysis. Known to play a role, in vitro, in the folding of actin and tubulin.
Drosophila melanogaster (taxid: 7227)
>sp|P11983|TCPA_MOUSE T-complex protein 1 subunit alpha OS=Mus musculus GN=Tcp1 PE=1 SV=3 Back     alignment and function description
>sp|P18279|TCPA_CRIGR T-complex protein 1 subunit alpha OS=Cricetulus griseus GN=TCP1 PE=2 SV=1 Back     alignment and function description
>sp|P50157|TCPA_AMBME T-complex protein 1 subunit alpha (Fragment) OS=Ambystoma mexicanum PE=2 SV=1 Back     alignment and function description
>sp|P28480|TCPA_RAT T-complex protein 1 subunit alpha OS=Rattus norvegicus GN=Tcp1 PE=1 SV=1 Back     alignment and function description
>sp|Q4R5G2|TCPA_MACFA T-complex protein 1 subunit alpha OS=Macaca fascicularis GN=TCP1 PE=2 SV=1 Back     alignment and function description
>sp|P17987|TCPA_HUMAN T-complex protein 1 subunit alpha OS=Homo sapiens GN=TCP1 PE=1 SV=1 Back     alignment and function description
>sp|Q9XT06|TCPA_MONDO T-complex protein 1 subunit alpha OS=Monodelphis domestica GN=TCP1 PE=2 SV=1 Back     alignment and function description
>sp|Q32L40|TCPA_BOVIN T-complex protein 1 subunit alpha OS=Bos taurus GN=TCP1 PE=1 SV=1 Back     alignment and function description
>sp|Q9W790|TCPA_PALPA T-complex protein 1 subunit alpha OS=Paleosuchus palpebrosus GN=TCP1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query130
66560172 557 PREDICTED: t-complex protein 1 subunit a 0.984 0.229 0.828 3e-55
380011108 557 PREDICTED: T-complex protein 1 subunit a 0.984 0.229 0.828 3e-55
350404950 557 PREDICTED: T-complex protein 1 subunit a 0.984 0.229 0.820 7e-55
340713325 557 PREDICTED: t-complex protein 1 subunit a 0.984 0.229 0.820 8e-55
383855040 557 PREDICTED: T-complex protein 1 subunit a 0.984 0.229 0.812 1e-54
194911001 557 GG12510 [Drosophila erecta] gi|190656904 0.984 0.229 0.804 6e-54
24649027 557 Tcp1-like, isoform A [Drosophila melanog 0.984 0.229 0.804 6e-54
158534 557 T complex protein [Drosophila melanogast 0.984 0.229 0.804 7e-54
91077066 557 PREDICTED: similar to chaperonin [Tribol 0.976 0.228 0.811 7e-54
157122017 557 chaperonin [Aedes aegypti] gi|108874611| 0.984 0.229 0.804 9e-54
>gi|66560172|ref|XP_392660.2| PREDICTED: t-complex protein 1 subunit alpha-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information
 Score =  219 bits (557), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 106/128 (82%), Positives = 119/128 (92%)

Query: 2   FGSNLNSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAYHNSSQTKKDKVDLKW 61
           F ++L+SREQLAIAEFARSLLVIPKTLAVNAAQD+TDLVAKLRAYHNSSQTK D  DLKW
Sbjct: 429 FATSLSSREQLAIAEFARSLLVIPKTLAVNAAQDATDLVAKLRAYHNSSQTKADLADLKW 488

Query: 62  VGLDLLEGVVRDNKKAGVLEPAMSKIKSLKFATEAAITILRIDDMIKLDPEQQGGRSYKN 121
           VGLDLLEG ++DNKKAGVLEPA+SKIKSLKFATEAAITILRIDDMIKLDPE+   +SY++
Sbjct: 489 VGLDLLEGTIKDNKKAGVLEPAISKIKSLKFATEAAITILRIDDMIKLDPERSKDKSYRD 548

Query: 122 AYDSGELD 129
           A +SGEL+
Sbjct: 549 AMESGELE 556

Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|380011108|ref|XP_003689654.1| PREDICTED: T-complex protein 1 subunit alpha-like [Apis florea] Back     alignment and taxonomy information
>gi|350404950|ref|XP_003487270.1| PREDICTED: T-complex protein 1 subunit alpha-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340713325|ref|XP_003395195.1| PREDICTED: t-complex protein 1 subunit alpha-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|383855040|ref|XP_003703027.1| PREDICTED: T-complex protein 1 subunit alpha-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|194911001|ref|XP_001982266.1| GG12510 [Drosophila erecta] gi|190656904|gb|EDV54136.1| GG12510 [Drosophila erecta] Back     alignment and taxonomy information
>gi|24649027|ref|NP_524450.2| Tcp1-like, isoform A [Drosophila melanogaster] gi|24649029|ref|NP_732748.1| Tcp1-like, isoform B [Drosophila melanogaster] gi|195331043|ref|XP_002032212.1| GM23644 [Drosophila sechellia] gi|195572900|ref|XP_002104433.1| T-cp1 [Drosophila simulans] gi|13959710|sp|P12613.2|TCPA_DROME RecName: Full=T-complex protein 1 subunit alpha; Short=TCP-1-alpha; AltName: Full=CCT-alpha gi|7300868|gb|AAF56009.1| Tcp1-like, isoform A [Drosophila melanogaster] gi|21392182|gb|AAM48445.1| RE70560p [Drosophila melanogaster] gi|23171968|gb|AAN13906.1| Tcp1-like, isoform B [Drosophila melanogaster] gi|194121155|gb|EDW43198.1| GM23644 [Drosophila sechellia] gi|194200360|gb|EDX13936.1| T-cp1 [Drosophila simulans] Back     alignment and taxonomy information
>gi|158534|gb|AAA28927.1| T complex protein [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|91077066|ref|XP_969171.1| PREDICTED: similar to chaperonin [Tribolium castaneum] gi|270002029|gb|EEZ98476.1| hypothetical protein TcasGA2_TC000969 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|157122017|ref|XP_001659922.1| chaperonin [Aedes aegypti] gi|108874611|gb|EAT38836.1| AAEL009320-PA [Aedes aegypti] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query130
FB|FBgn0003676557 T-cp1 "Tcp1-like" [Drosophila 0.984 0.229 0.804 1.5e-49
ZFIN|ZDB-GENE-990714-24558 tcp1 "t-complex polypeptide 1" 0.984 0.229 0.713 3.5e-43
MGI|MGI:98535556 Tcp1 "t-complex protein 1" [Mu 0.984 0.230 0.684 1.1e-41
RGD|3832556 Tcp1 "t-complex 1" [Rattus nor 0.984 0.230 0.676 2.8e-41
UNIPROTKB|F1LUR8444 Tcp1-ps1 "T-complex protein 1 0.984 0.288 0.676 2.8e-41
UNIPROTKB|E2R0L9556 TCP1 "T-complex protein 1 subu 0.984 0.230 0.669 7.5e-41
UNIPROTKB|G5E531556 TCP1 "T-complex protein 1 subu 0.984 0.230 0.669 9.6e-41
UNIPROTKB|F1SB63556 TCP1 "T-complex protein 1 subu 0.984 0.230 0.669 9.6e-41
UNIPROTKB|B2ZDY6556 B2ZDY6 "T-complex protein 1 su 0.984 0.230 0.669 9.6e-41
UNIPROTKB|E7EQR6401 TCP1 "T-complex protein 1 subu 0.984 0.319 0.669 2.6e-40
FB|FBgn0003676 T-cp1 "Tcp1-like" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 516 (186.7 bits), Expect = 1.5e-49, P = 1.5e-49
 Identities = 103/128 (80%), Positives = 118/128 (92%)

Query:     2 FGSNLNSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAYHNSSQTKKDKVDLKW 61
             F ++L SREQLAIAEFA+SLLVIPKTL+VNAA+D+TDLVAKLR+YHNSSQTK ++ DLKW
Sbjct:   429 FATSLASREQLAIAEFAKSLLVIPKTLSVNAAKDATDLVAKLRSYHNSSQTKPERSDLKW 488

Query:    62 VGLDLLEGVVRDNKKAGVLEPAMSKIKSLKFATEAAITILRIDDMIKLDPEQQGGRSYKN 121
              GLDL+EGVVRDNKKAGVLEPAMSKIKSLKFATEAAITILRIDDMIKL+PE + G+SY +
Sbjct:   489 TGLDLIEGVVRDNKKAGVLEPAMSKIKSLKFATEAAITILRIDDMIKLNPEDKSGKSYAD 548

Query:   122 AYDSGELD 129
             A  +GELD
Sbjct:   549 ACAAGELD 556
GO:0005832 "chaperonin-containing T-complex" evidence=ISS
GO:0051082 "unfolded protein binding" evidence=ISS
GO:0006457 "protein folding" evidence=ISS;NAS
GO:0005524 "ATP binding" evidence=IEA;NAS
GO:0008553 "hydrogen-exporting ATPase activity, phosphorylative mechanism" evidence=NAS
GO:0005753 "mitochondrial proton-transporting ATP synthase complex" evidence=NAS
GO:0006911 "phagocytosis, engulfment" evidence=IMP
GO:0007052 "mitotic spindle organization" evidence=IMP
GO:0005875 "microtubule associated complex" evidence=IDA
ZFIN|ZDB-GENE-990714-24 tcp1 "t-complex polypeptide 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:98535 Tcp1 "t-complex protein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|3832 Tcp1 "t-complex 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LUR8 Tcp1-ps1 "T-complex protein 1 subunit alpha" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2R0L9 TCP1 "T-complex protein 1 subunit alpha" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|G5E531 TCP1 "T-complex protein 1 subunit alpha" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SB63 TCP1 "T-complex protein 1 subunit alpha" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|B2ZDY6 B2ZDY6 "T-complex protein 1 subunit alpha" [Oryctolagus cuniculus (taxid:9986)] Back     alignment and assigned GO terms
UNIPROTKB|E7EQR6 TCP1 "T-complex protein 1 subunit alpha" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P18279TCPA_CRIGRNo assigned EC number0.68460.98460.2302yesN/A
P41988TCPA_CAEELNo assigned EC number0.67820.88460.2094yesN/A
Q55BM4TCPA_DICDINo assigned EC number0.62060.88460.2098yesN/A
O94501TCPA_SCHPONo assigned EC number0.68370.86920.2032yesN/A
Q32L40TCPA_BOVINNo assigned EC number0.66660.96920.2266yesN/A
P11983TCPA_MOUSENo assigned EC number0.68460.98460.2302yesN/A
P12612TCPA_YEASTNo assigned EC number0.60340.84610.1967yesN/A
P12613TCPA_DROMENo assigned EC number0.80460.98460.2298yesN/A
P17987TCPA_HUMANNo assigned EC number0.66920.98460.2302yesN/A
P28480TCPA_RATNo assigned EC number0.68180.96920.2266yesN/A
P28769TCPA_ARATHNo assigned EC number0.65210.88460.2110yesN/A
Q9XT06TCPA_MONDONo assigned EC number0.64120.98460.2298yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
cd03335527 cd03335, TCP1_alpha, TCP-1 (CTT or eukaryotic type 1e-66
TIGR02340536 TIGR02340, chap_CCT_alpha, T-complex protein 1, al 5e-62
cd00309464 cd00309, chaperonin_type_I_II, chaperonin families 5e-34
pfam00118481 pfam00118, Cpn60_TCP1, TCP-1/cpn60 chaperonin fami 6e-27
cd03343517 cd03343, cpn60, cpn60 chaperonin family 2e-25
COG0459524 COG0459, GroL, Chaperonin GroEL (HSP60 family) [Po 3e-22
TIGR02339519 TIGR02339, thermosome_arch, thermosome, various su 6e-22
cd03340522 cd03340, TCP1_eta, TCP-1 (CTT or eukaryotic type I 2e-21
PTZ00212533 PTZ00212, PTZ00212, T-complex protein 1 subunit be 4e-21
cd03336517 cd03336, TCP1_beta, TCP-1 (CTT or eukaryotic type 2e-20
cd03341472 cd03341, TCP1_theta, TCP-1 (CTT or eukaryotic type 4e-19
TIGR02345523 TIGR02345, chap_CCT_eta, T-complex protein 1, eta 2e-17
TIGR02346531 TIGR02346, chap_CCT_theta, T-complex protein 1, th 2e-16
TIGR02341518 TIGR02341, chap_CCT_beta, T-complex protein 1, bet 6e-15
cd03337480 cd03337, TCP1_gamma, TCP-1 (CTT or eukaryotic type 8e-14
cd03339526 cd03339, TCP1_epsilon, TCP-1 (CTT or eukaryotic ty 6e-12
TIGR02344525 TIGR02344, chap_CCT_gamma, T-complex protein 1, ga 7e-12
cd03338515 cd03338, TCP1_delta, TCP-1 (CTT or eukaryotic type 4e-11
TIGR02342517 TIGR02342, chap_CCT_delta, T-complex protein 1, de 1e-10
TIGR02343532 TIGR02343, chap_CCT_epsi, T-complex protein 1, eps 8e-10
TIGR02347531 TIGR02347, chap_CCT_zeta, T-complex protein 1, zet 1e-09
cd03342484 cd03342, TCP1_zeta, TCP-1 (CTT or eukaryotic type 4e-08
>gnl|CDD|239451 cd03335, TCP1_alpha, TCP-1 (CTT or eukaryotic type II) chaperonin family, alpha subunit Back     alignment and domain information 
 Score =  209 bits (534), Expect = 1e-66
 Identities = 84/110 (76%), Positives = 96/110 (87%)

Query: 2   FGSNLNSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAYHNSSQTKKDKVDLKW 61
           F + L SREQLAIAEFA +LLVIPKTLAVNAA+D+T+LVAKLRAYH ++Q K DK  LKW
Sbjct: 418 FATTLGSREQLAIAEFAEALLVIPKTLAVNAAKDATELVAKLRAYHAAAQVKPDKKHLKW 477

Query: 62  VGLDLLEGVVRDNKKAGVLEPAMSKIKSLKFATEAAITILRIDDMIKLDP 111
            GLDL+ G VRDN +AGVLEP +SKIKSLKFATEAAITILRIDD+IKL+P
Sbjct: 478 YGLDLINGKVRDNLEAGVLEPTVSKIKSLKFATEAAITILRIDDLIKLNP 527

Chaperonins are involved in productive folding of proteins. They share a common general morphology, a double toroid of 2 stacked rings. In contrast to bacterial group I chaperonins (GroEL), each ring of the eukaryotic cytosolic chaperonin (CTT) consists of eight different, but homologous subunits. Their common function is to sequester nonnative proteins inside their central cavity and promote folding by using energy derived from ATP hydrolysis. The best studied in vivo substrates of CTT are actin and tubulin. Length = 527
>gnl|CDD|131393 TIGR02340, chap_CCT_alpha, T-complex protein 1, alpha subunit Back     alignment and domain information
>gnl|CDD|238189 cd00309, chaperonin_type_I_II, chaperonin families, type I and type II Back     alignment and domain information
>gnl|CDD|215730 pfam00118, Cpn60_TCP1, TCP-1/cpn60 chaperonin family Back     alignment and domain information
>gnl|CDD|239459 cd03343, cpn60, cpn60 chaperonin family Back     alignment and domain information
>gnl|CDD|223535 COG0459, GroL, Chaperonin GroEL (HSP60 family) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233823 TIGR02339, thermosome_arch, thermosome, various subunits, archaeal Back     alignment and domain information
>gnl|CDD|239456 cd03340, TCP1_eta, TCP-1 (CTT or eukaryotic type II) chaperonin family, eta subunit Back     alignment and domain information
>gnl|CDD|185514 PTZ00212, PTZ00212, T-complex protein 1 subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|239452 cd03336, TCP1_beta, TCP-1 (CTT or eukaryotic type II) chaperonin family, beta subunit Back     alignment and domain information
>gnl|CDD|239457 cd03341, TCP1_theta, TCP-1 (CTT or eukaryotic type II) chaperonin family, theta subunit Back     alignment and domain information
>gnl|CDD|200176 TIGR02345, chap_CCT_eta, T-complex protein 1, eta subunit Back     alignment and domain information
>gnl|CDD|233826 TIGR02346, chap_CCT_theta, T-complex protein 1, theta subunit Back     alignment and domain information
>gnl|CDD|211733 TIGR02341, chap_CCT_beta, T-complex protein 1, beta subunit Back     alignment and domain information
>gnl|CDD|239453 cd03337, TCP1_gamma, TCP-1 (CTT or eukaryotic type II) chaperonin family, gamma subunit Back     alignment and domain information
>gnl|CDD|239455 cd03339, TCP1_epsilon, TCP-1 (CTT or eukaryotic type II) chaperonin family, epsilon subunit Back     alignment and domain information
>gnl|CDD|233825 TIGR02344, chap_CCT_gamma, T-complex protein 1, gamma subunit Back     alignment and domain information
>gnl|CDD|239454 cd03338, TCP1_delta, TCP-1 (CTT or eukaryotic type II) chaperonin family, delta subunit Back     alignment and domain information
>gnl|CDD|233824 TIGR02342, chap_CCT_delta, T-complex protein 1, delta subunit Back     alignment and domain information
>gnl|CDD|131396 TIGR02343, chap_CCT_epsi, T-complex protein 1, epsilon subunit Back     alignment and domain information
>gnl|CDD|233827 TIGR02347, chap_CCT_zeta, T-complex protein 1, zeta subunit Back     alignment and domain information
>gnl|CDD|239458 cd03342, TCP1_zeta, TCP-1 (CTT or eukaryotic type II) chaperonin family, zeta subunit Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 130
cd03335527 TCP1_alpha TCP-1 (CTT or eukaryotic type II) chape 99.95
TIGR02341519 chap_CCT_beta T-complex protein 1, beta subunit. M 99.95
cd03336517 TCP1_beta TCP-1 (CTT or eukaryotic type II) chaper 99.95
TIGR02340536 chap_CCT_alpha T-complex protein 1, alpha subunit. 99.95
PTZ00212533 T-complex protein 1 subunit beta; Provisional 99.95
TIGR02347531 chap_CCT_zeta T-complex protein 1, zeta subunit. M 99.95
cd03342484 TCP1_zeta TCP-1 (CTT or eukaryotic type II) chaper 99.95
TIGR02344525 chap_CCT_gamma T-complex protein 1, gamma subunit. 99.94
TIGR02342517 chap_CCT_delta T-complex protein 1, delta subunit. 99.94
cd03340522 TCP1_eta TCP-1 (CTT or eukaryotic type II) chapero 99.94
KOG0361|consensus543 99.94
TIGR02346531 chap_CCT_theta T-complex protein 1, theta subunit. 99.94
cd03337480 TCP1_gamma TCP-1 (CTT or eukaryotic type II) chape 99.94
TIGR02345522 chap_CCT_eta T-complex protein 1, eta subunit. Mem 99.94
cd03338515 TCP1_delta TCP-1 (CTT or eukaryotic type II) chape 99.94
cd03343517 cpn60 cpn60 chaperonin family. Chaperonins are inv 99.94
cd03339526 TCP1_epsilon TCP-1 (CTT or eukaryotic type II) cha 99.94
TIGR02339519 thermosome_arch thermosome, various subunits, arch 99.93
cd03341472 TCP1_theta TCP-1 (CTT or eukaryotic type II) chape 99.93
PRK00013542 groEL chaperonin GroEL; Reviewed 99.93
PRK12852545 groEL chaperonin GroEL; Reviewed 99.93
PRK12849542 groEL chaperonin GroEL; Reviewed 99.93
TIGR02343532 chap_CCT_epsi T-complex protein 1, epsilon subunit 99.93
PRK12851541 groEL chaperonin GroEL; Reviewed 99.93
PRK12850544 groEL chaperonin GroEL; Reviewed 99.93
CHL00093529 groEL chaperonin GroEL 99.93
cd00309464 chaperonin_type_I_II chaperonin families, type I a 99.92
PTZ00114555 Heat shock protein 60; Provisional 99.92
COG0459524 GroL Chaperonin GroEL (HSP60 family) [Posttranslat 99.91
KOG0363|consensus527 99.91
TIGR02348524 GroEL chaperonin GroL. This family consists of Gro 99.91
cd03344520 GroEL GroEL_like type I chaperonin. Chaperonins ar 99.9
PRK14104546 chaperonin GroEL; Provisional 99.9
PF00118485 Cpn60_TCP1: TCP-1/cpn60 chaperonin family Chaperon 99.9
PLN03167600 Chaperonin-60 beta subunit; Provisional 99.9
KOG0358|consensus534 99.9
KOG0362|consensus537 99.87
KOG0357|consensus400 99.86
KOG0364|consensus527 99.72
KOG0359|consensus520 99.7
KOG0360|consensus545 99.69
KOG0356|consensus550 99.23
>cd03335 TCP1_alpha TCP-1 (CTT or eukaryotic type II) chaperonin family, alpha subunit Back     alignment and domain information 
Probab=99.95  E-value=5.4e-28  Score=206.36  Aligned_cols=110  Identities=76%  Similarity=1.084  Sum_probs=97.6

Q ss_pred             CCCCcchhHHHHHHHHHHHHHHHHHHHHHhcCCCHHHHHHHHHHHhhccccccccCCCcceeEEcCCCceeccccCCccc
Q psy14916          2 FGSNLNSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAYHNSSQTKKDKVDLKWVGLDLLEGVVRDNKKAGVLE   81 (130)
Q Consensus         2 ~a~~~~g~eq~~i~~fa~ALe~IP~~LaeNaG~d~~~vl~kL~~~h~~~~~~~~~~~~~~~Gid~~~g~i~d~~~~gI~d   81 (130)
                      |+++++|++++++++|++||++||++||+|||+|+.+++.+|++.|.++..+..+.+.+++|||+.+|++.||++.||||
T Consensus       418 ~~~~~~~~~~~~i~~~a~aL~~ip~~La~NaG~d~~~~~~~l~~~h~~~~~~~~~~~~~~~Gid~~~g~~~d~~~~gV~d  497 (527)
T cd03335         418 FATTLGSREQLAIAEFAEALLVIPKTLAVNAAKDATELVAKLRAYHAAAQVKPDKKHLKWYGLDLINGKVRDNLEAGVLE  497 (527)
T ss_pred             HHhccCcHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHhcCCccccccCceEeEECCCCcccchhhcccee
Confidence            56778999999999999999999999999999999999999999997753111111235799999999999999999999


Q ss_pred             cHHHHHHHHHHHHHHHHHHHhHHHHhhcCC
Q psy14916         82 PAMSKIKSLKFATEAAITILRIDDMIKLDP  111 (130)
Q Consensus        82 p~~vK~~~i~~A~e~a~~iLrID~iI~~~~  111 (130)
                      |+.||+++|++|+|+|+||||||++|+.+|
T Consensus       498 p~~~k~~~i~~A~e~a~~iLrID~ii~~~~  527 (527)
T cd03335         498 PTVSKIKSLKFATEAAITILRIDDLIKLNP  527 (527)
T ss_pred             cHHHHHHHHHHHHHHHHHHHhhcceeecCC
Confidence            999999999999999999999999998765

Chaperonins are involved in productive folding of proteins. They share a common general morphology, a double toroid of 2 stacked rings. In contrast to bacterial group I chaperonins (GroEL), each ring of the eukaryotic cytosolic chaperonin (CTT) consists of eight different, but homologous subunits. Their common function is to sequester nonnative proteins inside their central cavity and promote folding by using energy derived from ATP hydrolysis. The best studied in vivo substrates of CTT are actin and tubulin.
>TIGR02341 chap_CCT_beta T-complex protein 1, beta subunit Back     alignment and domain information
>cd03336 TCP1_beta TCP-1 (CTT or eukaryotic type II) chaperonin family, beta subunit Back     alignment and domain information
>TIGR02340 chap_CCT_alpha T-complex protein 1, alpha subunit Back     alignment and domain information
>PTZ00212 T-complex protein 1 subunit beta; Provisional Back     alignment and domain information
>TIGR02347 chap_CCT_zeta T-complex protein 1, zeta subunit Back     alignment and domain information
>cd03342 TCP1_zeta TCP-1 (CTT or eukaryotic type II) chaperonin family, zeta subunit Back     alignment and domain information
>TIGR02344 chap_CCT_gamma T-complex protein 1, gamma subunit Back     alignment and domain information
>TIGR02342 chap_CCT_delta T-complex protein 1, delta subunit Back     alignment and domain information
>cd03340 TCP1_eta TCP-1 (CTT or eukaryotic type II) chaperonin family, eta subunit Back     alignment and domain information
>KOG0361|consensus Back     alignment and domain information
>TIGR02346 chap_CCT_theta T-complex protein 1, theta subunit Back     alignment and domain information
>cd03337 TCP1_gamma TCP-1 (CTT or eukaryotic type II) chaperonin family, gamma subunit Back     alignment and domain information
>TIGR02345 chap_CCT_eta T-complex protein 1, eta subunit Back     alignment and domain information
>cd03338 TCP1_delta TCP-1 (CTT or eukaryotic type II) chaperonin family, delta subunit Back     alignment and domain information
>cd03343 cpn60 cpn60 chaperonin family Back     alignment and domain information
>cd03339 TCP1_epsilon TCP-1 (CTT or eukaryotic type II) chaperonin family, epsilon subunit Back     alignment and domain information
>TIGR02339 thermosome_arch thermosome, various subunits, archaeal Back     alignment and domain information
>cd03341 TCP1_theta TCP-1 (CTT or eukaryotic type II) chaperonin family, theta subunit Back     alignment and domain information
>PRK00013 groEL chaperonin GroEL; Reviewed Back     alignment and domain information
>PRK12852 groEL chaperonin GroEL; Reviewed Back     alignment and domain information
>PRK12849 groEL chaperonin GroEL; Reviewed Back     alignment and domain information
>TIGR02343 chap_CCT_epsi T-complex protein 1, epsilon subunit Back     alignment and domain information
>PRK12851 groEL chaperonin GroEL; Reviewed Back     alignment and domain information
>PRK12850 groEL chaperonin GroEL; Reviewed Back     alignment and domain information
>CHL00093 groEL chaperonin GroEL Back     alignment and domain information
>cd00309 chaperonin_type_I_II chaperonin families, type I and type II Back     alignment and domain information
>PTZ00114 Heat shock protein 60; Provisional Back     alignment and domain information
>COG0459 GroL Chaperonin GroEL (HSP60 family) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0363|consensus Back     alignment and domain information
>TIGR02348 GroEL chaperonin GroL Back     alignment and domain information
>cd03344 GroEL GroEL_like type I chaperonin Back     alignment and domain information
>PRK14104 chaperonin GroEL; Provisional Back     alignment and domain information
>PF00118 Cpn60_TCP1: TCP-1/cpn60 chaperonin family Chaperonins cpn60 signature Chaperonins TCP-1 signatures 60 kd chaperonin signature; InterPro: IPR002423 Partially folded polypeptide chains, either newly made by ribosomes or emerging from mature proteins unfolded by stress, run the risk of aggregating with one another to the detriment of the organism Back     alignment and domain information
>PLN03167 Chaperonin-60 beta subunit; Provisional Back     alignment and domain information
>KOG0358|consensus Back     alignment and domain information
>KOG0362|consensus Back     alignment and domain information
>KOG0357|consensus Back     alignment and domain information
>KOG0364|consensus Back     alignment and domain information
>KOG0359|consensus Back     alignment and domain information
>KOG0360|consensus Back     alignment and domain information
>KOG0356|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
3iyg_A529 Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGST 2e-43
3p9d_A559 The Crystal Structure Of Yeast Cct Reveals Intrinsi 5e-32
3iyf_A521 Atomic Model Of The Lidless Mm-Cpn In The Open Stat 4e-15
3rus_A543 Crystal Structure Of Cpn-Rls In Complex With Adp Fr 4e-15
3izk_A491 Mm-Cpn Rls Deltalid With Atp Length = 491 4e-15
3izn_A491 Mm-Cpn Deltalid With Atp Length = 491 4e-15
3izi_A513 Mm-Cpn Rls With Atp Length = 513 4e-15
3los_A543 Atomic Model Of Mm-Cpn In The Closed State Length = 4e-15
3izh_A513 Mm-Cpn D386a With Atp Length = 513 5e-15
3j02_A491 Lidless D386a Mm-Cpn In The Pre-Hydrolysis Atp-Boun 5e-15
1a6d_B543 Thermosome From T. Acidophilum Length = 543 2e-14
3ko1_A553 Cystal Structure Of Thermosome From Acidianus Tengc 2e-14
1q3r_A548 Crystal Structure Of The Chaperonin From Thermococc 4e-14
1q2v_A548 Crystal Structure Of The Chaperonin From Thermococc 4e-14
1q3s_A548 Crystal Structure Of The Chaperonin From Thermococc 5e-14
3aq1_B500 Open State Monomer Of A Group Ii Chaperonin From Me 9e-14
3iyg_H515 Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGST 5e-13
1a6d_A545 Thermosome From T. Acidophilum Length = 545 9e-13
3iyg_B513 Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGST 1e-12
3iyg_Q512 Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGST 1e-11
3p9d_B527 The Crystal Structure Of Yeast Cct Reveals Intrinsi 5e-11
3p9d_G550 The Crystal Structure Of Yeast Cct Reveals Intrinsi 1e-10
3p9d_H568 The Crystal Structure Of Yeast Cct Reveals Intrinsi 4e-09
3iyg_G515 Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGST 9e-09
3iyg_D518 Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGST 1e-07
3p9d_C590 The Crystal Structure Of Yeast Cct Reveals Intrinsi 3e-07
3p9d_D528 The Crystal Structure Of Yeast Cct Reveals Intrinsi 7e-07
3iyg_Z517 Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGST 2e-06
3iyg_E515 Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGST 6e-05
3p9d_E562 The Crystal Structure Of Yeast Cct Reveals Intrinsi 1e-04
3p9d_F546 The Crystal Structure Of Yeast Cct Reveals Intrinsi 8e-04
>pdb|3IYG|A Chain A, Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGSTROM Cryo-Em Map Length = 529 Back     alignment and structure 
Iteration: 1

 Score =  170 bits (430), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 80/110 (72%), Positives = 95/110 (86%)
Query: 2   FGSNLNSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAYHNSSQTKKDKVDLKW 61
           + +++ SREQLAIAEFARSLLVIP TLAVNAAQDSTDLVAKLRA+HN +Q   ++ +LKW
Sbjct: 420 YATSMGSREQLAIAEFARSLLVIPNTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKW 479
Query: 62  VGLDLLEGVVRDNKKAGVLEPAMSKIKSLKFATEAAITILRIDDMIKLDP 111
           +GLDL+ G  RDNK+AGV EP + K+KSLKFATEAAITILRIDD+IKL P
Sbjct: 480 IGLDLVNGKPRDNKQAGVFEPTIVKVKSLKFATEAAITILRIDDLIKLHP 529
>pdb|3P9D|A Chain A, The Crystal Structure Of Yeast Cct Reveals Intrinsic Asymmetry Of Eukaryotic Cytosolic Chaperonins Length = 559 Back     alignment and structure
>pdb|3IYF|A Chain A, Atomic Model Of The Lidless Mm-Cpn In The Open State Length = 521 Back     alignment and structure
>pdb|3RUS|A Chain A, Crystal Structure Of Cpn-Rls In Complex With Adp From Methanococcus Maripaludis Length = 543 Back     alignment and structure
>pdb|3IZK|A Chain A, Mm-Cpn Rls Deltalid With Atp Length = 491 Back     alignment and structure
>pdb|3IZN|A Chain A, Mm-Cpn Deltalid With Atp Length = 491 Back     alignment and structure
>pdb|3IZI|A Chain A, Mm-Cpn Rls With Atp Length = 513 Back     alignment and structure
>pdb|3LOS|A Chain A, Atomic Model Of Mm-Cpn In The Closed State Length = 543 Back     alignment and structure
>pdb|3IZH|A Chain A, Mm-Cpn D386a With Atp Length = 513 Back     alignment and structure
>pdb|3J02|A Chain A, Lidless D386a Mm-Cpn In The Pre-Hydrolysis Atp-Bound State Length = 491 Back     alignment and structure
>pdb|1A6D|B Chain B, Thermosome From T. Acidophilum Length = 543 Back     alignment and structure
>pdb|3KO1|A Chain A, Cystal Structure Of Thermosome From Acidianus Tengchongensis Strain S5 Length = 553 Back     alignment and structure
>pdb|1Q3R|A Chain A, Crystal Structure Of The Chaperonin From Thermococcus Strain Ks-1 (Nucleotide-Free Form Of Single Mutant) Length = 548 Back     alignment and structure
>pdb|1Q2V|A Chain A, Crystal Structure Of The Chaperonin From Thermococcus Strain Ks-1 (Nucleotide-Free Form) Length = 548 Back     alignment and structure
>pdb|1Q3S|A Chain A, Crystal Structure Of The Chaperonin From Thermococcus Strain Ks-1 (Formiii Crystal Complexed With Adp) Length = 548 Back     alignment and structure
>pdb|3AQ1|B Chain B, Open State Monomer Of A Group Ii Chaperonin From Methanococcoides Burtonii Length = 500 Back     alignment and structure
>pdb|3IYG|H Chain H, Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGSTROM Cryo-Em Map Length = 515 Back     alignment and structure
>pdb|1A6D|A Chain A, Thermosome From T. Acidophilum Length = 545 Back     alignment and structure
>pdb|3IYG|B Chain B, Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGSTROM Cryo-Em Map Length = 513 Back     alignment and structure
>pdb|3IYG|Q Chain Q, Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGSTROM Cryo-Em Map Length = 512 Back     alignment and structure
>pdb|3P9D|B Chain B, The Crystal Structure Of Yeast Cct Reveals Intrinsic Asymmetry Of Eukaryotic Cytosolic Chaperonins Length = 527 Back     alignment and structure
>pdb|3P9D|G Chain G, The Crystal Structure Of Yeast Cct Reveals Intrinsic Asymmetry Of Eukaryotic Cytosolic Chaperonins Length = 550 Back     alignment and structure
>pdb|3P9D|H Chain H, The Crystal Structure Of Yeast Cct Reveals Intrinsic Asymmetry Of Eukaryotic Cytosolic Chaperonins Length = 568 Back     alignment and structure
>pdb|3IYG|G Chain G, Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGSTROM Cryo-Em Map Length = 515 Back     alignment and structure
>pdb|3IYG|D Chain D, Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGSTROM Cryo-Em Map Length = 518 Back     alignment and structure
>pdb|3P9D|C Chain C, The Crystal Structure Of Yeast Cct Reveals Intrinsic Asymmetry Of Eukaryotic Cytosolic Chaperonins Length = 590 Back     alignment and structure
>pdb|3P9D|D Chain D, The Crystal Structure Of Yeast Cct Reveals Intrinsic Asymmetry Of Eukaryotic Cytosolic Chaperonins Length = 528 Back     alignment and structure
>pdb|3IYG|Z Chain Z, Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGSTROM Cryo-Em Map Length = 517 Back     alignment and structure
>pdb|3IYG|E Chain E, Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGSTROM Cryo-Em Map Length = 515 Back     alignment and structure
>pdb|3P9D|E Chain E, The Crystal Structure Of Yeast Cct Reveals Intrinsic Asymmetry Of Eukaryotic Cytosolic Chaperonins Length = 562 Back     alignment and structure
>pdb|3P9D|F Chain F, The Crystal Structure Of Yeast Cct Reveals Intrinsic Asymmetry Of Eukaryotic Cytosolic Chaperonins Length = 546 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
3iyg_A529 T-complex protein 1 subunit alpha; TRIC/CCT, asymm 3e-47
3p9d_A559 T-complex protein 1 subunit alpha; HSP60, eukaryot 2e-45
3aq1_B500 Thermosome subunit; group II chaperonin, protein f 7e-45
1a6d_B543 Thermosome (beta subunit); group II chaperonin, CC 1e-44
3ruv_A543 Chaperonin, CPN; double-ring, protein folding mach 4e-44
1a6d_A545 Thermosome (alpha subunit); group II chaperonin, C 6e-44
3ko1_A553 Chaperonin; 9-fold symmetry, double ring, ATP hydr 6e-44
3p9d_G550 T-complex protein 1 subunit ETA; HSP60, eukaryotic 6e-44
1q3q_A548 Thermosome alpha subunit; chaperone, chaperonin; H 2e-43
3p9d_B527 T-complex protein 1 subunit beta; HSP60, eukaryoti 2e-43
3iyg_B513 T-complex protein 1 subunit beta; TRIC/CCT, asymme 1e-42
3p9d_H568 T-complex protein 1 subunit theta; HSP60, eukaryot 2e-42
3p9d_F546 T-complex protein 1 subunit zeta; HSP60, eukaryoti 3e-42
3p9d_E562 T-complex protein 1 subunit epsilon; HSP60, eukary 8e-42
3iyg_G515 T-complex protein 1 subunit gamma; TRIC/CCT, asymm 1e-41
3iyg_H515 T-complex protein 1 subunit ETA; TRIC/CCT, asymmet 2e-41
3iyg_E515 T-complex protein 1 subunit; TRIC/CCT, asymmetric, 2e-41
3iyg_D518 T-complex protein 1 subunit delta; TRIC/CCT, asymm 2e-41
3p9d_D528 T-complex protein 1 subunit delta; HSP60, eukaryot 5e-41
3iyg_Z517 T-complex protein 1 subunit zeta; TRIC/CCT, asymme 4e-40
3iyg_Q512 T-complex protein 1 subunit theta; TRIC/CCT, asymm 5e-39
3p9d_C590 T-complex protein 1 subunit gamma; HSP60, eukaryot 2e-36
>3iyg_A T-complex protein 1 subunit alpha; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 529 Back     alignment and structure
 Score =  158 bits (401), Expect = 3e-47
 Identities = 80/110 (72%), Positives = 95/110 (86%)

Query: 2   FGSNLNSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAYHNSSQTKKDKVDLKW 61
           + +++ SREQLAIAEFARSLLVIP TLAVNAAQDSTDLVAKLRA+HN +Q   ++ +LKW
Sbjct: 420 YATSMGSREQLAIAEFARSLLVIPNTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKW 479

Query: 62  VGLDLLEGVVRDNKKAGVLEPAMSKIKSLKFATEAAITILRIDDMIKLDP 111
           +GLDL+ G  RDNK+AGV EP + K+KSLKFATEAAITILRIDD+IKL P
Sbjct: 480 IGLDLVNGKPRDNKQAGVFEPTIVKVKSLKFATEAAITILRIDDLIKLHP 529
>3p9d_A T-complex protein 1 subunit alpha; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_a* Length = 559 Back     alignment and structure
>3aq1_B Thermosome subunit; group II chaperonin, protein folding, chaperone; 2.75A {Methanococcoides burtonii} Length = 500 Back     alignment and structure
>1a6d_B Thermosome (beta subunit); group II chaperonin, CCT, TRIC, PR folding, ATPase, chaperonin; 2.60A {Thermoplasma acidophilum} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1a6e_B* 1e0r_B Length = 543 Back     alignment and structure
>3ruv_A Chaperonin, CPN; double-ring, protein folding machinery, group II chaperonin, binding, chaperone; HET: ANP; 2.24A {Methanococcus maripaludis} PDB: 3rus_A* 3ruw_A* 3ruq_A* 3los_A 3kfb_A* 3izi_A 3izj_A 3izm_A 3izh_A 3kfe_A* 3iyf_A* 3kfk_A* 3izk_A 3izl_A 3j03_A 3izn_A 3j02_A Length = 543 Back     alignment and structure
>1a6d_A Thermosome (alpha subunit); group II chaperonin, CCT, TRIC, PR folding, ATPase, chaperonin; 2.60A {Thermoplasma acidophilum} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1a6e_A* Length = 545 Back     alignment and structure
>3ko1_A Chaperonin; 9-fold symmetry, double ring, ATP hydrolase, chaperone, NUCL binding; HET: ADP; 3.70A {Acidianus tengchongensis} Length = 553 Back     alignment and structure
>3p9d_G T-complex protein 1 subunit ETA; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_g* Length = 550 Back     alignment and structure
>1q3q_A Thermosome alpha subunit; chaperone, chaperonin; HET: ANP; 2.30A {Thermococcus SP} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1q2v_A* 1q3s_A* 1q3r_A Length = 548 Back     alignment and structure
>3p9d_B T-complex protein 1 subunit beta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_b* Length = 527 Back     alignment and structure
>3iyg_B T-complex protein 1 subunit beta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} PDB: 3ktt_B 4a0o_A 4a0v_A 4a0w_A 4a13_A Length = 513 Back     alignment and structure
>3p9d_H T-complex protein 1 subunit theta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_h* Length = 568 Back     alignment and structure
>3p9d_F T-complex protein 1 subunit zeta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_f* Length = 546 Back     alignment and structure
>3p9d_E T-complex protein 1 subunit epsilon; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_e* Length = 562 Back     alignment and structure
>3iyg_G T-complex protein 1 subunit gamma; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 515 Back     alignment and structure
>3iyg_H T-complex protein 1 subunit ETA; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 515 Back     alignment and structure
>3iyg_E T-complex protein 1 subunit; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 515 Back     alignment and structure
>3iyg_D T-complex protein 1 subunit delta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 518 Back     alignment and structure
>3p9d_D T-complex protein 1 subunit delta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_d* Length = 528 Back     alignment and structure
>3iyg_Z T-complex protein 1 subunit zeta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 517 Back     alignment and structure
>3iyg_Q T-complex protein 1 subunit theta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Length = 512 Back     alignment and structure
>3p9d_C T-complex protein 1 subunit gamma; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_c* 2bbm_B 2bbn_B Length = 590 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query130
3iyg_A529 T-complex protein 1 subunit alpha; TRIC/CCT, asymm 99.96
3iyg_B513 T-complex protein 1 subunit beta; TRIC/CCT, asymme 99.96
3iyg_Z517 T-complex protein 1 subunit zeta; TRIC/CCT, asymme 99.96
3iyg_G515 T-complex protein 1 subunit gamma; TRIC/CCT, asymm 99.96
3iyg_H515 T-complex protein 1 subunit ETA; TRIC/CCT, asymmet 99.96
3p9d_F546 T-complex protein 1 subunit zeta; HSP60, eukaryoti 99.96
3iyg_D518 T-complex protein 1 subunit delta; TRIC/CCT, asymm 99.96
3ruv_A543 Chaperonin, CPN; double-ring, protein folding mach 99.96
3iyg_Q512 T-complex protein 1 subunit theta; TRIC/CCT, asymm 99.95
3p9d_A559 T-complex protein 1 subunit alpha; HSP60, eukaryot 99.95
3ko1_A553 Chaperonin; 9-fold symmetry, double ring, ATP hydr 99.95
3iyg_E515 T-complex protein 1 subunit; TRIC/CCT, asymmetric, 99.95
3aq1_B500 Thermosome subunit; group II chaperonin, protein f 99.95
3p9d_B527 T-complex protein 1 subunit beta; HSP60, eukaryoti 99.95
3p9d_G550 T-complex protein 1 subunit ETA; HSP60, eukaryotic 99.95
3p9d_E562 T-complex protein 1 subunit epsilon; HSP60, eukary 99.95
3p9d_D528 T-complex protein 1 subunit delta; HSP60, eukaryot 99.95
1a6d_B543 Thermosome (beta subunit); group II chaperonin, CC 99.95
3p9d_C590 T-complex protein 1 subunit gamma; HSP60, eukaryot 99.94
1q3q_A548 Thermosome alpha subunit; chaperone, chaperonin; H 99.94
1a6d_A545 Thermosome (alpha subunit); group II chaperonin, C 99.94
3p9d_H568 T-complex protein 1 subunit theta; HSP60, eukaryot 99.94
1we3_A543 CPN60(groel); chaperonin, chaperone, groel, HSP60, 99.94
3rtk_A546 60 kDa chaperonin 2; heat shock protein, chaperone 99.93
1iok_A545 Chaperonin 60; chaperone; 3.20A {Paracoccus denitr 99.93
1kp8_A547 Groel protein; chaperonin, assisted protein foldin 99.92
>3iyg_A T-complex protein 1 subunit alpha; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Back     alignment and structure
Probab=99.96  E-value=2.5e-30  Score=219.82  Aligned_cols=110  Identities=73%  Similarity=1.080  Sum_probs=97.8

Q ss_pred             CCCCcchhHHHHHHHHHHHHHHHHHHHHHhcCCCHHHHHHHHHHHhhccccccccCCCcceeEEcCCCceeccccCCccc
Q psy14916          2 FGSNLNSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAYHNSSQTKKDKVDLKWVGLDLLEGVVRDNKKAGVLE   81 (130)
Q Consensus         2 ~a~~~~g~eq~~i~~fa~ALe~IP~~LaeNaG~d~~~vl~kL~~~h~~~~~~~~~~~~~~~Gid~~~g~i~d~~~~gI~d   81 (130)
                      |+++++|++|+++++||+|||+||++||+|||+|+.+++.+|++.|.++..+..+.++.++|||+.+|++.||++.||||
T Consensus       420 ~~~~~~g~eq~~i~~fa~ALe~ip~~La~NaG~d~~~~v~~l~~~h~~~~~~~~~~~~~~~G~d~~~g~~~d~~~~gV~d  499 (529)
T 3iyg_A          420 YATSMGSREQLAIAEFARSLLVIPNTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKWIGLDLVNGKPRDNKQAGVFE  499 (529)
T ss_pred             HhhhcCChHHHHHHHHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHhccccccccccCceeeeeCCCCCccChhhccCEe
Confidence            57788999999999999999999999999999999999999999997653111112235799999999999999999999


Q ss_pred             cHHHHHHHHHHHHHHHHHHHhHHHHhhcCC
Q psy14916         82 PAMSKIKSLKFATEAAITILRIDDMIKLDP  111 (130)
Q Consensus        82 p~~vK~~~i~~A~e~a~~iLrID~iI~~~~  111 (130)
                      |+.||+|+|++|+|+|+||||||+||+..|
T Consensus       500 p~~vk~~al~~A~e~a~~iL~iD~ii~~~~  529 (529)
T 3iyg_A          500 PTIVKVKSLKFATEAAITILRIDDLIKLHP  529 (529)
T ss_pred             cHHHHHHHHHHHHHHHHHHHhHHhhhcCCC
Confidence            999999999999999999999999998743
>3iyg_B T-complex protein 1 subunit beta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} PDB: 3ktt_B 4a0o_A 4a0v_A 4a0w_A 4a13_A Back     alignment and structure
>3iyg_Z T-complex protein 1 subunit zeta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Back     alignment and structure
>3iyg_G T-complex protein 1 subunit gamma; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Back     alignment and structure
>3iyg_H T-complex protein 1 subunit ETA; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Back     alignment and structure
>3p9d_F T-complex protein 1 subunit zeta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_f* 4d8q_F* 4d8r_f* Back     alignment and structure
>3iyg_D T-complex protein 1 subunit delta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Back     alignment and structure
>3ruv_A Chaperonin, CPN; double-ring, protein folding machinery, group II chaperonin, binding, chaperone; HET: ANP; 2.24A {Methanococcus maripaludis} PDB: 3rus_A* 3ruw_A* 3ruq_A* 3los_A 3kfb_A* 3izi_A 3izj_A 3izm_A 3izh_A 3kfe_A* 3iyf_A* 3kfk_A* 3izk_A 3izl_A 3j03_A 3izn_A 3j02_A Back     alignment and structure
>3iyg_Q T-complex protein 1 subunit theta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Back     alignment and structure
>3p9d_A T-complex protein 1 subunit alpha; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_a* 4d8q_A* 4d8r_a* Back     alignment and structure
>3ko1_A Chaperonin; 9-fold symmetry, double ring, ATP hydrolase, chaperone, NUCL binding; HET: ADP; 3.70A {Acidianus tengchongensis} Back     alignment and structure
>3iyg_E T-complex protein 1 subunit; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Back     alignment and structure
>3aq1_B Thermosome subunit; group II chaperonin, protein folding, chaperone; 2.75A {Methanococcoides burtonii} Back     alignment and structure
>3p9d_B T-complex protein 1 subunit beta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_b* 4d8q_B* 4d8r_b* Back     alignment and structure
>3p9d_G T-complex protein 1 subunit ETA; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_g* 4d8q_G* 4d8r_g* Back     alignment and structure
>3p9d_E T-complex protein 1 subunit epsilon; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_e* 4d8q_E* 4d8r_e* Back     alignment and structure
>3p9d_D T-complex protein 1 subunit delta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_d* 4d8q_D* 4d8r_d* Back     alignment and structure
>1a6d_B Thermosome (beta subunit); group II chaperonin, CCT, TRIC, PR folding, ATPase, chaperonin; 2.60A {Thermoplasma acidophilum} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1a6e_B* 1e0r_B Back     alignment and structure
>3p9d_C T-complex protein 1 subunit gamma; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_c* 4d8q_C* 4d8r_c* 2bbm_B 2bbn_B Back     alignment and structure
>1q3q_A Thermosome alpha subunit; chaperone, chaperonin; HET: ANP; 2.30A {Thermococcus SP} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1q2v_A* 1q3s_A* 1q3r_A Back     alignment and structure
>1a6d_A Thermosome (alpha subunit); group II chaperonin, CCT, TRIC, PR folding, ATPase, chaperonin; 2.60A {Thermoplasma acidophilum} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1a6e_A* Back     alignment and structure
>3p9d_H T-complex protein 1 subunit theta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_h* 4d8q_H* 4d8r_h* Back     alignment and structure
>1we3_A CPN60(groel); chaperonin, chaperone, groel, HSP60, HSP10, folding, ADP, ATP; HET: ADP; 2.80A {Thermus thermophilus} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 PDB: 1wf4_a* Back     alignment and structure
>3rtk_A 60 kDa chaperonin 2; heat shock protein, chaperone; 2.80A {Mycobacterium tuberculosis} PDB: 1sjp_A Back     alignment and structure
>1iok_A Chaperonin 60; chaperone; 3.20A {Paracoccus denitrificans} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 Back     alignment and structure
>1kp8_A Groel protein; chaperonin, assisted protein folding, chaperone; HET: ATP; 2.00A {Escherichia coli} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 PDB: 1gr5_A 2c7e_A* 1grl_A 1oel_A 1xck_A 1gru_A 1mnf_A 1aon_A 2c7c_A 2c7d_A 2cgt_A 2nwc_A 3e76_A* 2eu1_A 1j4z_A 1kpo_O 1sx3_A* 3c9v_A 1ss8_A 3cau_A ... Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 130
d1a6db1243 a.129.1.2 (B:20-144,B:404-521) Thermosome, E domai 2e-25
d1a6da1245 a.129.1.2 (A:17-145,A:404-519) Thermosome, E domai 1e-24
d1q3qa1258 a.129.1.2 (A:9-145,A:406-526) Thermosome, E domain 1e-14
d1we3a1255 a.129.1.1 (A:3-138,A:409-527) GroEL, E domain {The 2e-11
d1sjpa1180 a.129.1.1 (A:62-134,A:408-514) GroEL, E domain {My 0.002
>d1a6db1 a.129.1.2 (B:20-144,B:404-521) Thermosome, E domain {Archaeon Thermoplasma acidophilum, beta chain [TaxId: 2303]} Length = 243 Back     information, alignment and structure

class: All alpha proteins
fold: GroEL equatorial domain-like
superfamily: GroEL equatorial domain-like
family: Group II chaperonin (CCT, TRIC), ATPase domain
domain: Thermosome, E domain
species: Archaeon Thermoplasma acidophilum, beta chain [TaxId: 2303]

 Score = 94.0 bits (233), Expect = 2e-25
 Identities = 42/107 (39%), Positives = 61/107 (57%), Gaps = 8/107 (7%)

Query: 1   MFGSNLNSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAYHNSSQTKKDKVDLK 60
            +   +  R+QLAI +FA ++  IP+ LA NA  D  D++ KLRA H            K
Sbjct: 144 SYAQKIGGRQQLAIEKFADAIEEIPRALAENAGLDPIDILLKLRAEHAKGN--------K 195

Query: 61  WVGLDLLEGVVRDNKKAGVLEPAMSKIKSLKFATEAAITILRIDDMI 107
             G+++  G + D  K GV+EP     ++++ ATEAAI ILRIDD+I
Sbjct: 196 TYGINVFTGEIEDMVKNGVIEPIRVGKQAIESATEAAIMILRIDDVI 242
>d1a6da1 a.129.1.2 (A:17-145,A:404-519) Thermosome, E domain {Archaeon Thermoplasma acidophilum, alpha chain [TaxId: 2303]} Length = 245 Back     information, alignment and structure
>d1q3qa1 a.129.1.2 (A:9-145,A:406-526) Thermosome, E domain {Archaeon Thermococcus sp. ks-1, alpha chain [TaxId: 79679]} Length = 258 Back     information, alignment and structure
>d1we3a1 a.129.1.1 (A:3-138,A:409-527) GroEL, E domain {Thermus thermophilus [TaxId: 274]} Length = 255 Back     information, alignment and structure
>d1sjpa1 a.129.1.1 (A:62-134,A:408-514) GroEL, E domain {Mycobacterium tuberculosis, GroEL2 [TaxId: 1773]} Length = 180 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query130
d1a6db1243 Thermosome, E domain {Archaeon Thermoplasma acidop 99.96
d1a6da1245 Thermosome, E domain {Archaeon Thermoplasma acidop 99.93
d1q3qa1258 Thermosome, E domain {Archaeon Thermococcus sp. ks 99.86
d1sjpa1180 GroEL, E domain {Mycobacterium tuberculosis, GroEL 99.85
d1we3a1255 GroEL, E domain {Thermus thermophilus [TaxId: 274] 99.81
d1ioka1252 GroEL, E domain {Paracoccus denitrificans [TaxId: 99.56
d1kp8a1252 GroEL, E domain {Escherichia coli [TaxId: 562]} 99.36
>d1a6db1 a.129.1.2 (B:20-144,B:404-521) Thermosome, E domain {Archaeon Thermoplasma acidophilum, beta chain [TaxId: 2303]} Back     information, alignment and structure
class: All alpha proteins
fold: GroEL equatorial domain-like
superfamily: GroEL equatorial domain-like
family: Group II chaperonin (CCT, TRIC), ATPase domain
domain: Thermosome, E domain
species: Archaeon Thermoplasma acidophilum, beta chain [TaxId: 2303]

Probab=99.96  E-value=6.4e-30  Score=197.28  Aligned_cols=98  Identities=43%  Similarity=0.634  Sum_probs=93.4

Q ss_pred             CCCCcchhHHHHHHHHHHHHHHHHHHHHHhcCCCHHHHHHHHHHHhhccccccccCCCcceeEEcCCCceeccccCCccc
Q psy14916          2 FGSNLNSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAYHNSSQTKKDKVDLKWVGLDLLEGVVRDNKKAGVLE   81 (130)
Q Consensus         2 ~a~~~~g~eq~~i~~fa~ALe~IP~~LaeNaG~d~~~vl~kL~~~h~~~~~~~~~~~~~~~Gid~~~g~i~d~~~~gI~d   81 (130)
                      |+++++|++|+++++|++||+.||++||+|||+|+.+++.+|+..|.++        +.++|+|+.+|.+.||.+.||||
T Consensus       145 ~a~~~~g~~q~~i~~~a~Ale~ip~~LaeNaG~d~~~~i~~l~~~h~~~--------~~~~Gvd~~~g~i~d~~~~gV~d  216 (243)
T d1a6db1         145 YAQKIGGRQQLAIEKFADAIEEIPRALAENAGLDPIDILLKLRAEHAKG--------NKTYGINVFTGEIEDMVKNGVIE  216 (243)
T ss_dssp             HHHHTCSSHHHHHHHHHHHHTHHHHHHHHHHTCCHHHHHHHHHHHHHTT--------CTTEEEETTTTEEEETTTTTCEE
T ss_pred             hhhccCCHHHHHHHHHHHHhhccCccccccCCCChhHHHHHHHHHHhCC--------CCceeEECcCCEEeehHhcccEe
Confidence            4678899999999999999999999999999999999999999999765        36899999999999999999999


Q ss_pred             cHHHHHHHHHHHHHHHHHHHhHHHHh
Q psy14916         82 PAMSKIKSLKFATEAAITILRIDDMI  107 (130)
Q Consensus        82 p~~vK~~~i~~A~e~a~~iLrID~iI  107 (130)
                      |+.||+|+|++|+|+|++|||||+||
T Consensus       217 p~~vk~~ai~~A~e~a~~iL~iD~ii  242 (243)
T d1a6db1         217 PIRVGKQAIESATEAAIMILRIDDVI  242 (243)
T ss_dssp             EHHHHHHHHHHHHHHHHHHHHEEEEE
T ss_pred             cHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            99999999999999999999999987
>d1a6da1 a.129.1.2 (A:17-145,A:404-519) Thermosome, E domain {Archaeon Thermoplasma acidophilum, alpha chain [TaxId: 2303]} Back     information, alignment and structure
>d1q3qa1 a.129.1.2 (A:9-145,A:406-526) Thermosome, E domain {Archaeon Thermococcus sp. ks-1, alpha chain [TaxId: 79679]} Back     information, alignment and structure
>d1sjpa1 a.129.1.1 (A:62-134,A:408-514) GroEL, E domain {Mycobacterium tuberculosis, GroEL2 [TaxId: 1773]} Back     information, alignment and structure
>d1we3a1 a.129.1.1 (A:3-138,A:409-527) GroEL, E domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ioka1 a.129.1.1 (A:2-136,A:410-526) GroEL, E domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1kp8a1 a.129.1.1 (A:2-136,A:410-526) GroEL, E domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure