Psyllid ID: psy14958

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360--
MCSQLCESKSEKLFVAMNCREILSEIFGLKYFLSPLLSRGSASTQGISRYKLSPCGHLLAENIKKEWVRSCVLRREEPAFLYSQQGDCENETDLQDMFLTTKELSNGKIGGATAQVGDPSGKTKDRDKQDLATVQTNTKGIEKNIKTIFRNHEQYFWKDRKDSLKPPIVVNNMSWYNSINVIDFMNHIARLFRMGDMLKKQSVGGSDQMGNIKAGHDLISKLYGKTVFDLLVRTPQTVYAGFDPTASSLHIGNLLILINLIHWQRAGHQVIALMICLSQILWRTCNEEAVVNNMSWYNSINVIDFMNHIARLFRMGDMLKKQSVVTRLESEHGMNYTEFSYQIFQSYDWAHLYKEHNCRFQA
ccHHHHHccccHHHHHHcHHHHHHHHHHHHHHHHHHHcccccccccccEEcccccccHHHHcccHHHHHHHHHccccccEEEccccccccHHcHHHHHHHHcHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccHHcccccccccccEEEEcHHHHccccHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccccccHHHHHHHHHHHHHHHccccEEEEcccccccccccccccccEEcHHHHccccHHHHHHHHcccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcccEEcc
cccHHcccccHHHHHHHHHHHHHHHHHHHHHHHcHHccccccccccccEcccccccHHHHHHHHHHHHHHHHHcccccEEEEcccccccccccHHHHHHHHHHHHHHHEcccHHHcccccccccccccccHHHHHHHHHHHHHHHHHHcccccHccccccccccccEEEEEcHHHHHcccHHHHHHHHccccEHHHHHcEEEEEEHHHHHHHHHHHHHHHHHHcccHHHHHHHcccEEEEEEcccccccEHHHHHHHHHHHHHHHcccEEEEEEEccccccccccccEEEEEcHHHHHcccHHHHHHHHcccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcEEEEc
mcsqlcesksEKLFVAMNCREILSEIFGLKyflspllsrgsastqgisryklspcghllaENIKKEWVRSCvlrreepaflysqqgdcenetDLQDMFLTtkelsngkiggataqvgdpsgktkdrdkqdLATVQTNTKGIEKNIKTIFRNHEQYFWkdrkdslkppivvnnmswynsINVIDFMNHIARLFRMGDmlkkqsvggsdqmgnikAGHDLISKLYGKTVFDLLVrtpqtvyagfdptasslhiGNLLILINLIHWQRAGHQVIALMICLSQILWRTCNEEAVVNNMSWYNSINVIDFMNHIARLFRMGDMLKKQSVVTRLesehgmnyteFSYQIFQSYDWAHLYKEHNCRFQA
mcsqlceskseKLFVAMNCREILSEIFGLKYFLSPLLSRGSASTQGISRYKLSPCGHLLAENIKKEWVRSCVLRREEPAflysqqgdcenETDLQDMFLTTKelsngkiggataqvgdpsgktkdrdkqdlatvqtntkgiekniKTIFRNHEQYFWKDRKDSLKPPIVVNNMSWYNSINVIDFMNHIARLFRMGDMLKKQSVGGSDQMGNIKAGHDLISKLYGKTVFDLLVRTPQTVYAGFDPTASSLHIGNLLILINLIHWQRAGHQVIALMICLSQILWRTCNEEAVVNNMSWYNSINVIDFMNHIARLFRMGDMLKKQSVVTRLESEHGMNYTEFSYQIFQSYDWAHLYKEHNCRFQA
MCSQLCESKSEKLFVAMNCREILSEIFGLKYFLSPLLSRGSASTQGISRYKLSPCGHLLAENIKKEWVRSCVLRREEPAFLYSQQGDCENETDLQDMFLTTKELSNGKIGGATAQVGDPSGKTKDRDKQDLATVQTNTKGIEKNIKTIFRNHEQYFWKDRKDSLKPPIVVNNMSWYNSINVIDFMNHIARLFRMGDMLKKQSVGGSDQMGNIKAGHDLISKLYGKTVFDLLVRTPQTVYAGFDPTASSlhignllilinlihWQRAGHQVIALMICLSQILWRTCNEEAVVNNMSWYNSINVIDFMNHIARLFRMGDMLKKQSVVTRLESEHGMNYTEFSYQIFQSYDWAHLYKEHNCRFQA
***********KLFVAMNCREILSEIFGLKYFLSPLLSRGSASTQGISRYKLSPCGHLLAENIKKEWVRSCVLRREEPAFLYSQQGDC*******DMFL***************************************KGIEKNIKTIFRNHEQYFWKDRKDSLKPPIVVNNMSWYNSINVIDFMNHIARLFRMGDMLKKQ*******MGNIKAGHDLISKLYGKTVFDLLVRTPQTVYAGFDPTASSLHIGNLLILINLIHWQRAGHQVIALMICLSQILWRTCNEEAVVNNMSWYNSINVIDFMNHIARLFRMGDMLKKQSVVTRLESEHGMNYTEFSYQIFQSYDWAHLYKEHNC****
*********SE*LFVAMNCREILSEIFGLKYFLSPLL************YKLSPCGHLLAENIKKEWVRSCVLRREEPAFLYSQQGDCENETDLQDMFLTTKELSNGKIGGATAQVGDPSGKTKDRDKQDLATVQTNTKGIEKNIKTIFRNHEQYFWKDRKDSLKPPIVVNNMSWYNSINVIDFMNHIARLFRMGDMLKKQSVGGSDQMGNIKAGHDLISKLYGKTVFDLLVRTPQTVYAGFDPTASSLHIGNLLILINLIHWQRAGHQVIALMICLSQILWRTCNEEAVVNNMSWYNSINVIDFMNHIARLFRMGDMLKKQSVVTRLESEHGMNYTEFSYQIFQSYDWAHLYKEHNCRFQA
********KSEKLFVAMNCREILSEIFGLKYFLSPLLSRGSASTQGISRYKLSPCGHLLAENIKKEWVRSCVLRREEPAFLYSQQGDCENETDLQDMFLTTKELSNGKIGGATAQ**************DLATVQTNTKGIEKNIKTIFRNHEQYFWKDRKDSLKPPIVVNNMSWYNSINVIDFMNHIARLFRMGDMLKKQSVGGSDQMGNIKAGHDLISKLYGKTVFDLLVRTPQTVYAGFDPTASSLHIGNLLILINLIHWQRAGHQVIALMICLSQILWRTCNEEAVVNNMSWYNSINVIDFMNHIARLFRMGDMLKKQSVVTRLESEHGMNYTEFSYQIFQSYDWAHLYKEHNCRFQA
*C***CESKSEKLFVAMNCREILSEIFGLKYFLSPLLSRG****QGISRYKLSPCGHLLAENIKKEWVRSCVLRREEPAFLYSQQGDCENETDLQDMFLTTKELSNGKIGGATAQVGDPSGKTKDRDKQDLATVQTNTKGIEKNIKTIFRNHEQYFWKDRKDSLKPPIVVNNMSWYNSINVIDFMNHIARLFRMGDMLKKQSVGGSDQMGNIKAGHDLISKLYGKTVFDLLVRTPQTVYAGFDPTASSLHIGNLLILINLIHWQRAGHQVIALMICLSQILWRTCNEEAVVNNMSWYNSINVIDFMNHIARLFRMGDMLKKQSVVTRLESEHGMNYTEFSYQIFQSYDWAHLYKEHNCRFQA
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCSQLCESKSEKLFVAMNCREILSEIFGLKYFLSPLLSRGSASTQGISRYKLSPCGHLLAENIKKEWVRSCVLRREEPAFLYSQQGDCENETDLQDMFLTTKELSNGKIGGATAQVGDPSGKTKDRDKQDLATVQTNTKGIEKNIKTIFRNHEQYFWKDRKDSLKPPIVVNNMSWYNSINVIDFMNHIARLFRMGDMLKKQSVGGSDQMGNIKAGHDLISKLYGKTVFDLLVRTPQTVYAGFDPTASSLHIGNLLILINLIHWQRAGHQVIALMICLSQILWRTCNEEAVVNNMSWYNSINVIDFMNHIARLFRMGDMLKKQSVVTRLESEHGMNYTEFSYQIFQSYDWAHLYKEHNCRFQA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query362 2.2.26 [Sep-21-2011]
Q9W107 464 Probable tyrosine--tRNA l yes N/A 0.403 0.314 0.385 3e-33
A1A1W2 435 Tyrosine--tRNA ligase OS= yes N/A 0.342 0.285 0.414 8e-27
B7GTN2 440 Tyrosine--tRNA ligase OS= yes N/A 0.350 0.288 0.393 1e-25
B3DSX9 440 Tyrosine--tRNA ligase OS= yes N/A 0.350 0.288 0.393 1e-25
Q8G5G1 440 Tyrosine--tRNA ligase OS= yes N/A 0.350 0.288 0.393 1e-25
Q8BYL4 472 Tyrosine--tRNA ligase, mi yes N/A 0.353 0.271 0.358 2e-25
Q5I0L3 471 Tyrosine--tRNA ligase, mi yes N/A 0.353 0.271 0.358 3e-25
Q7UM14 438 Tyrosine--tRNA ligase OS= yes N/A 0.375 0.310 0.341 5e-25
Q6AGC2 442 Tyrosine--tRNA ligase OS= yes N/A 0.364 0.298 0.363 4e-24
A0LUB6 426 Tyrosine--tRNA ligase OS= yes N/A 0.350 0.298 0.359 1e-23
>sp|Q9W107|SYYM_DROME Probable tyrosine--tRNA ligase, mitochondrial OS=Drosophila melanogaster GN=CG16912 PE=2 SV=1 Back     alignment and function desciption
 Score =  142 bits (359), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 74/192 (38%), Positives = 102/192 (53%), Gaps = 46/192 (23%)

Query: 216 HDLISKLYGKTVFDLLVRTPQTVYAGFDPTASSLHIGNLLILINLIHWQRAGHQVIALMI 275
           H +        +  L  R  Q++YAGFDPTA SLH+GNLL+++ LIH QRAGH+ IAL+ 
Sbjct: 38  HGIFPDTAAPRMKQLFTRGQQSIYAGFDPTADSLHVGNLLVIMGLIHCQRAGHRPIALVG 97

Query: 276 CLSQI----------------------------------------LWRTCNEE------A 289
             + +                                        LW +  ++       
Sbjct: 98  GATGLIGDPSGRKTERNQLGETVIETNLKAIEQQLRRVFENHENCLWDSKKQKLPLAPLI 157

Query: 290 VVNNMSWYNSINVIDFMNHIARLFRMGDMLKKQSVVTRLESEHGMNYTEFSYQIFQSYDW 349
           +VNN  WY  + +IDF+ ++ R FRMG ML + SV +RLESE GM++TEF+YQIFQ+YDW
Sbjct: 158 IVNNADWYADLQLIDFVANMGRHFRMGSMLSRSSVQSRLESEDGMSFTEFTYQIFQAYDW 217

Query: 350 AHLYKEHNCRFQ 361
            HL + HNC FQ
Sbjct: 218 LHLLRRHNCCFQ 229
Catalyzes the attachment of tyrosine to tRNA(Tyr) in a two-step reaction: tyrosine is first activated by ATP to form Tyr-AMP and then transferred to the acceptor end of tRNA(Tyr).
Drosophila melanogaster (taxid: 7227)
EC: 6EC: .EC: 1EC: .EC: 1EC: .EC: 1
>sp|A1A1W2|SYY_BIFAA Tyrosine--tRNA ligase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=tyrS PE=3 SV=1 Back     alignment and function description
>sp|B7GTN2|SYY_BIFLS Tyrosine--tRNA ligase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=tyrS PE=3 SV=1 Back     alignment and function description
>sp|B3DSX9|SYY_BIFLD Tyrosine--tRNA ligase OS=Bifidobacterium longum (strain DJO10A) GN=tyrS PE=3 SV=1 Back     alignment and function description
>sp|Q8G5G1|SYY_BIFLO Tyrosine--tRNA ligase OS=Bifidobacterium longum (strain NCC 2705) GN=tyrS PE=3 SV=1 Back     alignment and function description
>sp|Q8BYL4|SYYM_MOUSE Tyrosine--tRNA ligase, mitochondrial OS=Mus musculus GN=Yars2 PE=2 SV=2 Back     alignment and function description
>sp|Q5I0L3|SYYM_RAT Tyrosine--tRNA ligase, mitochondrial OS=Rattus norvegicus GN=Yars2 PE=2 SV=1 Back     alignment and function description
>sp|Q7UM14|SYY_RHOBA Tyrosine--tRNA ligase OS=Rhodopirellula baltica (strain SH1) GN=tyrS PE=3 SV=1 Back     alignment and function description
>sp|Q6AGC2|SYY_LEIXX Tyrosine--tRNA ligase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=tyrS PE=3 SV=1 Back     alignment and function description
>sp|A0LUB6|SYY_ACIC1 Tyrosine--tRNA ligase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=tyrS PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query362
307178905426 Probable tyrosyl-tRNA synthetase, mitoch 0.372 0.316 0.441 2e-36
242009572 463 tyrosyl-tRNA synthetase, putative [Pedic 0.403 0.315 0.421 5e-36
322785930404 hypothetical protein SINV_80157 [Solenop 0.367 0.329 0.430 3e-35
91092398457 PREDICTED: similar to tyrosyl-tRNA synth 0.403 0.319 0.428 5e-35
332030429426 Putative tyrosyl-tRNA synthetase, mitoch 0.372 0.316 0.452 5e-35
270011290254 hypothetical protein TcasGA2_TC002218 [T 0.403 0.574 0.428 6e-35
157126543 463 tyrosyl-tRNA synthetase [Aedes aegypti] 0.364 0.285 0.438 8e-35
307213308462 Probable tyrosyl-tRNA synthetase, mitoch 0.372 0.292 0.441 2e-34
357625876432 putative tyrosyl-tRNA synthetase [Danaus 0.403 0.337 0.421 2e-34
345482117 482 PREDICTED: probable tyrosyl-tRNA synthet 0.372 0.280 0.441 4e-34
>gi|307178905|gb|EFN67433.1| Probable tyrosyl-tRNA synthetase, mitochondrial [Camponotus floridanus] Back     alignment and taxonomy information
 Score =  159 bits (401), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 79/179 (44%), Positives = 106/179 (59%), Gaps = 44/179 (24%)

Query: 227 VFDLLVRTPQTVYAGFDPTASSLHIGNLLILINLIHWQRAGHQVIALMICLSQIL----- 281
           + DLL ++PQ VYAGFDPTA SLHIGNLLIL+NL+HWQRAGHQVIAL+   + ++     
Sbjct: 14  IIDLLNKSPQCVYAGFDPTADSLHIGNLLILMNLLHWQRAGHQVIALVGGATGLIGDPSH 73

Query: 282 -----------------------------------WRTCNEE----AVVNNMSWYNSINV 302
                                              W+   E      +VNN+ WY ++NV
Sbjct: 74  RKKERVEMDKYLMEENLKSIINNIEIIFNNHQTYFWKNRQEHLKPLIIVNNLDWYTNVNV 133

Query: 303 IDFMNHIARLFRMGDMLKKQSVVTRLESEHGMNYTEFSYQIFQSYDWAHLYKEHNCRFQ 361
           I+F+  I + FRMG ML + SV +RL S+ GM++TEF+YQ+FQ+YDW  L K++ CRFQ
Sbjct: 134 IEFVRSIGKYFRMGTMLGRASVQSRLNSDTGMSFTEFTYQVFQAYDWFQLMKKYKCRFQ 192

Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|242009572|ref|XP_002425557.1| tyrosyl-tRNA synthetase, putative [Pediculus humanus corporis] gi|212509436|gb|EEB12819.1| tyrosyl-tRNA synthetase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|322785930|gb|EFZ12549.1| hypothetical protein SINV_80157 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|91092398|ref|XP_968995.1| PREDICTED: similar to tyrosyl-tRNA synthetase [Tribolium castaneum] Back     alignment and taxonomy information
>gi|332030429|gb|EGI70117.1| Putative tyrosyl-tRNA synthetase, mitochondrial [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|270011290|gb|EFA07738.1| hypothetical protein TcasGA2_TC002218 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|157126543|ref|XP_001660920.1| tyrosyl-tRNA synthetase [Aedes aegypti] gi|108873226|gb|EAT37451.1| AAEL010563-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|307213308|gb|EFN88760.1| Probable tyrosyl-tRNA synthetase, mitochondrial [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|357625876|gb|EHJ76165.1| putative tyrosyl-tRNA synthetase [Danaus plexippus] Back     alignment and taxonomy information
>gi|345482117|ref|XP_001607236.2| PREDICTED: probable tyrosyl-tRNA synthetase, mitochondrial-like [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query362
FB|FBgn0035064 464 CG16912 [Drosophila melanogast 0.198 0.155 0.583 4.9e-25
ZFIN|ZDB-GENE-030131-6268 474 yars2 "tyrosyl-tRNA synthetase 0.259 0.198 0.442 5.9e-20
UNIPROTKB|H0YHS6291 YARS2 "Tyrosine--tRNA ligase, 0.256 0.319 0.368 6.3e-18
TAIR|locus:2076879 511 EMB2768 "EMBRYO DEFECTIVE 2768 0.198 0.140 0.458 3.7e-17
UNIPROTKB|E2RHU6 477 YARS2 "Uncharacterized protein 0.198 0.150 0.402 6.2e-17
UNIPROTKB|A5D7G0 478 YARS2 "Uncharacterized protein 0.256 0.194 0.368 2.8e-16
UNIPROTKB|Q9Y2Z4 477 YARS2 "Tyrosine--tRNA ligase, 0.256 0.194 0.368 1.7e-16
UNIPROTKB|Q9KUQ0 426 tyrS1 "Tyrosine--tRNA ligase 1 0.212 0.180 0.410 1.1e-15
TIGR_CMR|VC_0465 426 VC_0465 "tyrosyl-tRNA syntheta 0.212 0.180 0.410 1.1e-15
MGI|MGI:1917370 472 Yars2 "tyrosyl-tRNA synthetase 0.198 0.152 0.388 2.6e-15
FB|FBgn0035064 CG16912 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 245 (91.3 bits), Expect = 4.9e-25, Sum P(2) = 4.9e-25
 Identities = 42/72 (58%), Positives = 55/72 (76%)

Query:   290 VVNNMSWYNSINVIDFMNHIARLFRMGDMLKKQSVVTRLESEHGMNYTEFSYQIFQSYDW 349
             +VNN  WY  + +IDF+ ++ R FRMG ML + SV +RLESE GM++TEF+YQIFQ+YDW
Sbjct:   158 IVNNADWYADLQLIDFVANMGRHFRMGSMLSRSSVQSRLESEDGMSFTEFTYQIFQAYDW 217

Query:   350 AHLYKEHNCRFQ 361
              HL + HNC FQ
Sbjct:   218 LHLLRRHNCCFQ 229
GO:0004831 "tyrosine-tRNA ligase activity" evidence=ISS
GO:0006437 "tyrosyl-tRNA aminoacylation" evidence=IEA
GO:0003723 "RNA binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0006412 "translation" evidence=ISS
GO:0005739 "mitochondrion" evidence=ISS
ZFIN|ZDB-GENE-030131-6268 yars2 "tyrosyl-tRNA synthetase 2, mitochondrial" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|H0YHS6 YARS2 "Tyrosine--tRNA ligase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TAIR|locus:2076879 EMB2768 "EMBRYO DEFECTIVE 2768" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E2RHU6 YARS2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|A5D7G0 YARS2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y2Z4 YARS2 "Tyrosine--tRNA ligase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KUQ0 tyrS1 "Tyrosine--tRNA ligase 1" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_0465 VC_0465 "tyrosyl-tRNA synthetase" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
MGI|MGI:1917370 Yars2 "tyrosyl-tRNA synthetase 2 (mitochondrial)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer6.1.1.1LOW CONFIDENCE prediction!
3rd Layer6.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query362
PRK05912 408 PRK05912, PRK05912, tyrosyl-tRNA synthetase; Valid 2e-41
cd00805 269 cd00805, TyrRS_core, catalytic core domain of tyro 9e-32
PRK13354 410 PRK13354, PRK13354, tyrosyl-tRNA synthetase; Provi 9e-30
COG0162 401 COG0162, TyrS, Tyrosyl-tRNA synthetase [Translatio 1e-27
pfam00579 291 pfam00579, tRNA-synt_1b, tRNA synthetases class I 5e-23
cd00805269 cd00805, TyrRS_core, catalytic core domain of tyro 9e-22
TIGR00234 377 TIGR00234, tyrS, tyrosyl-tRNA synthetase 1e-20
PRK05912408 PRK05912, PRK05912, tyrosyl-tRNA synthetase; Valid 5e-20
cd00395 273 cd00395, Tyr_Trp_RS_core, catalytic core domain of 6e-19
PRK13354410 PRK13354, PRK13354, tyrosyl-tRNA synthetase; Provi 2e-17
COG0162401 COG0162, TyrS, Tyrosyl-tRNA synthetase [Translatio 9e-16
TIGR00234377 TIGR00234, tyrS, tyrosyl-tRNA synthetase 1e-14
cd00395273 cd00395, Tyr_Trp_RS_core, catalytic core domain of 2e-10
pfam00579291 pfam00579, tRNA-synt_1b, tRNA synthetases class I 7e-05
>gnl|CDD|235645 PRK05912, PRK05912, tyrosyl-tRNA synthetase; Validated Back     alignment and domain information 
 Score =  149 bits (379), Expect = 2e-41
 Identities = 52/166 (31%), Positives = 77/166 (46%), Gaps = 33/166 (19%)

Query: 229 DLLVRTPQTVYAGFDPTASSLHIGNLLILINLIHWQRAGHQVIAL------MI------- 275
           + L + P  +Y GFDPTA SLH+G+L+ L+ L  +Q AGH+ IAL      MI       
Sbjct: 27  EKLAKEPLRIYLGFDPTAPSLHLGHLVPLLKLRRFQDAGHKPIALIGGFTGMIGDPSGKS 86

Query: 276 --------------------CLSQILWRTCNEEAVVNNMSWYNSINVIDFMNHIARLFRM 315
                                L + L    +   +VNN  W   +N IDF+  + + F +
Sbjct: 87  ETRKLLTREQVAENAETIKEQLFKFLDFEKDGAEIVNNSDWLGKLNAIDFLRDLGKHFTV 146

Query: 316 GDMLKKQSVVTRLESEHGMNYTEFSYQIFQSYDWAHLYKEHNCRFQ 361
             ML++     RL    G+++TEF Y + Q YD+  L K + C  Q
Sbjct: 147 NRMLERDDFKKRLREGQGISFTEFLYPLLQGYDFVALNKRYGCDLQ 192

Length = 408
>gnl|CDD|173902 cd00805, TyrRS_core, catalytic core domain of tyrosinyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|237360 PRK13354, PRK13354, tyrosyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|223240 COG0162, TyrS, Tyrosyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|216003 pfam00579, tRNA-synt_1b, tRNA synthetases class I (W and Y) Back     alignment and domain information
>gnl|CDD|173902 cd00805, TyrRS_core, catalytic core domain of tyrosinyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|232889 TIGR00234, tyrS, tyrosyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|235645 PRK05912, PRK05912, tyrosyl-tRNA synthetase; Validated Back     alignment and domain information
>gnl|CDD|173893 cd00395, Tyr_Trp_RS_core, catalytic core domain of tyrosinyl-tRNA and tryptophanyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|237360 PRK13354, PRK13354, tyrosyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|223240 COG0162, TyrS, Tyrosyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|232889 TIGR00234, tyrS, tyrosyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|173893 cd00395, Tyr_Trp_RS_core, catalytic core domain of tyrosinyl-tRNA and tryptophanyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|216003 pfam00579, tRNA-synt_1b, tRNA synthetases class I (W and Y) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 362
COG0162401 TyrS Tyrosyl-tRNA synthetase [Translation, ribosom 100.0
KOG2623|consensus467 100.0
KOG2623|consensus 467 100.0
COG0162 401 TyrS Tyrosyl-tRNA synthetase [Translation, ribosom 100.0
PRK13354410 tyrosyl-tRNA synthetase; Provisional 100.0
TIGR00234377 tyrS tyrosyl-tRNA synthetase. This tyrosyl-tRNA sy 100.0
PRK05912408 tyrosyl-tRNA synthetase; Validated 100.0
PRK13354 410 tyrosyl-tRNA synthetase; Provisional 99.97
PRK05912 408 tyrosyl-tRNA synthetase; Validated 99.97
TIGR00234 377 tyrS tyrosyl-tRNA synthetase. This tyrosyl-tRNA sy 99.96
cd00395 273 Tyr_Trp_RS_core catalytic core domain of tyrosinyl 99.95
cd00395273 Tyr_Trp_RS_core catalytic core domain of tyrosinyl 99.94
cd00805269 TyrRS_core catalytic core domain of tyrosinyl-tRNA 99.93
cd00805 269 TyrRS_core catalytic core domain of tyrosinyl-tRNA 99.92
PF00579 292 tRNA-synt_1b: tRNA synthetases class I (W and Y); 99.9
PLN02486 383 aminoacyl-tRNA ligase 99.85
PRK08560 329 tyrosyl-tRNA synthetase; Validated 99.84
PTZ00126 383 tyrosyl-tRNA synthetase; Provisional 99.8
PF00579292 tRNA-synt_1b: tRNA synthetases class I (W and Y); 99.79
PTZ00126383 tyrosyl-tRNA synthetase; Provisional 99.72
PTZ00348 682 tyrosyl-tRNA synthetase; Provisional 99.72
PRK12285 368 tryptophanyl-tRNA synthetase; Reviewed 99.71
cd00806 280 TrpRS_core catalytic core domain of tryptophanyl-t 99.68
PRK08560329 tyrosyl-tRNA synthetase; Validated 99.67
TIGR00233 328 trpS tryptophanyl-tRNA synthetase. This model repr 99.58
PTZ00348 682 tyrosyl-tRNA synthetase; Provisional 99.57
PRK00927 333 tryptophanyl-tRNA synthetase; Reviewed 99.54
PLN02486383 aminoacyl-tRNA ligase 99.49
PRK12282 333 tryptophanyl-tRNA synthetase II; Reviewed 99.43
KOG2145|consensus 397 99.34
PRK12556 332 tryptophanyl-tRNA synthetase; Provisional 99.14
KOG2144|consensus 360 99.13
cd00806280 TrpRS_core catalytic core domain of tryptophanyl-t 99.11
PLN02886 389 aminoacyl-tRNA ligase 99.11
PRK12285368 tryptophanyl-tRNA synthetase; Reviewed 99.11
PRK12284 431 tryptophanyl-tRNA synthetase; Reviewed 99.02
PRK00927333 tryptophanyl-tRNA synthetase; Reviewed 98.92
PRK12283 398 tryptophanyl-tRNA synthetase; Reviewed 98.87
COG0180 314 TrpS Tryptophanyl-tRNA synthetase [Translation, ri 98.66
TIGR00233328 trpS tryptophanyl-tRNA synthetase. This model repr 98.59
PRK12282333 tryptophanyl-tRNA synthetase II; Reviewed 98.1
KOG2713|consensus 347 97.58
PRK12556332 tryptophanyl-tRNA synthetase; Provisional 96.7
cd00802143 class_I_aaRS_core catalytic core domain of class I 96.41
cd00802143 class_I_aaRS_core catalytic core domain of class I 95.06
PRK12284431 tryptophanyl-tRNA synthetase; Reviewed 94.85
>COG0162 TyrS Tyrosyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
Probab=100.00  E-value=3.5e-43  Score=352.60  Aligned_cols=190  Identities=26%  Similarity=0.325  Sum_probs=166.5

Q ss_pred             CcceEEeeeCC------CcchhhhhhhhhhHhhhhcccccchhhhhhcCCCccccchhhhhhhcccceeEEEcCcccccc
Q psy14958         44 TQGISRYKLSP------CGHLLAENIKKEWVRSCVLRREEPAFLYSQQGDCENETDLQDMFLTTKELSNGKIGGATAQVG  117 (362)
Q Consensus        44 ~~~~~~~g~dp------~gh~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~lIGg~Ta~IG  117 (362)
                      .|+++|+||||      +||+|+++               ||++||+.|  |++              ++|||||||+||
T Consensus        31 ~~~~~Y~GfDPTa~slHlGhlv~l~---------------kL~~fQ~aG--h~~--------------ivLigd~ta~Ig   79 (401)
T COG0162          31 GPLRVYIGFDPTAPSLHLGHLVPLM---------------KLRRFQDAG--HKP--------------IVLIGDATAMIG   79 (401)
T ss_pred             CCceEEEeeCCCCCccchhhHHHHH---------------HHHHHHHCC--CeE--------------EEEecccceecC
Confidence            39999999999      89999999               999999999  999              899999999999


Q ss_pred             CCCCCCcccCCCCHHHHHHHHHHHHHHHHHHHhhhhhhhhcccCCCCCCcEEEeChhhhccCCHHHHHHHHHhhhhhhhh
Q psy14958        118 DPSGKTKDRDKQDLATVQTNTKGIEKNIKTIFRNHEQYFWKDRKDSLKPPIVVNNMSWYNSINVIDFMNHIARLFRMGDM  197 (362)
Q Consensus       118 DPSGr~~~R~~Lt~e~i~~Na~~i~~Qi~~il~n~~~~~~~~~~~~~~~~~i~nN~~Wl~~m~~~dfL~~lg~~f~v~~M  197 (362)
                      |||||+++|++++.|+|.+|+++|.+|+.++++              +++++||||+|++++++.+||+++|+|||||+|
T Consensus        80 DpsGk~e~r~~l~~e~v~~n~~~i~~ql~~~ld--------------~k~~~v~ns~w~~~~~y~~~l~~~g~~~sv~rm  145 (401)
T COG0162          80 DPSGKSEERKLLTRETVLENAETIKKQLGKFLD--------------NKAEFVNNSDWLKKLNYLDFLRDVGKHFSVNRM  145 (401)
T ss_pred             CCCCCHHHHhhccHHHHHHHHHHHHHHhcccCC--------------cceEEEechHHhCcCCHHHHHHHHHhHccHHHH
Confidence            999999999999999999999999999999975              468999999999999999999999999999999


Q ss_pred             hhhc----------------------------------ccCccchhHHHhhcccchhccccc-----eeeeecc------
Q psy14958        198 LKKQ----------------------------------SVGGSDQMGNIKAGHDLISKLYGK-----TVFDLLV------  232 (362)
Q Consensus       198 L~Rd----------------------------------~iGGsDQ~~NI~rGrdLi~r~~gq-----eLp~LL~------  232 (362)
                      |+||                                  ++||+|||+|++.|++++++....     ++|+|..      
T Consensus       146 l~~d~~~~R~~~~~~is~~Ef~YpLmQayD~~~L~~dlq~GG~DQ~~ni~~grdl~rr~g~~~~~~lt~PLL~~ldG~Km  225 (401)
T COG0162         146 LRRDDVKKRLEREQGISFTEFNYPLLQAYDFVYLNKDLQLGGSDQWGNILAGRDLIRRLGQKKVVGLTTPLLTGLDGKKM  225 (401)
T ss_pred             HHhhhHHHHhccCCCCchhhhhhHHHHHHHHHHHccchhcCChHHHHHHHHHHHHHHHhCCCCeEEEEeccccCCCCCcc
Confidence            9998                                  379999999999999999974333     4677652      


Q ss_pred             CCCCce-eeccCCC--CCCcchhhHhHH---HHHHHHHHcCCceEEeecchhH
Q psy14958        233 RTPQTV-YAGFDPT--ASSLHIGNLLIL---INLIHWQRAGHQVIALMICLSQ  279 (362)
Q Consensus       233 sksl~~-YiG~dpT--a~~lHlGhlmsi---l~lr~fq~~G~~~i~lIg~i~~  279 (362)
                      +||.++ |++....  |-++ +...+.+   .+++|+....+.+...|..|.+
T Consensus       226 gKs~~~a~~~~s~~~Sp~~~-yq~~~~i~D~~~~~~~~~~t~l~~~eI~~i~~  277 (401)
T COG0162         226 GKSEGGAVWLDSEKTSPYDF-YQYWMNIEDADVKRFLKLLTFLSLEEIEEIEK  277 (401)
T ss_pred             cccCCCceEccCCCCCcHhh-hhcHhcCcHHHHHHHHHHhCcCChHHHHHHHH
Confidence            567776 7766433  5567 8889988   9999999987776555555443

>KOG2623|consensus Back     alignment and domain information
>KOG2623|consensus Back     alignment and domain information
>COG0162 TyrS Tyrosyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13354 tyrosyl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR00234 tyrS tyrosyl-tRNA synthetase Back     alignment and domain information
>PRK05912 tyrosyl-tRNA synthetase; Validated Back     alignment and domain information
>PRK13354 tyrosyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK05912 tyrosyl-tRNA synthetase; Validated Back     alignment and domain information
>TIGR00234 tyrS tyrosyl-tRNA synthetase Back     alignment and domain information
>cd00395 Tyr_Trp_RS_core catalytic core domain of tyrosinyl-tRNA and tryptophanyl-tRNA synthetase Back     alignment and domain information
>cd00395 Tyr_Trp_RS_core catalytic core domain of tyrosinyl-tRNA and tryptophanyl-tRNA synthetase Back     alignment and domain information
>cd00805 TyrRS_core catalytic core domain of tyrosinyl-tRNA synthetase Back     alignment and domain information
>cd00805 TyrRS_core catalytic core domain of tyrosinyl-tRNA synthetase Back     alignment and domain information
>PF00579 tRNA-synt_1b: tRNA synthetases class I (W and Y); InterPro: IPR002305 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PLN02486 aminoacyl-tRNA ligase Back     alignment and domain information
>PRK08560 tyrosyl-tRNA synthetase; Validated Back     alignment and domain information
>PTZ00126 tyrosyl-tRNA synthetase; Provisional Back     alignment and domain information
>PF00579 tRNA-synt_1b: tRNA synthetases class I (W and Y); InterPro: IPR002305 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PTZ00126 tyrosyl-tRNA synthetase; Provisional Back     alignment and domain information
>PTZ00348 tyrosyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK12285 tryptophanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>cd00806 TrpRS_core catalytic core domain of tryptophanyl-tRNA synthetase Back     alignment and domain information
>PRK08560 tyrosyl-tRNA synthetase; Validated Back     alignment and domain information
>TIGR00233 trpS tryptophanyl-tRNA synthetase Back     alignment and domain information
>PTZ00348 tyrosyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK00927 tryptophanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PLN02486 aminoacyl-tRNA ligase Back     alignment and domain information
>PRK12282 tryptophanyl-tRNA synthetase II; Reviewed Back     alignment and domain information
>KOG2145|consensus Back     alignment and domain information
>PRK12556 tryptophanyl-tRNA synthetase; Provisional Back     alignment and domain information
>KOG2144|consensus Back     alignment and domain information
>cd00806 TrpRS_core catalytic core domain of tryptophanyl-tRNA synthetase Back     alignment and domain information
>PLN02886 aminoacyl-tRNA ligase Back     alignment and domain information
>PRK12285 tryptophanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12284 tryptophanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK00927 tryptophanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12283 tryptophanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>COG0180 TrpS Tryptophanyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00233 trpS tryptophanyl-tRNA synthetase Back     alignment and domain information
>PRK12282 tryptophanyl-tRNA synthetase II; Reviewed Back     alignment and domain information
>KOG2713|consensus Back     alignment and domain information
>PRK12556 tryptophanyl-tRNA synthetase; Provisional Back     alignment and domain information
>cd00802 class_I_aaRS_core catalytic core domain of class I amino acyl-tRNA synthetase Back     alignment and domain information
>cd00802 class_I_aaRS_core catalytic core domain of class I amino acyl-tRNA synthetase Back     alignment and domain information
>PRK12284 tryptophanyl-tRNA synthetase; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query362
2pid_A 356 Crystal Structure Of Human Mitochondrial Tyrosyl-tr 1e-19
2jan_A 432 Tyrosyl-Trna Synthetase From Mycobacterium Tubercul 2e-16
2ts1_A 419 Structure Of Tyrosyl-TRNA SYNTHETASE REFINED AT 2.3 6e-15
1tya_E 319 Structural Analysis Of A Series Of Mutants Of Tyros 1e-14
1tyd_E 319 Structure Of Tyrosyl-Trna Synthetase Refined At 2.3 1e-14
4ts1_A 319 Crystal Structure Of A Deletion Mutant Of A Tyrosyl 1e-14
1tyc_A 319 Structural Analysis Of A Series Of Mutants Of Tyros 1e-14
1tyb_E 319 Structural Analysis Of A Series Of Mutants Of Tyros 1e-14
1vbm_A 318 Crystal Structure Of The Escherichia Coli Tyrosyl-T 2e-13
1x8x_A 322 Tyrosyl T-Rna Synthetase From E.Coli Complexed With 2e-13
1jii_A 420 Crystal Structure Of S. Aureus Tyrrs In Complex Wit 1e-12
1wq3_A 322 Escherichia Coli Tyrosyl-Trna Synthetase Mutant Com 4e-12
1wq4_A 321 Escherichia Coli Tyrosyl-Trna Synthetase Mutant Com 4e-12
1vbn_A 318 Escherichia Coli Tyrosyl-Trna Synthetase Mutant Com 4e-12
1y42_X 392 Crystal Structure Of A C-Terminally Truncated Cyt-1 3e-08
>pdb|2PID|A Chain A, Crystal Structure Of Human Mitochondrial Tyrosyl-trna Synthetase In Complex With An Adenylate Analog Length = 356 Back     alignment and structure 
Iteration: 1

 Score = 93.6 bits (231), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 55/169 (32%), Positives = 77/169 (45%), Gaps = 42/169 (24%)
Query: 235 PQTVYAGFDPTASSXXXXXXXXXXXXXXWQRAGHQVIALMICLSQILW----RTCNEEA- 289
           PQT+Y GFDPTA S               QRAGH VIAL+   +  L     RT   EA 
Sbjct: 46  PQTIYCGFDPTADSLHVGHLLALLGLFHLQRAGHNVIALVGGATARLGDPSGRTKEREAL 105
Query: 290 -------------------------------------VVNNMSWYNSINVIDFMNHIARL 312
                                                V++N +WY   +++DF+  +   
Sbjct: 106 ETERVRANARALRLGLEALAANHQQLFTDGRSWGSFTVLDNSAWYQKQHLVDFLAAVGGH 165
Query: 313 FRMGDMLKKQSVVTRLESEHGMNYTEFSYQIFQSYDWAHLYKEHNCRFQ 361
           FRMG +L +QSV  RL+S  GM+  EF YQ+ Q+YD+ +L++ + CR Q
Sbjct: 166 FRMGTLLSRQSVQLRLKSPEGMSLAEFFYQVLQAYDFYYLFQRYGCRVQ 214
>pdb|2JAN|A Chain A, Tyrosyl-Trna Synthetase From Mycobacterium Tuberculosis In Unliganded State Length = 432 Back     alignment and structure
>pdb|2TS1|A Chain A, Structure Of Tyrosyl-TRNA SYNTHETASE REFINED AT 2.3 ANGSTROMS Resolution. Interaction Of The Enzyme With The Tyrosyl Adenylate Intermediate Length = 419 Back     alignment and structure
>pdb|1TYA|E Chain E, Structural Analysis Of A Series Of Mutants Of Tyrosyl-Trna Synthetase: Enhancement Of Catalysis By Hydrophobic Interactions Length = 319 Back     alignment and structure
>pdb|1TYD|E Chain E, Structure Of Tyrosyl-Trna Synthetase Refined At 2.3 Angstroms Resolution. Interaction Of The Enzyme With The Tyrosyl Adenylate Intermediate Length = 319 Back     alignment and structure
>pdb|4TS1|A Chain A, Crystal Structure Of A Deletion Mutant Of A Tyrosyl-TRNA Synthetase Complexed With Tyrosine Length = 319 Back     alignment and structure
>pdb|1TYC|A Chain A, Structural Analysis Of A Series Of Mutants Of Tyrosyl-Trna Synthetase: Enhancement Of Catalysis By Hydrophobic Interactions Length = 319 Back     alignment and structure
>pdb|1TYB|E Chain E, Structural Analysis Of A Series Of Mutants Of Tyrosyl-Trna Synthetase: Enhancement Of Catalysis By Hydrophobic Interactions Length = 319 Back     alignment and structure
>pdb|1VBM|A Chain A, Crystal Structure Of The Escherichia Coli Tyrosyl-Trna Synthetase Complexed With Tyr-Ams Length = 318 Back     alignment and structure
>pdb|1X8X|A Chain A, Tyrosyl T-Rna Synthetase From E.Coli Complexed With Tyrosine Length = 322 Back     alignment and structure
>pdb|1JII|A Chain A, Crystal Structure Of S. Aureus Tyrrs In Complex With Sb-219383 Length = 420 Back     alignment and structure
>pdb|1WQ3|A Chain A, Escherichia Coli Tyrosyl-Trna Synthetase Mutant Comlexed With 3-Iodo- L-Tyrosine Length = 322 Back     alignment and structure
>pdb|1WQ4|A Chain A, Escherichia Coli Tyrosyl-Trna Synthetase Mutant Complexed With L- Tyrosine Length = 321 Back     alignment and structure
>pdb|1VBN|A Chain A, Escherichia Coli Tyrosyl-Trna Synthetase Mutant Complexed With Tyr-Ams Length = 318 Back     alignment and structure
>pdb|1Y42|X Chain X, Crystal Structure Of A C-Terminally Truncated Cyt-18 Protein Length = 392 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query362
2pid_A 356 Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase 3e-52
2pid_A356 Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase 3e-34
1y42_X 392 Tyrosyl-tRNA synthetase, mitochondrial; CYT-18, tR 6e-48
1y42_X392 Tyrosyl-tRNA synthetase, mitochondrial; CYT-18, tR 2e-29
2jan_A 432 Tyrosyl-tRNA synthetase; protein biosynthesis, ami 2e-44
2jan_A432 Tyrosyl-tRNA synthetase; protein biosynthesis, ami 1e-23
2ts1_A 419 Tyrosyl-tRNA synthetase; ligase (synthetase); 2.30 5e-44
2ts1_A419 Tyrosyl-tRNA synthetase; ligase (synthetase); 2.30 5e-25
1jil_A 420 Tyrrs, tyrosyl-tRNA synthetase; truncation, based 1e-43
1jil_A420 Tyrrs, tyrosyl-tRNA synthetase; truncation, based 7e-24
2yxn_A 322 Tyrosyl-tRNA synthetase; tRNA synthetases class I, 2e-43
2yxn_A322 Tyrosyl-tRNA synthetase; tRNA synthetases class I, 2e-24
1h3f_A 432 Tyrosyl-tRNA synthetase; ligase, aminoacyl-tRNA sy 1e-26
1h3f_A432 Tyrosyl-tRNA synthetase; ligase, aminoacyl-tRNA sy 1e-14
2zp1_A 314 Tyrosyl-tRNA synthetase; tRNA synthetases class I, 6e-10
2cya_A 364 Tyrosyl-tRNA synthetase; tyrrs, aminoacylation, st 4e-09
2cyb_A 323 Tyrosyl-tRNA synthetase; rossmann-fold, structural 1e-08
1n3l_A 372 Tyrosyl-tRNA synthetase; rossmann fold AS catalyti 4e-07
2dlc_X 394 Tyrosyl-tRNA synthetase, cytoplasmic; tyrrs, ligas 8e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
>2pid_A Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase, protein-substrate complex, ATP-BI ligase, mitochondrion, nucleotide-binding, protein biosynth; HET: YSA; 2.20A {Homo sapiens} PDB: 3zxi_A* Length = 356 Back     alignment and structure
 Score =  175 bits (447), Expect = 3e-52
 Identities = 60/175 (34%), Positives = 85/175 (48%), Gaps = 42/175 (24%)

Query: 229 DLLVRTPQTVYAGFDPTASSLHIGNLLILINLIHWQRAGHQVIAL------MI------- 275
                 PQT+Y GFDPTA SLH+G+LL L+ L H QRAGH VIAL       +       
Sbjct: 40  RGTASFPQTIYCGFDPTADSLHVGHLLALLGLFHLQRAGHNVIALVGGATARLGDPSGRT 99

Query: 276 ----------------CLSQILWR-------------TCNEEAVVNNMSWYNSINVIDFM 306
                            L   L               +     V++N +WY   +++DF+
Sbjct: 100 KEREALETERVRANARALRLGLEALAANHQQLFTDGRSWGSFTVLDNSAWYQKQHLVDFL 159

Query: 307 NHIARLFRMGDMLKKQSVVTRLESEHGMNYTEFSYQIFQSYDWAHLYKEHNCRFQ 361
             +   FRMG +L +QSV  RL+S  GM+  EF YQ+ Q+YD+ +L++ + CR Q
Sbjct: 160 AAVGGHFRMGTLLSRQSVQLRLKSPEGMSLAEFFYQVLQAYDFYYLFQRYGCRVQ 214
>2pid_A Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase, protein-substrate complex, ATP-BI ligase, mitochondrion, nucleotide-binding, protein biosynth; HET: YSA; 2.20A {Homo sapiens} PDB: 3zxi_A* Length = 356 Back     alignment and structure
>1y42_X Tyrosyl-tRNA synthetase, mitochondrial; CYT-18, tRNA ligase, group I intron; HET: TYR; 1.95A {Neurospora crassa} PDB: 2rkj_A Length = 392 Back     alignment and structure
>1y42_X Tyrosyl-tRNA synthetase, mitochondrial; CYT-18, tRNA ligase, group I intron; HET: TYR; 1.95A {Neurospora crassa} PDB: 2rkj_A Length = 392 Back     alignment and structure
>2jan_A Tyrosyl-tRNA synthetase; protein biosynthesis, aminoacyl-tRNA synthetase, tyrrs, ligase, tyrosine, RNA-binding, ATP-binding; 2.9A {Mycobacterium tuberculosis} Length = 432 Back     alignment and structure
>2jan_A Tyrosyl-tRNA synthetase; protein biosynthesis, aminoacyl-tRNA synthetase, tyrrs, ligase, tyrosine, RNA-binding, ATP-binding; 2.9A {Mycobacterium tuberculosis} Length = 432 Back     alignment and structure
>2ts1_A Tyrosyl-tRNA synthetase; ligase (synthetase); 2.30A {Geobacillus stearothermophilus} SCOP: c.26.1.1 PDB: 3ts1_A* 1tyd_E* 1tya_E* 1tyc_A 1tyb_E* 4ts1_A* 1jh3_A Length = 419 Back     alignment and structure
>2ts1_A Tyrosyl-tRNA synthetase; ligase (synthetase); 2.30A {Geobacillus stearothermophilus} SCOP: c.26.1.1 PDB: 3ts1_A* 1tyd_E* 1tya_E* 1tyc_A 1tyb_E* 4ts1_A* 1jh3_A Length = 419 Back     alignment and structure
>1jil_A Tyrrs, tyrosyl-tRNA synthetase; truncation, based inhibitor design, ligase; HET: 485; 2.20A {Staphylococcus aureus} SCOP: c.26.1.1 PDB: 1jij_A* 1jii_A* 1jik_A* Length = 420 Back     alignment and structure
>1jil_A Tyrrs, tyrosyl-tRNA synthetase; truncation, based inhibitor design, ligase; HET: 485; 2.20A {Staphylococcus aureus} SCOP: c.26.1.1 PDB: 1jij_A* 1jii_A* 1jik_A* Length = 420 Back     alignment and structure
>2yxn_A Tyrosyl-tRNA synthetase; tRNA synthetases class I, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: AZY; 1.80A {Escherichia coli str} PDB: 1wq3_A* 1wq4_A* 1x8x_A* 1vbn_A* 1vbm_A* Length = 322 Back     alignment and structure
>2yxn_A Tyrosyl-tRNA synthetase; tRNA synthetases class I, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: AZY; 1.80A {Escherichia coli str} PDB: 1wq3_A* 1wq4_A* 1x8x_A* 1vbn_A* 1vbm_A* Length = 322 Back     alignment and structure
>1h3f_A Tyrosyl-tRNA synthetase; ligase, aminoacyl-tRNA synthetase; HET: TYE; 2.00A {Thermus thermophilus} SCOP: c.26.1.1 d.66.1.4 PDB: 1h3e_A* Length = 432 Back     alignment and structure
>1h3f_A Tyrosyl-tRNA synthetase; ligase, aminoacyl-tRNA synthetase; HET: TYE; 2.00A {Thermus thermophilus} SCOP: c.26.1.1 d.66.1.4 PDB: 1h3e_A* Length = 432 Back     alignment and structure
>2zp1_A Tyrosyl-tRNA synthetase; tRNA synthetases class I, ligase, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, nucleotide-binding; HET: IYR; 1.70A {Methanocaldococcus jannaschii} PDB: 1zh6_A* 1j1u_A* 1u7d_A 2q1g_A* 2pxh_A* 1zh0_A* 2q1i_A* 2ag6_A* 3qe4_A* 3d6u_A* 3d6v_A* 1u7x_A 3n2y_A* 2hgz_A* Length = 314 Back     alignment and structure
>2cya_A Tyrosyl-tRNA synthetase; tyrrs, aminoacylation, structural genomics, NPPSFA, national on protein structural and functional analyses; 2.20A {Aeropyrum pernix} Length = 364 Back     alignment and structure
>2cyb_A Tyrosyl-tRNA synthetase; rossmann-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: TYR; 1.80A {Archaeoglobus fulgidus} Length = 323 Back     alignment and structure
>1n3l_A Tyrosyl-tRNA synthetase; rossmann fold AS catalytic domain, unique anticodon recognit domain, dimer, ligase; 1.18A {Homo sapiens} SCOP: c.26.1.1 PDB: 1q11_A* Length = 372 Back     alignment and structure
>2dlc_X Tyrosyl-tRNA synthetase, cytoplasmic; tyrrs, ligase-tRNA complex; HET: 2MG OMG M2G PSU 6IA 5MC 5MU 1MA YMP; 2.40A {Saccharomyces cerevisiae} Length = 394 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query362
3p0j_A 690 Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase 100.0
2ts1_A419 Tyrosyl-tRNA synthetase; ligase (synthetase); 2.30 100.0
1jil_A420 Tyrrs, tyrosyl-tRNA synthetase; truncation, based 100.0
1h3f_A432 Tyrosyl-tRNA synthetase; ligase, aminoacyl-tRNA sy 100.0
2jan_A432 Tyrosyl-tRNA synthetase; protein biosynthesis, ami 100.0
2pid_A356 Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase 99.97
1y42_X392 Tyrosyl-tRNA synthetase, mitochondrial; CYT-18, tR 99.97
1jil_A 420 Tyrrs, tyrosyl-tRNA synthetase; truncation, based 99.97
2ts1_A 419 Tyrosyl-tRNA synthetase; ligase (synthetase); 2.30 99.97
2jan_A 432 Tyrosyl-tRNA synthetase; protein biosynthesis, ami 99.97
1y42_X 392 Tyrosyl-tRNA synthetase, mitochondrial; CYT-18, tR 99.97
2yxn_A322 Tyrosyl-tRNA synthetase; tRNA synthetases class I, 99.97
1h3f_A 432 Tyrosyl-tRNA synthetase; ligase, aminoacyl-tRNA sy 99.96
2yxn_A 322 Tyrosyl-tRNA synthetase; tRNA synthetases class I, 99.96
2pid_A 356 Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase 99.96
2j5b_A 348 Tyrosyl-tRNA synthetase; ligase, protein biosynthe 99.93
2cya_A 364 Tyrosyl-tRNA synthetase; tyrrs, aminoacylation, st 99.92
1r6u_A 437 Tryptophanyl-tRNA synthetase; class IC tRNA synthe 99.92
2cyc_A 375 Tyrosyl-tRNA synthetase; tyrosine, tyrrs, aminoacy 99.92
2zp1_A 314 Tyrosyl-tRNA synthetase; tRNA synthetases class I, 99.92
2ip1_A 432 Tryptophanyl-tRNA synthetase; rossmann fold, struc 99.92
3vgj_A 373 Tyrosyl-tRNA synthetase, putative; tyrrs, ligase; 99.92
1r6t_A 477 Tryptophanyl-tRNA synthetase; class IC tRNA synthe 99.91
3hv0_A 393 Tryptophanyl-tRNA synthetase; tRNA-ligase, ATP-bin 99.9
3foc_A 451 Tryptophanyl-tRNA synthetase; structural genomics, 99.9
3vgj_A373 Tyrosyl-tRNA synthetase, putative; tyrrs, ligase; 99.89
2j5b_A348 Tyrosyl-tRNA synthetase; ligase, protein biosynthe 99.88
3i05_A 395 Tryptophanyl-tRNA synthetase; APO tRNA-ligase, ATP 99.88
2cya_A364 Tyrosyl-tRNA synthetase; tyrrs, aminoacylation, st 99.87
2cyc_A375 Tyrosyl-tRNA synthetase; tyrosine, tyrrs, aminoacy 99.87
3tzl_A 322 Tryptophanyl-tRNA synthetase; structural genomics, 99.87
2cyb_A 323 Tyrosyl-tRNA synthetase; rossmann-fold, structural 99.87
3p0j_A 690 Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase 99.87
2el7_A 337 Tryptophanyl-tRNA synthetase; aminoacyl-tRNA synth 99.86
3tze_A 406 Tryptophanyl-tRNA synthetase; structural genomics, 99.85
3jxe_A 392 Tryptophanyl-tRNA synthetase; adenosine triphospha 99.85
1n3l_A 372 Tyrosyl-tRNA synthetase; rossmann fold AS catalyti 99.84
2dlc_X 394 Tyrosyl-tRNA synthetase, cytoplasmic; tyrrs, ligas 99.84
2g36_A 340 Tryptophanyl-tRNA synthetase; TM0492, structural g 99.84
3hzr_A 386 Tryptophanyl-tRNA synthetase; APO tRNA-ligase, str 99.84
2cyb_A323 Tyrosyl-tRNA synthetase; rossmann-fold, structural 99.84
1yi8_B 351 Tryptophanyl-tRNA synthetase; ligase; HET: TRP; 2. 99.82
2zp1_A314 Tyrosyl-tRNA synthetase; tRNA synthetases class I, 99.82
1r6u_A437 Tryptophanyl-tRNA synthetase; class IC tRNA synthe 99.81
3hv0_A393 Tryptophanyl-tRNA synthetase; tRNA-ligase, ATP-bin 99.81
1n3l_A372 Tyrosyl-tRNA synthetase; rossmann fold AS catalyti 99.81
2dlc_X394 Tyrosyl-tRNA synthetase, cytoplasmic; tyrrs, ligas 99.8
3foc_A451 Tryptophanyl-tRNA synthetase; structural genomics, 99.78
3i05_A395 Tryptophanyl-tRNA synthetase; APO tRNA-ligase, ATP 99.77
1r6t_A477 Tryptophanyl-tRNA synthetase; class IC tRNA synthe 99.76
2ip1_A432 Tryptophanyl-tRNA synthetase; rossmann fold, struc 99.76
3jxe_A392 Tryptophanyl-tRNA synthetase; adenosine triphospha 99.75
1i6k_A 328 TRPRS, tryptophanyl-tRNA synthetase; class I tRNA 99.69
3tzl_A322 Tryptophanyl-tRNA synthetase; structural genomics, 99.69
3tze_A406 Tryptophanyl-tRNA synthetase; structural genomics, 99.69
2el7_A337 Tryptophanyl-tRNA synthetase; aminoacyl-tRNA synth 99.69
2yy5_A 348 Tryptophanyl-tRNA synthetase; aminoaccyl tRNA synt 99.67
1yi8_B351 Tryptophanyl-tRNA synthetase; ligase; HET: TRP; 2. 99.66
3hzr_A386 Tryptophanyl-tRNA synthetase; APO tRNA-ligase, str 99.65
3a04_A 372 Tryptophanyl-tRNA synthetase; ligase, aminoacyl-tR 99.64
3prh_A 388 Tryptophanyl-tRNA synthetase; TRPRS, protein biosy 99.61
3sz3_A 341 Tryptophanyl-tRNA synthetase; structural genomics, 99.61
2g36_A340 Tryptophanyl-tRNA synthetase; TM0492, structural g 99.6
3n9i_A 346 Tryptophanyl-tRNA synthetase; tryptophan-tRNA liga 99.58
1i6k_A328 TRPRS, tryptophanyl-tRNA synthetase; class I tRNA 99.49
2yy5_A348 Tryptophanyl-tRNA synthetase; aminoaccyl tRNA synt 99.38
3sz3_A341 Tryptophanyl-tRNA synthetase; structural genomics, 99.29
3prh_A388 Tryptophanyl-tRNA synthetase; TRPRS, protein biosy 99.14
3n9i_A346 Tryptophanyl-tRNA synthetase; tryptophan-tRNA liga 99.06
3a04_A372 Tryptophanyl-tRNA synthetase; ligase, aminoacyl-tR 98.93
>3p0j_A Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, tyrrs, pseudod translation, ATP-binding, nucleotide-binding, ligase; HET: TYE; 2.89A {Leishmania major} PDB: 3p0i_A* 3p0h_A* Back     alignment and structure
Probab=100.00  E-value=5.2e-36  Score=317.18  Aligned_cols=279  Identities=11%  Similarity=-0.035  Sum_probs=214.4

Q ss_pred             hHHHHHHHHhc-CchhhHH-----HHHhcccCCCcceEEeeeCC-----CcchhhhhhhhhhHhhhhcccccchhhhhhc
Q psy14958         17 MNCREILSEIF-GLKYFLS-----PLLSRGSASTQGISRYKLSP-----CGHLLAENIKKEWVRSCVLRREEPAFLYSQQ   85 (362)
Q Consensus        17 ~~~~~~~~~~~-g~~~~~~-----~~~~~~~~~~~~~~~~g~dp-----~gh~~~~~~~~~~~~~~~~~~~~~~~~~~~~   85 (362)
                      |+..|.++.+. |+.|++.     ++|   .+++|++++.||||     +||.++..+              +++.||+.
T Consensus         9 ~~~~~~~~~~~~~~~e~~~~~eL~~~L---~~~~~~~vy~G~~PTg~lHLG~~v~~~~--------------~~~~lQ~~   71 (690)
T 3p0j_A            9 MNTDERYKLLRSVGEECIQESELRNLI---EKKPLIRCYDGFEPSGRMHIAQGIFKAV--------------NVNKCTAA   71 (690)
T ss_dssp             CCHHHHHHHHHHTCSEEECHHHHHHHH---HHCTTEEEEEEECCCSCCBHHHHHHHHH--------------HHHHHHHT
T ss_pred             cCHHHHHHHHhhCceeecCHHHHHHHH---hcCCCceEEeeecCCCcchhHhhHHHHH--------------HHHHHHHC
Confidence            67788899888 8766554     444   34789999999999     789776542              57889999


Q ss_pred             CCCccccchhhhhhhcccceeEEEcCccccccCCCCCCcccCCCCHHHHHHHHHHHHHHHHHHHhhhhhhhhcccCCCCC
Q psy14958         86 GDCENETDLQDMFLTTKELSNGKIGGATAQVGDPSGKTKDRDKQDLATVQTNTKGIEKNIKTIFRNHEQYFWKDRKDSLK  165 (362)
Q Consensus        86 g~~~~~~~~~~~~~~~~~~~~~lIGg~Ta~IGDPSGr~~~R~~Lt~e~i~~Na~~i~~Qi~~il~n~~~~~~~~~~~~~~  165 (362)
                      |  |.+              +++|||+||+||||||++.       |+|++|+..+.+++. .+..           +++
T Consensus        72 G--~~~--------------~~lIaD~ha~~~d~~~~~~-------e~i~~~~~~~~~~~l-A~Gl-----------Dp~  116 (690)
T 3p0j_A           72 G--CEF--------------VFWVADWFALMNDKVGGEL-------EKIRIVGRYLIEVWK-AAGM-----------DMD  116 (690)
T ss_dssp             T--EEE--------------EEEECCGGGGGGCTTTTHH-------HHHHHHHHHHHHHHH-HTTC-----------CGG
T ss_pred             C--CcE--------------EEEEeeeEEEecCCCcchH-------HHHHHHHHHHHHHHH-HcCC-----------ChH
Confidence            8  999              7999999999999999975       668999966655433 3211           277


Q ss_pred             CcEEEeChhhhccCC--HHHHHHHHHhhhhhhhhhhhc--------------------------------ccCccchhHH
Q psy14958        166 PPIVVNNMSWYNSIN--VIDFMNHIARLFRMGDMLKKQ--------------------------------SVGGSDQMGN  211 (362)
Q Consensus       166 ~~~i~nN~~Wl~~m~--~~dfL~~lg~~f~v~~ML~Rd--------------------------------~iGGsDQ~~N  211 (362)
                      +++|++||+|+..++  +..++.++++++||++|++++                                ..||+||++|
T Consensus       117 k~~i~~qS~~v~~~~~l~~~~~~~i~~~~tv~~m~~~~~~~~r~~~~i~~g~f~YPlLQAaDil~~~ad~vpvG~DQ~~~  196 (690)
T 3p0j_A          117 KVLFLWSSEEITSHADTYWRMVLDIGRQNTIARIKKCCTIMGKTEGTLTAAQVLYPLMQCCDIFFLKADICQLGLDQRKV  196 (690)
T ss_dssp             GEEEEEHHHHHTTSHHHHHHHHHHHHHTSCHHHHHTTC-------CCCCCSCSSHHHHHHHHHHHTTCSEECCBGGGHHH
T ss_pred             HeEEEechHHHHhhHHHHHHHHHHHHhhCCHHHHHhhhhhhhhccCCCchhhHhhHHHHHHHHHhhCCCEEeccccHHHH
Confidence            899999999999886  356777799999999999875                                2599999999


Q ss_pred             Hhhcccchhccccc------e---eeeec-----cCCCCc-eeecc----------------------------------
Q psy14958        212 IKAGHDLISKLYGK------T---VFDLL-----VRTPQT-VYAGF----------------------------------  242 (362)
Q Consensus       212 I~rGrdLi~r~~gq------e---Lp~LL-----~sksl~-~YiG~----------------------------------  242 (362)
                      +..+|+++++....      +   ++.|.     .|||.+ +||++                                  
T Consensus       197 l~l~Rdla~r~n~~~~p~~l~~~~l~gL~dG~~KMSKS~~~~~I~L~D~p~~i~kKI~~A~td~~~~~~~~~~d~g~~~~  276 (690)
T 3p0j_A          197 NMLAREYCDLIGRKLKPVILSHHMLAGLKQGQAKMSKSDPDSAIFMEDTEEDVARKIRQAYCPRVKQSASAITDDGAPVA  276 (690)
T ss_dssp             HHHHHHHHHHTTCCCCCEEEEBCCCCCSSTTCSSCBTTBGGGSCBTTCCHHHHHHHHHTSCCCSSCCCCCCCCTTCCCCC
T ss_pred             HHHHHHHHHHhCCCCCceEeecCeeecCCCCCcCCCCCCCCCeeeccCCHHHHHHHHHhCcCCCcccccccccCCCCccc
Confidence            99999998754221      0   11210     022221 11110                                  


Q ss_pred             --------------------------------------------------------------------------------
Q psy14958        243 --------------------------------------------------------------------------------  242 (362)
Q Consensus       243 --------------------------------------------------------------------------------  242 (362)
                                                                                                      
T Consensus       277 ~~~~~~v~~y~~~~~~~~~~~~~~~~~~~~~~~eel~~~y~~G~l~~~dlK~~lae~i~~~L~Pirer~~~~~~~~~~l~  356 (690)
T 3p0j_A          277 TDDRNPVLDYFQCVVYARPGAAATIDGTTYATYEDLEQAFVSDEVSEDALKSCLIDEVNALLEPVRQHFASNEEAHELLE  356 (690)
T ss_dssp             CSSCCHHHHHHHHTTTTSTTCCEEETTEEESSHHHHHHHHHHTSSCHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHH
T ss_pred             CCCCchHHHHHHHhhcccccccccccCCCcchHHHHHHHHHcCCCCHHHHHHHHHHHHHHHHHHHHHHHHhchhhHHHHH
Confidence                                                                                            


Q ss_pred             -------------------------------CCCCCCcchhhHhHHHH-HHHHHHc--CCceEEeecchhHHhhc-----
Q psy14958        243 -------------------------------DPTASSLHIGNLLILIN-LIHWQRA--GHQVIALMICLSQILWR-----  283 (362)
Q Consensus       243 -------------------------------dpTa~~lHlGhlmsil~-lr~fq~~--G~~~i~lIg~i~~~l~~-----  283 (362)
                                                     -|+..++|+||++++++ ++.|+.+  ||.++++|||+|+++++     
T Consensus       357 ~v~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~ps~g~lHLGh~v~~~k~l~~~~~~~~g~~v~ilIaD~~A~i~d~~g~~  436 (690)
T 3p0j_A          357 AVKSYRKDGATLPLAETALPAAPAKPHACMWMPALLKVPLDVAEGMIKVTKDFIAAHPEGTVTLVLPDWSAVASDEITGV  436 (690)
T ss_dssp             HHHHTCCC-----------CCCCSSCEEEEECCCCSSCBHHHHHHHHHHHHHHHHHCSSCEEEEEECTTHHHHTTCTTCC
T ss_pred             HHHHHhcCCCCCCCcccccCCCCCCcceEEecCCCCCcccchHHHHHHHHHHHHHHcCCCeEEEEEecchhhhCCCCCCC
Confidence                                           13344799999999999 9999999  99999999999877641     


Q ss_pred             ------------------C-CCceEEEechhhhcCC---CHHHHHHHHHhhccHHHHHchhHHHhhhhcCCCCcchhhhh
Q psy14958        284 ------------------T-CNEEAVVNNMSWYNSI---NVIDFMNHIARLFRMGDMLKKQSVVTRLESEHGMNYTEFSY  341 (362)
Q Consensus       284 ------------------~-~~~~~Iv~NsdW~~~~---~~~dfL~~vgk~~tl~~mL~rd~~~~Rl~~~~gis~~Ef~Y  341 (362)
                                        + .++++|++||+|+...   .+.++++ +++++|++||+++.      . +++++++||+|
T Consensus       437 ~e~i~~~~~y~~~~~~alG~d~k~~fv~~S~~~~~~~~~~~~~vi~-la~~~tl~r~~~~~------~-~~~~~i~~~~Y  508 (690)
T 3p0j_A          437 EKDISAALQVNCALLKAYGLPSSVKIVTENEVILGNCDDFWVSVIG-IARKNLLSHVEELY------G-GEVRNAGQVIA  508 (690)
T ss_dssp             HHHHHHHHHHHHHHHHHHTCCTTSEEEEHHHHHHHTHHHHHHHHHH-HHTTSCHHHHHHHT------T-SCCSSHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHhcCCCcCeEEEECCchhccchhhHHHHHHH-HHHhhhHHHHHHHh------C-CCCcchHHHHH
Confidence                              2 2479999999999875   3456776 99999999999753      2 46789999999


Q ss_pred             hhHhHHhHHHHhhh
Q psy14958        342 QIFQSYDWAHLYKE  355 (362)
Q Consensus       342 pllQayDf~~L~~~  355 (362)
                      |+|||||+++|..+
T Consensus       509 PlmQaaDi~~l~aD  522 (690)
T 3p0j_A          509 ALMRVATALMLSVS  522 (690)
T ss_dssp             HHHHHHHHHHTTCS
T ss_pred             HHHHHhhhhccCCC
Confidence            99999999998653
>2ts1_A Tyrosyl-tRNA synthetase; ligase (synthetase); 2.30A {Geobacillus stearothermophilus} SCOP: c.26.1.1 PDB: 3ts1_A* 1tyd_E* 1tya_E* 1tyc_A 1tyb_E* 4ts1_A* 1jh3_A Back     alignment and structure
>1jil_A Tyrrs, tyrosyl-tRNA synthetase; truncation, based inhibitor design, ligase; HET: 485; 2.20A {Staphylococcus aureus} SCOP: c.26.1.1 PDB: 1jij_A* 1jii_A* 1jik_A* Back     alignment and structure
>1h3f_A Tyrosyl-tRNA synthetase; ligase, aminoacyl-tRNA synthetase; HET: TYE; 2.00A {Thermus thermophilus} SCOP: c.26.1.1 d.66.1.4 PDB: 1h3e_A* Back     alignment and structure
>2jan_A Tyrosyl-tRNA synthetase; protein biosynthesis, aminoacyl-tRNA synthetase, tyrrs, ligase, tyrosine, RNA-binding, ATP-binding; 2.9A {Mycobacterium tuberculosis} Back     alignment and structure
>2pid_A Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase, protein-substrate complex, ATP-BI ligase, mitochondrion, nucleotide-binding, protein biosynth; HET: YSA; 2.20A {Homo sapiens} PDB: 3zxi_A* Back     alignment and structure
>1y42_X Tyrosyl-tRNA synthetase, mitochondrial; CYT-18, tRNA ligase, group I intron; HET: TYR; 1.95A {Neurospora crassa} PDB: 2rkj_A Back     alignment and structure
>1jil_A Tyrrs, tyrosyl-tRNA synthetase; truncation, based inhibitor design, ligase; HET: 485; 2.20A {Staphylococcus aureus} SCOP: c.26.1.1 PDB: 1jij_A* 1jii_A* 1jik_A* Back     alignment and structure
>2ts1_A Tyrosyl-tRNA synthetase; ligase (synthetase); 2.30A {Geobacillus stearothermophilus} SCOP: c.26.1.1 PDB: 3ts1_A* 1tyd_E* 1tya_E* 1tyc_A 1tyb_E* 4ts1_A* 1jh3_A Back     alignment and structure
>2jan_A Tyrosyl-tRNA synthetase; protein biosynthesis, aminoacyl-tRNA synthetase, tyrrs, ligase, tyrosine, RNA-binding, ATP-binding; 2.9A {Mycobacterium tuberculosis} Back     alignment and structure
>1y42_X Tyrosyl-tRNA synthetase, mitochondrial; CYT-18, tRNA ligase, group I intron; HET: TYR; 1.95A {Neurospora crassa} PDB: 2rkj_A Back     alignment and structure
>2yxn_A Tyrosyl-tRNA synthetase; tRNA synthetases class I, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: AZY; 1.80A {Escherichia coli str} PDB: 1wq3_A* 1wq4_A* 1x8x_A* 1vbn_A* 1vbm_A* Back     alignment and structure
>1h3f_A Tyrosyl-tRNA synthetase; ligase, aminoacyl-tRNA synthetase; HET: TYE; 2.00A {Thermus thermophilus} SCOP: c.26.1.1 d.66.1.4 PDB: 1h3e_A* Back     alignment and structure
>2yxn_A Tyrosyl-tRNA synthetase; tRNA synthetases class I, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: AZY; 1.80A {Escherichia coli str} PDB: 1wq3_A* 1wq4_A* 1x8x_A* 1vbn_A* 1vbm_A* Back     alignment and structure
>2pid_A Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase, protein-substrate complex, ATP-BI ligase, mitochondrion, nucleotide-binding, protein biosynth; HET: YSA; 2.20A {Homo sapiens} PDB: 3zxi_A* Back     alignment and structure
>2j5b_A Tyrosyl-tRNA synthetase; ligase, protein biosynthesis, ATP-binding; HET: TYE; 2.20A {Acanthamoeba polyphaga mimivirus} Back     alignment and structure
>2cya_A Tyrosyl-tRNA synthetase; tyrrs, aminoacylation, structural genomics, NPPSFA, national on protein structural and functional analyses; 2.20A {Aeropyrum pernix} Back     alignment and structure
>1r6u_A Tryptophanyl-tRNA synthetase; class IC tRNA synthetase, rossmann fold catalytic domain, AN recognition domain, bound Trp-AMP, ligase; HET: TYM; 2.00A {Homo sapiens} SCOP: c.26.1.1 PDB: 1ulh_A 2dr2_A* 2ake_A* 1o5t_A Back     alignment and structure
>2cyc_A Tyrosyl-tRNA synthetase; tyrosine, tyrrs, aminoacylation, structural genomics; HET: TYR; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>2zp1_A Tyrosyl-tRNA synthetase; tRNA synthetases class I, ligase, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, nucleotide-binding; HET: IYR; 1.70A {Methanocaldococcus jannaschii} PDB: 1zh6_A* 1j1u_A* 1u7d_A 2q1g_A* 2pxh_A* 1zh0_A* 2q1i_A* 2ag6_A* 3qe4_A* 3d6u_A* 3d6v_A* 1u7x_A 3n2y_A* 2hgz_A* Back     alignment and structure
>2ip1_A Tryptophanyl-tRNA synthetase; rossmann fold, structural genomics, PSI-2, protein structure initiative; HET: PG4; 1.80A {Saccharomyces cerevisiae} PDB: 3kt0_A* 3kt3_A* 3kt6_A* 3kt8_A* Back     alignment and structure
>3vgj_A Tyrosyl-tRNA synthetase, putative; tyrrs, ligase; HET: YAP; 2.21A {Plasmodium falciparum} Back     alignment and structure
>1r6t_A Tryptophanyl-tRNA synthetase; class IC tRNA synthetase, rossmann fold catalytical domain, recognition domain, bound Trp-AMP, ligase; HET: TYM; 2.10A {Homo sapiens} SCOP: a.16.1.3 c.26.1.1 PDB: 2azx_A* 2quh_A* 2qui_A* 2quj_A* 2quk_A Back     alignment and structure
>3hv0_A Tryptophanyl-tRNA synthetase; tRNA-ligase, ATP-binding, aminoacyl-tRNA synthetase, ligase, nucleotide-binding; HET: TRP; 2.42A {Cryptosporidium parvum iowa II} SCOP: c.26.1.0 Back     alignment and structure
>3foc_A Tryptophanyl-tRNA synthetase; structural genomics, giardiasi aminoacyl-tRNA synthetase, ligase; 2.09A {Giardia lamblia atcc 50803} Back     alignment and structure
>3vgj_A Tyrosyl-tRNA synthetase, putative; tyrrs, ligase; HET: YAP; 2.21A {Plasmodium falciparum} Back     alignment and structure
>2j5b_A Tyrosyl-tRNA synthetase; ligase, protein biosynthesis, ATP-binding; HET: TYE; 2.20A {Acanthamoeba polyphaga mimivirus} Back     alignment and structure
>3i05_A Tryptophanyl-tRNA synthetase; APO tRNA-ligase, ATP-binding, aminoacyl-tRNA synthetase, LIG nucleotide-binding, protein biosynthesis; 2.80A {Trypanosoma brucei} SCOP: c.26.1.0 Back     alignment and structure
>2cya_A Tyrosyl-tRNA synthetase; tyrrs, aminoacylation, structural genomics, NPPSFA, national on protein structural and functional analyses; 2.20A {Aeropyrum pernix} Back     alignment and structure
>2cyc_A Tyrosyl-tRNA synthetase; tyrosine, tyrrs, aminoacylation, structural genomics; HET: TYR; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3tzl_A Tryptophanyl-tRNA synthetase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta structure; HET: ADP TRP; 2.15A {Campylobacter jejuni subsp} SCOP: c.26.1.0 PDB: 3m5w_A* Back     alignment and structure
>2cyb_A Tyrosyl-tRNA synthetase; rossmann-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: TYR; 1.80A {Archaeoglobus fulgidus} Back     alignment and structure
>3p0j_A Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, tyrrs, pseudod translation, ATP-binding, nucleotide-binding, ligase; HET: TYE; 2.89A {Leishmania major} PDB: 3p0i_A* 3p0h_A* Back     alignment and structure
>2el7_A Tryptophanyl-tRNA synthetase; aminoacyl-tRNA synthetase, translation, structural GEN NPPSFA; 2.50A {Thermus thermophilus} Back     alignment and structure
>3tze_A Tryptophanyl-tRNA synthetase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, amino acylation; HET: TRP; 2.60A {Encephalitozoon cuniculi} Back     alignment and structure
>3jxe_A Tryptophanyl-tRNA synthetase; adenosine triphosphate, rossmann fold, crystallography, X-RAY, P. horikoshii, aminoacyl-tRNA synthetase; HET: TYM; 3.00A {Pyrococcus horikoshii} Back     alignment and structure
>1n3l_A Tyrosyl-tRNA synthetase; rossmann fold AS catalytic domain, unique anticodon recognit domain, dimer, ligase; 1.18A {Homo sapiens} SCOP: c.26.1.1 PDB: 1q11_A* Back     alignment and structure
>2dlc_X Tyrosyl-tRNA synthetase, cytoplasmic; tyrrs, ligase-tRNA complex; HET: 2MG OMG M2G PSU 6IA 5MC 5MU 1MA YMP; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2g36_A Tryptophanyl-tRNA synthetase; TM0492, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI, ligase; HET: TRP; 2.50A {Thermotoga maritima} Back     alignment and structure
>3hzr_A Tryptophanyl-tRNA synthetase; APO tRNA-ligase, structural genomics, medical structural GEN pathogenic protozoa, MSGPP, ligase; 3.00A {Entamoeba histolytica} Back     alignment and structure
>2cyb_A Tyrosyl-tRNA synthetase; rossmann-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: TYR; 1.80A {Archaeoglobus fulgidus} Back     alignment and structure
>1yi8_B Tryptophanyl-tRNA synthetase; ligase; HET: TRP; 2.10A {Deinococcus radiodurans} PDB: 1yia_B* 1yid_B* 2a4m_A* Back     alignment and structure
>2zp1_A Tyrosyl-tRNA synthetase; tRNA synthetases class I, ligase, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, nucleotide-binding; HET: IYR; 1.70A {Methanocaldococcus jannaschii} PDB: 1zh6_A* 1j1u_A* 1u7d_A 2q1g_A* 2pxh_A* 1zh0_A* 2q1i_A* 2ag6_A* 3qe4_A* 3d6u_A* 3d6v_A* 1u7x_A 3n2y_A* 2hgz_A* Back     alignment and structure
>1r6u_A Tryptophanyl-tRNA synthetase; class IC tRNA synthetase, rossmann fold catalytic domain, AN recognition domain, bound Trp-AMP, ligase; HET: TYM; 2.00A {Homo sapiens} SCOP: c.26.1.1 PDB: 1ulh_A 2dr2_A* 2ake_A* 1o5t_A Back     alignment and structure
>3hv0_A Tryptophanyl-tRNA synthetase; tRNA-ligase, ATP-binding, aminoacyl-tRNA synthetase, ligase, nucleotide-binding; HET: TRP; 2.42A {Cryptosporidium parvum iowa II} SCOP: c.26.1.0 Back     alignment and structure
>1n3l_A Tyrosyl-tRNA synthetase; rossmann fold AS catalytic domain, unique anticodon recognit domain, dimer, ligase; 1.18A {Homo sapiens} SCOP: c.26.1.1 PDB: 1q11_A* Back     alignment and structure
>2dlc_X Tyrosyl-tRNA synthetase, cytoplasmic; tyrrs, ligase-tRNA complex; HET: 2MG OMG M2G PSU 6IA 5MC 5MU 1MA YMP; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3foc_A Tryptophanyl-tRNA synthetase; structural genomics, giardiasi aminoacyl-tRNA synthetase, ligase; 2.09A {Giardia lamblia atcc 50803} Back     alignment and structure
>3i05_A Tryptophanyl-tRNA synthetase; APO tRNA-ligase, ATP-binding, aminoacyl-tRNA synthetase, LIG nucleotide-binding, protein biosynthesis; 2.80A {Trypanosoma brucei} SCOP: c.26.1.0 Back     alignment and structure
>1r6t_A Tryptophanyl-tRNA synthetase; class IC tRNA synthetase, rossmann fold catalytical domain, recognition domain, bound Trp-AMP, ligase; HET: TYM; 2.10A {Homo sapiens} SCOP: a.16.1.3 c.26.1.1 PDB: 2azx_A* 2quh_A* 2qui_A* 2quj_A* 2quk_A Back     alignment and structure
>2ip1_A Tryptophanyl-tRNA synthetase; rossmann fold, structural genomics, PSI-2, protein structure initiative; HET: PG4; 1.80A {Saccharomyces cerevisiae} PDB: 3kt0_A* 3kt3_A* 3kt6_A* 3kt8_A* Back     alignment and structure
>3jxe_A Tryptophanyl-tRNA synthetase; adenosine triphosphate, rossmann fold, crystallography, X-RAY, P. horikoshii, aminoacyl-tRNA synthetase; HET: TYM; 3.00A {Pyrococcus horikoshii} Back     alignment and structure
>1i6k_A TRPRS, tryptophanyl-tRNA synthetase; class I tRNA synthetase, AARS, induced FIT, ligase; HET: TYM; 1.72A {Geobacillus stearothermophilus} SCOP: c.26.1.1 PDB: 1i6l_A* 1i6m_A* 1m83_A* 1mau_A* 1maw_A* 1mb2_A* 2ov4_A* 3fhj_A* 3fi0_A* 1d2r_A 3u1v_A Back     alignment and structure
>3tzl_A Tryptophanyl-tRNA synthetase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta structure; HET: ADP TRP; 2.15A {Campylobacter jejuni subsp} SCOP: c.26.1.0 PDB: 3m5w_A* Back     alignment and structure
>3tze_A Tryptophanyl-tRNA synthetase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, amino acylation; HET: TRP; 2.60A {Encephalitozoon cuniculi} Back     alignment and structure
>2el7_A Tryptophanyl-tRNA synthetase; aminoacyl-tRNA synthetase, translation, structural GEN NPPSFA; 2.50A {Thermus thermophilus} Back     alignment and structure
>2yy5_A Tryptophanyl-tRNA synthetase; aminoaccyl tRNA synthetase, structural genomics, NPPSFA; HET: WSA; 2.55A {Mycoplasma pneumoniae} Back     alignment and structure
>1yi8_B Tryptophanyl-tRNA synthetase; ligase; HET: TRP; 2.10A {Deinococcus radiodurans} PDB: 1yia_B* 1yid_B* 2a4m_A* Back     alignment and structure
>3hzr_A Tryptophanyl-tRNA synthetase; APO tRNA-ligase, structural genomics, medical structural GEN pathogenic protozoa, MSGPP, ligase; 3.00A {Entamoeba histolytica} Back     alignment and structure
>3a04_A Tryptophanyl-tRNA synthetase; ligase, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, nucleotide-binding, protein biosynthesis; 1.97A {Aeropyrum pernix} PDB: 3a05_A* Back     alignment and structure
>3prh_A Tryptophanyl-tRNA synthetase; TRPRS, protein biosynthesis, translation, class I tRNA synth rossman fold, high motif, KMSKS motif; 2.80A {Bacillus subtilis} Back     alignment and structure
>3sz3_A Tryptophanyl-tRNA synthetase; structural genomics, center for structural genomics of infec diseases, csgid, rossmann fold; HET: TRP; 1.50A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>2g36_A Tryptophanyl-tRNA synthetase; TM0492, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI, ligase; HET: TRP; 2.50A {Thermotoga maritima} Back     alignment and structure
>3n9i_A Tryptophanyl-tRNA synthetase; tryptophan-tRNA ligase, csgid, structural genomics, niaid, center for structural genomics infectious diseases; 1.95A {Yersinia pestis} SCOP: c.26.1.1 Back     alignment and structure
>1i6k_A TRPRS, tryptophanyl-tRNA synthetase; class I tRNA synthetase, AARS, induced FIT, ligase; HET: TYM; 1.72A {Geobacillus stearothermophilus} SCOP: c.26.1.1 PDB: 1i6l_A* 1i6m_A* 1m83_A* 1mau_A* 1maw_A* 1mb2_A* 2ov4_A* 3fhj_A* 3fi0_A* 1d2r_A 3u1v_A Back     alignment and structure
>2yy5_A Tryptophanyl-tRNA synthetase; aminoaccyl tRNA synthetase, structural genomics, NPPSFA; HET: WSA; 2.55A {Mycoplasma pneumoniae} Back     alignment and structure
>3sz3_A Tryptophanyl-tRNA synthetase; structural genomics, center for structural genomics of infec diseases, csgid, rossmann fold; HET: TRP; 1.50A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3prh_A Tryptophanyl-tRNA synthetase; TRPRS, protein biosynthesis, translation, class I tRNA synth rossman fold, high motif, KMSKS motif; 2.80A {Bacillus subtilis} Back     alignment and structure
>3n9i_A Tryptophanyl-tRNA synthetase; tryptophan-tRNA ligase, csgid, structural genomics, niaid, center for structural genomics infectious diseases; 1.95A {Yersinia pestis} SCOP: c.26.1.1 Back     alignment and structure
>3a04_A Tryptophanyl-tRNA synthetase; ligase, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, nucleotide-binding, protein biosynthesis; 1.97A {Aeropyrum pernix} PDB: 3a05_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 362
d2ts1a_ 319 c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Bac 8e-21
d1jila_ 323 c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Sta 7e-19
d1h3fa1 343 c.26.1.1 (A:5-347) Tyrosyl-tRNA synthetase (TyrRS) 3e-13
d1n3la_ 339 c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Hum 1e-10
d1j1ua_ 306 c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Arc 4e-10
d1r6ta2 386 c.26.1.1 (A:82-467) Tryptophanyl-tRNA synthetase ( 3e-05
>d2ts1a_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Length = 319 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Nucleotidylyl transferase
family: Class I aminoacyl-tRNA synthetases (RS), catalytic domain
domain: Tyrosyl-tRNA synthetase (TyrRS)
species: Bacillus stearothermophilus, nca 1503 [TaxId: 1422]

 Score = 89.4 bits (221), Expect = 8e-21
 Identities = 51/169 (30%), Positives = 78/169 (46%), Gaps = 37/169 (21%)

Query: 229 DLLVRTPQTVYAGFDPTASSLHIGNLLILINLIHWQRAGHQVIALMI------------- 275
            LL     T+Y GFDPTA SLHIG+L  ++ +  +Q+AGH+ IAL+              
Sbjct: 24  KLLNEERVTLYCGFDPTADSLHIGHLATILTMRRFQQAGHRPIALVGGATGLIGDPSGKK 83

Query: 276 ----------------------CLSQILWRTCNEEAVVNNMSWYNSINVIDFMNHIARLF 313
                                           N   + NN  W   ++VI F+  + + F
Sbjct: 84  SERTLNAKETVEAWSARIKEQLGRFLDFEADGNPAKIKNNYDWIGPLDVITFLRDVGKHF 143

Query: 314 RMGDMLKKQSVVTRLESEHGMNYTEFSYQIFQSYDWAHLYKEHNCRFQA 362
            +  M+ K+SV +R+  E G+++TEFSY + Q+YD+  LY+   CR Q 
Sbjct: 144 SVNYMMAKESVQSRI--ETGISFTEFSYMMLQAYDFLRLYETEGCRLQI 190
>d1jila_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Staphylococcus aureus [TaxId: 1280]} Length = 323 Back     information, alignment and structure
>d1h3fa1 c.26.1.1 (A:5-347) Tyrosyl-tRNA synthetase (TyrRS) {Thermus thermophilus [TaxId: 274]} Length = 343 Back     information, alignment and structure
>d1n3la_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Human (Homo sapiens) [TaxId: 9606]} Length = 339 Back     information, alignment and structure
>d1j1ua_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 306 Back     information, alignment and structure
>d1r6ta2 c.26.1.1 (A:82-467) Tryptophanyl-tRNA synthetase (TrpRS) {Human (Homo sapiens) [TaxId: 9606]} Length = 386 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query362
d1jila_323 Tyrosyl-tRNA synthetase (TyrRS) {Staphylococcus au 100.0
d2ts1a_319 Tyrosyl-tRNA synthetase (TyrRS) {Bacillus stearoth 100.0
d2ts1a_ 319 Tyrosyl-tRNA synthetase (TyrRS) {Bacillus stearoth 100.0
d1jila_ 323 Tyrosyl-tRNA synthetase (TyrRS) {Staphylococcus au 100.0
d1h3fa1343 Tyrosyl-tRNA synthetase (TyrRS) {Thermus thermophi 99.93
d1h3fa1 343 Tyrosyl-tRNA synthetase (TyrRS) {Thermus thermophi 99.93
d1j1ua_ 306 Tyrosyl-tRNA synthetase (TyrRS) {Archaeon Methanoc 99.89
d1n3la_ 339 Tyrosyl-tRNA synthetase (TyrRS) {Human (Homo sapie 99.88
d1r6ta2 386 Tryptophanyl-tRNA synthetase (TrpRS) {Human (Homo 99.84
d1n3la_339 Tyrosyl-tRNA synthetase (TyrRS) {Human (Homo sapie 99.74
d1j1ua_306 Tyrosyl-tRNA synthetase (TyrRS) {Archaeon Methanoc 99.7
d1r6ta2386 Tryptophanyl-tRNA synthetase (TrpRS) {Human (Homo 99.57
d1i6la_ 326 Tryptophanyl-tRNA synthetase (TrpRS) {Bacillus ste 99.3
d1i6la_326 Tryptophanyl-tRNA synthetase (TrpRS) {Bacillus ste 93.79
d1li5a2 315 Cysteinyl-tRNA synthetase (CysRS) {Escherichia col 87.17
d1irxa2 317 Class I lysyl-tRNA synthetase {Archaeon Pyrococcus 86.41
>d1jila_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Nucleotidylyl transferase
family: Class I aminoacyl-tRNA synthetases (RS), catalytic domain
domain: Tyrosyl-tRNA synthetase (TyrRS)
species: Staphylococcus aureus [TaxId: 1280]

Probab=100.00  E-value=6.8e-46  Score=360.10  Aligned_cols=195  Identities=27%  Similarity=0.365  Sum_probs=172.8

Q ss_pred             CCCcceEEeeeCC------CcchhhhhhhhhhHhhhhcccccchhhhhhcCCCccccchhhhhhhcccceeEEEcCcccc
Q psy14958         42 ASTQGISRYKLSP------CGHLLAENIKKEWVRSCVLRREEPAFLYSQQGDCENETDLQDMFLTTKELSNGKIGGATAQ  115 (362)
Q Consensus        42 ~~~~~~~~~g~dp------~gh~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~lIGg~Ta~  115 (362)
                      +++|+++|+||||      +||+|+++               +|++||+.|  |.+              |+||||+||+
T Consensus        28 ~~~~~~~Y~G~DPTa~sLHlGhlv~l~---------------~l~~~q~~G--h~~--------------i~LiG~~T~~   76 (323)
T d1jila_          28 NKEQVTLYCGADPTADSLHIGHLLPFL---------------TLRRFQEHG--HRP--------------IVLIGGGTGM   76 (323)
T ss_dssp             HHSCCEEEEEECCSSSSCBHHHHHHHH---------------HHHHHHHTT--CEE--------------EEEECTTGGG
T ss_pred             hCCCcEEEEcccCCCccccHHHHHHHH---------------HHHHHHHhC--Cce--------------EEeehhhhhh
Confidence            4679999999999      89999999               999999999  999              8999999999


Q ss_pred             ccCCCCCCcccCCCCHHHHHHHHHHHHHHHHHHHhhhhhhhhcccCCCCCCcEEEeChhhhccCCHHHHHHHHHhhhhhh
Q psy14958        116 VGDPSGKTKDRDKQDLATVQTNTKGIEKNIKTIFRNHEQYFWKDRKDSLKPPIVVNNMSWYNSINVIDFMNHIARLFRMG  195 (362)
Q Consensus       116 IGDPSGr~~~R~~Lt~e~i~~Na~~i~~Qi~~il~n~~~~~~~~~~~~~~~~~i~nN~~Wl~~m~~~dfL~~lg~~f~v~  195 (362)
                      |||||||+++|+.++.|+|++|+++|+.|+.+++++.          ++.+++|+||++||++++++|||+++|++|||+
T Consensus        77 iGDPsgk~~~R~~l~~~~i~~n~~~~~~~~~~~~~~~----------~~~~~~i~~n~~w~~~~~~~~~l~~~~~~~~v~  146 (323)
T d1jila_          77 IGDPSGKSEERVLQTEEQVDKNIEGISKQMHNIFEFG----------TDHGAVLVNNRDWLGQISLISFLRDYGKHVGVN  146 (323)
T ss_dssp             TCCCTTCSSCCCCCCHHHHHHHHHHHHHHHHHHSCCS----------SSSSCEEEETHHHHTTCCHHHHHHHTGGGCCHH
T ss_pred             ccCCCccchhhhhhhHHHHHHHHhhhhhhhhhhhhcc----------cccceEEechhhhhccchHHHHHHHHhhhhhhh
Confidence            9999999999999999999999999999999998741          256789999999999999999999999999999


Q ss_pred             hhhhhc------------------------------------ccCccchhHHHhhcccchhccccc------eeeeec--
Q psy14958        196 DMLKKQ------------------------------------SVGGSDQMGNIKAGHDLISKLYGK------TVFDLL--  231 (362)
Q Consensus       196 ~ML~Rd------------------------------------~iGGsDQ~~NI~rGrdLi~r~~gq------eLp~LL--  231 (362)
                      +||+||                                    ++||+|||+||++|++++++..++      +.|++.  
T Consensus       147 ~ml~~d~~~~R~~~~is~~Ef~YpllQ~~Df~~l~~~~~~~iqiGGsDQ~~Ni~~Grdl~~~~~~~~~~~~it~pLl~~~  226 (323)
T d1jila_         147 YMLGKDSIQSRLEHGISYTEFTYTILQAIDFGHLNRELNCKIQVGGSDQWGNITSGIELMRRMYGQTDAYGLTIPLVTKS  226 (323)
T ss_dssp             HHHTCGGGHHHHTTTCCHHHHHHHHHHHHHHHHHHHHHCEEEEEEEGGGHHHHHHHHHHHHHHHCCCCCEEEEECCCBCT
T ss_pred             HHHHhHHHHHHhcccccHhhHHHHHHHHHHHHHHHHHhhchhhhhccccHHHhhhhhhhhhhhcccccceEEecccccch
Confidence            999998                                    369999999999999999976443      345554  


Q ss_pred             ----cCCCCceeeccCCC---CCCcchhhHhHH---HHHHHHHHcCCceEEeecchh
Q psy14958        232 ----VRTPQTVYAGFDPT---ASSLHIGNLLIL---INLIHWQRAGHQVIALMICLS  278 (362)
Q Consensus       232 ----~sksl~~YiG~dpT---a~~lHlGhlmsi---l~lr~fq~~G~~~i~lIg~i~  278 (362)
                          .+||.++|+++|+.   |.++ +|++|++   .+++|+..+.+.+...|..+.
T Consensus       227 ~G~Km~KS~~n~i~l~~~~tsP~~~-y~k~~n~~D~~i~~yl~~~T~l~~~ei~~l~  282 (323)
T d1jila_         227 DGKKFGKSESGAVWLDAEKTSPYEF-YQFWINQSDEDVIKFLKYFTFLGKEEIDRLE  282 (323)
T ss_dssp             TSCBTTBCSSSBCBSSTTTSCHHHH-HHHHHTCCHHHHHHHHHHHCCCCHHHHHHHH
T ss_pred             hhhhhhhcCCCCeeeecccCChHHH-HHHhhcCCHHHHHHHHHHHhcCCHHHHHHHH
Confidence                26899999999983   5445 9999998   999999998888766665544
>d2ts1a_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Back     information, alignment and structure
>d2ts1a_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Back     information, alignment and structure
>d1jila_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1h3fa1 c.26.1.1 (A:5-347) Tyrosyl-tRNA synthetase (TyrRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1h3fa1 c.26.1.1 (A:5-347) Tyrosyl-tRNA synthetase (TyrRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1j1ua_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1n3la_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6ta2 c.26.1.1 (A:82-467) Tryptophanyl-tRNA synthetase (TrpRS) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n3la_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j1ua_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1r6ta2 c.26.1.1 (A:82-467) Tryptophanyl-tRNA synthetase (TrpRS) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i6la_ c.26.1.1 (A:) Tryptophanyl-tRNA synthetase (TrpRS) {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1i6la_ c.26.1.1 (A:) Tryptophanyl-tRNA synthetase (TrpRS) {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1li5a2 c.26.1.1 (A:1-315) Cysteinyl-tRNA synthetase (CysRS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1irxa2 c.26.1.1 (A:3-319) Class I lysyl-tRNA synthetase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure