Psyllid ID: psy15014

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280------
MLQTGSGKTYTMGTGFETDVSEEMLGIIPRAITHLFEGIQNIAEQARQNGDTPPEVVVQAQFLELYNEEVSGLEHITCVQAHSIYSSSDSDSNSEDRQSVDSAYSAELANLTTEIDIKQKLIEELEKSHRRMQGIKQHYEDKFQQLQAKIRSTEEERDKVLASLNKNNTFRFQIIDLFDDTRDYGLSKMKSNIKIHEDSGHSIYVTGATSKSIRSAQEAMNALRQGALSRTTASTQMNSQSSRSHAIFTLHIQQKRLVKVEDPEGEIGEFLLFLTFPTGSASEFYF
cccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEEEEEHHHHHccccccccccccEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEEccccccccccccccccEEEccccccEEEcccEEEEEccHHHHHHHHHHHHHccHHHHcccccccccccEEEEEEEEEEEccccccccccEEEEcccccccccccccccc
cccccccccEcccccccccccHHHccHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEEEEEcHHHHHHHHHHHHHEcEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHcccHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEHHHHHHHHcccccccccccEcEEEcccccEEEcccccEEEccHHHHHHHHHHHHHHHHcccccHHHHHHHcEEEEEEEEEEEEcccccEEEEEEHcHcccccccccccccccc
mlqtgsgktytmgtgfetdvsEEMLGIIPRAITHLFEGIQNIAEQArqngdtppeVVVQAQFLELYNEEvsglehitcvqahsiysssdsdsnsedrqsvDSAYSAELANLTTEIDIKQKLIEELEKSHRRMQGIKQHYEDKFQQLQAKIRSTEEERDKVLASLNKNNTFRFQIIDLFDDtrdyglskmksnikihedsghsiyvtgATSKSIRSAQEAMNALRQGALSRttastqmnsqssrsHAIFTLHIQQKRlvkvedpegeigEFLLFltfptgsasefyf
mlqtgsgktytmgtgFETDVSEEMLGIIPRAITHLFEGIQNIAEQARQNGDTPPEVVVQAQFLELYNEEVSGLEHITCVQAHSIysssdsdsnsEDRQSVDSAYSAELANLTTEIDIKQKLIEELEKSHRRMQGIKQHYEDKFQQLQAKIRSTEEERDKVLAslnknntfrfqiiDLFDDTRDYGLSKMKsnikihedsghsiyVTGATSKSIRSAQEAMNALRQGALSRTTASTQMNSQSSRSHAIFTLHIQQKRLVKVEDPEGEIGEFLlfltfptgsasefyf
MLQTGSGKTYTMGTGFETDVSEEMLGIIPRAITHLFEGIQNIAEQARQNGDTPPEVVVQAQFLELYNEEVSGLEHITCVQAHsiysssdsdsnsedrqsVDSAYSAELANLTTEIDIKQKLIEELEKSHRRMQGIKQHYEDKFQQLQAKIRSTEEERDKVLASLNKNNTFRFQIIDLFDDTRDYGLSKMKSNIKIHEDSGHSIYVTGATSKSIRSAQEAMNALRQGALSRTTASTQMNSQSSRSHAIFTLHIQQKRLVKVEDPEGEIGEFLLFLTFPTGSASEFYF
*************TGFETDVSEEMLGIIPRAITHLFEGIQNIAE*********PEVVVQAQFLELYNEEVSGLEHITCVQAHSIY***************************TEIDI*******************************************LASLNKNNTFRFQIIDLFDDTRDYGLSKMKSNIKIH****HSIYV****************************************AIFTLHIQQKRLVKVEDPEGEIGEFLLFLTFPT********
MLQTGSGKTYTMGTG**********GIIPRAITHLFEGIQN***********PPEVVVQAQFLELYNEEVSGLEHITCVQA***********NSEDRQSVDSAYSA******************************QHYEDKFQQLQA**********KVLASLNKNNTFRFQIIDLFDDTRD***************SGHSIYVTGATSKSIRSAQEAMNALRQGALSRTTASTQMNSQSSRSHAIFTLHIQ****************FLLFLTFPTGSA*****
MLQTGSGKTYTMGTGFETDVSEEMLGIIPRAITHLFEGIQNIAEQARQNGDTPPEVVVQAQFLELYNEEVSGLEHITCVQAHSI*****************SAYSAELANLTTEIDIKQKLIEELEKSHRRMQGIKQHYEDKFQQLQAKIRSTEEERDKVLASLNKNNTFRFQIIDLFDDTRDYGLSKMKSNIKIHEDSGHSIYVTGATSKSIRSAQEAMNALRQGAL***************SHAIFTLHIQQKRLVKVEDPEGEIGEFLLFLTFPTGSASEFYF
*********YTMGTGFETDVSEEMLGIIPRAITHLFEGIQNIAEQARQNGDTPPEVVVQAQFLELYNEEVSGLEHITCVQAHSIYSSSDSDSNSEDRQSVDSAYSAELANLTTEIDIKQKLIEELEKSHRRMQGIKQHYEDKFQQLQAKIRSTEEERDKVLASLNKNNTFRFQIIDLFDDTRDYGLSKMKSNIKIHEDSGHSIYVTGATSKSIRSAQEAMNALRQGALSRTTASTQ*NSQSSRSHAIFTLHIQQKRLVKVEDPEGEIGEFLLF*************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLQTGSGKTYTMGTGFETDVSEEMLGIIPRAITHLFEGIQNIAEQARQNGDTPPEVVVQAQFLELYNEEVSGLEHITCVQAHSIYSSSDSDSNSEDRQSVDSAYSAExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLNKNNTFRFQIIDLFDDTRDYGLSKMKSNIKIHEDSGHSIYVTGATSKSIRSAQEAMNALRQGALSRTTASTQMNSQSSRSHAIFTLHIQQKRLVKVEDPEGEIGEFLLFLTFPTGSASEFYF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query286 2.2.26 [Sep-21-2011]
Q9QXL1 1668 Kinesin-like protein KIF2 yes N/A 0.398 0.068 0.512 2e-24
O75037 1637 Kinesin-like protein KIF2 yes N/A 0.304 0.053 0.6 9e-24
Q9QXL2 1672 Kinesin-like protein KIF2 no N/A 0.398 0.068 0.466 3e-23
Q7Z4S6 1674 Kinesin-like protein KIF2 no N/A 0.300 0.051 0.569 2e-22
Q91784 1226 Chromosome-associated kin N/A N/A 0.283 0.066 0.443 2e-12
Q2VIQ3 1234 Chromosome-associated kin no N/A 0.272 0.063 0.452 2e-12
Q90640 1225 Chromosome-associated kin no N/A 0.272 0.063 0.457 3e-12
P33174 1231 Chromosome-associated kin no N/A 0.307 0.071 0.390 4e-12
O95239 1232 Chromosome-associated kin no N/A 0.272 0.063 0.440 5e-12
P56536239 Kinesin heavy chain isofo no N/A 0.335 0.401 0.34 5e-10
>sp|Q9QXL1|KI21B_MOUSE Kinesin-like protein KIF21B OS=Mus musculus GN=Kif21b PE=1 SV=2 Back     alignment and function desciption
 Score =  112 bits (281), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 76/119 (63%), Gaps = 5/119 (4%)

Query: 173 QIIDLFDDTRDYGLSKMKSNIKIHEDSGHSIYVTGATSKSIRSAQEAMNALRQGALSRTT 232
           +I+DLFD TRD      +SNIKIHED+   IY TG TS+ I S +E +  L+QGALSRTT
Sbjct: 154 EILDLFDSTRDPDARHRRSNIKIHEDANGGIYTTGVTSRLINSQEELIQCLKQGALSRTT 213

Query: 233 ASTQMNSQSSRSHAIFTLHIQQKRLVKVEDPEGEIGEFLLFLTFPTGS-----ASEFYF 286
           ASTQMN QSSRSHAIFT+H+ Q R+    D   E    L     PTG+      ++F+F
Sbjct: 214 ASTQMNVQSSRSHAIFTIHLCQMRVCAQPDLVNETVTGLPDGAAPTGTEYETLTAKFHF 272
Microtubule-binding motor protein probably involved in neuronal dendritic transport. In vitro, has a plus-end directed motor activity.
Mus musculus (taxid: 10090)
>sp|O75037|KI21B_HUMAN Kinesin-like protein KIF21B OS=Homo sapiens GN=KIF21B PE=1 SV=2 Back     alignment and function description
>sp|Q9QXL2|KI21A_MOUSE Kinesin-like protein KIF21A OS=Mus musculus GN=Kif21a PE=1 SV=2 Back     alignment and function description
>sp|Q7Z4S6|KI21A_HUMAN Kinesin-like protein KIF21A OS=Homo sapiens GN=KIF21A PE=1 SV=2 Back     alignment and function description
>sp|Q91784|KIF4_XENLA Chromosome-associated kinesin KIF4 OS=Xenopus laevis GN=kif4 PE=2 SV=1 Back     alignment and function description
>sp|Q2VIQ3|KIF4B_HUMAN Chromosome-associated kinesin KIF4B OS=Homo sapiens GN=KIF4B PE=2 SV=2 Back     alignment and function description
>sp|Q90640|KIF4_CHICK Chromosome-associated kinesin KIF4 OS=Gallus gallus GN=KIF4 PE=2 SV=1 Back     alignment and function description
>sp|P33174|KIF4_MOUSE Chromosome-associated kinesin KIF4 OS=Mus musculus GN=Kif4 PE=2 SV=3 Back     alignment and function description
>sp|O95239|KIF4A_HUMAN Chromosome-associated kinesin KIF4A OS=Homo sapiens GN=KIF4A PE=1 SV=3 Back     alignment and function description
>sp|P56536|KIF5C_RAT Kinesin heavy chain isoform 5C (Fragment) OS=Rattus norvegicus GN=Kif5c PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query286
328701148 1495 PREDICTED: kinesin-like protein KIF21A-l 0.300 0.057 0.677 8e-27
328701146 1481 PREDICTED: kinesin-like protein KIF21A-l 0.300 0.058 0.677 9e-27
301757635 1635 PREDICTED: kinesin-like protein KIF21B-l 0.398 0.069 0.525 2e-23
410986413 1647 PREDICTED: kinesin-like protein KIF21B [ 0.398 0.069 0.525 2e-23
157821213 1634 kinesin-like protein KIF21B [Rattus norv 0.398 0.069 0.521 4e-23
359319986 1621 PREDICTED: kinesin family member 21B [Ca 0.398 0.070 0.516 7e-23
348577947 1637 PREDICTED: kinesin-like protein KIF21B-l 0.398 0.069 0.525 1e-22
6561829 1668 Kif21b [Mus musculus] 0.398 0.068 0.512 1e-22
341940868 1668 RecName: Full=Kinesin-like protein KIF21 0.398 0.068 0.512 1e-22
148707609 1649 mCG130959 [Mus musculus] 0.398 0.069 0.512 1e-22
>gi|328701148|ref|XP_003241507.1| PREDICTED: kinesin-like protein KIF21A-like isoform 3 [Acyrthosiphon pisum] gi|328701150|ref|XP_001949752.2| PREDICTED: kinesin-like protein KIF21A-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  126 bits (317), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 61/90 (67%), Positives = 73/90 (81%)

Query: 173 QIIDLFDDTRDYGLSKMKSNIKIHEDSGHSIYVTGATSKSIRSAQEAMNALRQGALSRTT 232
           +IIDLFD   DY ++K KS I+IHED  H+IYVTG + K I SA EA++ LRQGALSRTT
Sbjct: 159 EIIDLFDTANDYSIAKNKSGIRIHEDMQHNIYVTGVSWKPINSASEALSNLRQGALSRTT 218

Query: 233 ASTQMNSQSSRSHAIFTLHIQQKRLVKVED 262
           A+T MNSQSSRSHA+FT++IQQKR VK ED
Sbjct: 219 AATAMNSQSSRSHAVFTINIQQKRFVKHED 248

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328701146|ref|XP_003241506.1| PREDICTED: kinesin-like protein KIF21A-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|301757635|ref|XP_002914673.1| PREDICTED: kinesin-like protein KIF21B-like [Ailuropoda melanoleuca] Back     alignment and taxonomy information
>gi|410986413|ref|XP_003999505.1| PREDICTED: kinesin-like protein KIF21B [Felis catus] Back     alignment and taxonomy information
>gi|157821213|ref|NP_001099460.1| kinesin-like protein KIF21B [Rattus norvegicus] gi|149058510|gb|EDM09667.1| kinesin family member 21B (predicted) [Rattus norvegicus] Back     alignment and taxonomy information
>gi|359319986|ref|XP_547366.4| PREDICTED: kinesin family member 21B [Canis lupus familiaris] Back     alignment and taxonomy information
>gi|348577947|ref|XP_003474745.1| PREDICTED: kinesin-like protein KIF21B-like [Cavia porcellus] Back     alignment and taxonomy information
>gi|6561829|gb|AAF17084.1|AF202893_1 Kif21b [Mus musculus] Back     alignment and taxonomy information
>gi|341940868|sp|Q9QXL1.2|KI21B_MOUSE RecName: Full=Kinesin-like protein KIF21B; AltName: Full=Kinesin-like protein KIF6 Back     alignment and taxonomy information
>gi|148707609|gb|EDL39556.1| mCG130959 [Mus musculus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query286
UNIPROTKB|F1M408 1603 F1M408 "Uncharacterized protei 0.388 0.069 0.549 2.9e-43
RGD|1306206 1644 Kif21b "kinesin family member 0.388 0.067 0.549 3.1e-43
MGI|MGI:109234 1668 Kif21b "kinesin family member 0.388 0.066 0.540 1.1e-42
UNIPROTKB|J9P991 1621 KIF21B "Uncharacterized protei 0.398 0.070 0.516 2.6e-42
UNIPROTKB|F1Q188 1636 KIF21B "Uncharacterized protei 0.398 0.069 0.516 2.7e-42
UNIPROTKB|F1NUN8 1621 KIF21B "Uncharacterized protei 0.332 0.058 0.604 1.1e-41
UNIPROTKB|F1NU29 1638 KIF21B "Uncharacterized protei 0.332 0.057 0.604 1.2e-41
RGD|1305126 556 Kif21a "kinesin family member 0.321 0.165 0.554 1.2e-41
UNIPROTKB|F1NA34 1662 KIF21B "Uncharacterized protei 0.332 0.057 0.604 1.2e-41
UNIPROTKB|I3LPA4 1474 KIF21B "Uncharacterized protei 0.374 0.072 0.535 6.2e-41
UNIPROTKB|F1M408 F1M408 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 276 (102.2 bits), Expect = 2.9e-43, Sum P(2) = 2.9e-43
 Identities = 61/111 (54%), Positives = 73/111 (65%)

Query:   173 QIIDLFDDTRDYGLSKMKSNIKIHEDSGHSIYVTGATSKSIRSAQEAMNALRQGALSRTT 232
             +I+DLFD TRD      +SNIKIHED+   IY TG TS+ I S +E +  L+QGALSRTT
Sbjct:   141 EILDLFDSTRDPDARHRRSNIKIHEDANGGIYTTGVTSRLINSQEELIQCLKQGALSRTT 200

Query:   233 ASTQMNSQSSRSHAIFTLHIQQKRLVKVEDPEGEIGEFLLFLTFPTGSASE 283
             ASTQMN QSSRSHAIFT+H+ Q R+    D   E    L   T PTG+  E
Sbjct:   201 ASTQMNVQSSRSHAIFTIHLCQMRVCAQPDLVNETVTGLPDGTAPTGTEYE 251
GO:0003777 "microtubule motor activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005874 "microtubule" evidence=IEA
GO:0005875 "microtubule associated complex" evidence=IEA
GO:0007018 "microtubule-based movement" evidence=IEA
RGD|1306206 Kif21b "kinesin family member 21B" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:109234 Kif21b "kinesin family member 21B" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|J9P991 KIF21B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q188 KIF21B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NUN8 KIF21B "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NU29 KIF21B "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1305126 Kif21a "kinesin family member 21A" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NA34 KIF21B "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|I3LPA4 KIF21B "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query286
cd01372341 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-lik 9e-30
smart00129335 smart00129, KISc, Kinesin motor, catalytic domain 4e-21
pfam00225326 pfam00225, Kinesin, Kinesin motor domain 2e-20
cd01372341 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-lik 1e-19
cd00106328 cd00106, KISc, Kinesin motor domain 1e-19
cd01369325 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kine 8e-19
cd01373337 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP 2e-16
cd01366329 cd01366, KISc_C_terminal, Kinesin motor domain, KI 1e-14
pfam00225326 pfam00225, Kinesin, Kinesin motor domain 5e-14
cd01364352 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC 7e-14
cd01375334 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF 3e-13
cd01365356 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, K 3e-13
COG5059 568 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] 6e-13
cd01370338 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP 8e-13
smart00129335 smart00129, KISc, Kinesin motor, catalytic domain 2e-12
cd01367322 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF 8e-12
cd01368345 cd01368, KISc_KIF23_like, Kinesin motor domain, KI 1e-11
cd00106328 cd00106, KISc, Kinesin motor domain 3e-11
cd01366329 cd01366, KISc_C_terminal, Kinesin motor domain, KI 4e-11
cd01374321 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E 5e-10
cd01374321 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E 3e-09
cd01371333 cd01371, KISc_KIF3, Kinesin motor domain, kinesins 3e-09
cd01364352 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC 5e-09
cd01369325 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kine 3e-08
cd01371333 cd01371, KISc_KIF3, Kinesin motor domain, kinesins 3e-08
cd01376319 cd01376, KISc_KID_like, Kinesin motor domain, KIF2 5e-08
cd01373337 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP 1e-07
cd01365356 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, K 2e-07
cd01363186 cd01363, Motor_domain, Myosin and Kinesin motor do 2e-06
cd01375334 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF 9e-06
PLN03188 1320 PLN03188, PLN03188, kinesin-12 family protein; Pro 1e-05
cd01367322 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF 2e-04
PLN03188 1320 PLN03188, PLN03188, kinesin-12 family protein; Pro 3e-04
COG5059 568 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] 5e-04
cd01370338 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP 5e-04
cd01368345 cd01368, KISc_KIF23_like, Kinesin motor domain, KI 0.003
>gnl|CDD|238668 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-like subfamily Back     alignment and domain information 
 Score =  114 bits (288), Expect = 9e-30
 Identities = 44/101 (43%), Positives = 58/101 (57%), Gaps = 5/101 (4%)

Query: 173 QIIDLFDDTRDYGLSKMKSNIKIHEDSGHSIYVTGATSKSIRSAQEAMNALRQGALSRTT 232
           ++ DL   +        KS I+I EDS  +I + G T  ++ SAQE M+ L QG+LSRTT
Sbjct: 140 EVRDLLSPSTS-----EKSPIQIREDSKGNIIIVGLTEVTVNSAQEVMSCLEQGSLSRTT 194

Query: 233 ASTQMNSQSSRSHAIFTLHIQQKRLVKVEDPEGEIGEFLLF 273
           AST MNSQSSRSHAIFT+ ++Q R      P     +    
Sbjct: 195 ASTAMNSQSSRSHAIFTITLEQTRKNGPIAPMSGDDKNSTL 235

Members of this group seem to perform a variety of functions, and have been implicated in neuronal organelle transport and chromosome segregation during mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second tubulin dimer, about 80 Angstroms along the microtubule. Meanwhile, ATP hydrolysis takes place, and when the second head domain binds to the microtubule, the first domain again replaces ADP with ATP, triggering a conformational change that pulls the first domain forward. Length = 341
>gnl|CDD|214526 smart00129, KISc, Kinesin motor, catalytic domain Back     alignment and domain information
>gnl|CDD|215803 pfam00225, Kinesin, Kinesin motor domain Back     alignment and domain information
>gnl|CDD|238668 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-like subfamily Back     alignment and domain information
>gnl|CDD|238054 cd00106, KISc, Kinesin motor domain Back     alignment and domain information
>gnl|CDD|238665 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup Back     alignment and domain information
>gnl|CDD|238669 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP2-like subgroup Back     alignment and domain information
>gnl|CDD|238662 cd01366, KISc_C_terminal, Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins Back     alignment and domain information
>gnl|CDD|215803 pfam00225, Kinesin, Kinesin motor domain Back     alignment and domain information
>gnl|CDD|238660 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division Back     alignment and domain information
>gnl|CDD|238671 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling Back     alignment and domain information
>gnl|CDD|238661 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, KIF1_like proteins Back     alignment and domain information
>gnl|CDD|227392 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|238666 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP3-like subgroup Back     alignment and domain information
>gnl|CDD|214526 smart00129, KISc, Kinesin motor, catalytic domain Back     alignment and domain information
>gnl|CDD|238663 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF2-like group Back     alignment and domain information
>gnl|CDD|238664 cd01368, KISc_KIF23_like, Kinesin motor domain, KIF23-like subgroup Back     alignment and domain information
>gnl|CDD|238054 cd00106, KISc, Kinesin motor domain Back     alignment and domain information
>gnl|CDD|238662 cd01366, KISc_C_terminal, Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins Back     alignment and domain information
>gnl|CDD|238670 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis Back     alignment and domain information
>gnl|CDD|238670 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis Back     alignment and domain information
>gnl|CDD|238667 cd01371, KISc_KIF3, Kinesin motor domain, kinesins II or KIF3_like proteins Back     alignment and domain information
>gnl|CDD|238660 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division Back     alignment and domain information
>gnl|CDD|238665 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup Back     alignment and domain information
>gnl|CDD|238667 cd01371, KISc_KIF3, Kinesin motor domain, kinesins II or KIF3_like proteins Back     alignment and domain information
>gnl|CDD|238672 cd01376, KISc_KID_like, Kinesin motor domain, KIF22/Kid-like subgroup Back     alignment and domain information
>gnl|CDD|238669 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP2-like subgroup Back     alignment and domain information
>gnl|CDD|238661 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, KIF1_like proteins Back     alignment and domain information
>gnl|CDD|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain Back     alignment and domain information
>gnl|CDD|238671 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling Back     alignment and domain information
>gnl|CDD|215621 PLN03188, PLN03188, kinesin-12 family protein; Provisional Back     alignment and domain information
>gnl|CDD|238663 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF2-like group Back     alignment and domain information
>gnl|CDD|215621 PLN03188, PLN03188, kinesin-12 family protein; Provisional Back     alignment and domain information
>gnl|CDD|227392 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|238666 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP3-like subgroup Back     alignment and domain information
>gnl|CDD|238664 cd01368, KISc_KIF23_like, Kinesin motor domain, KIF23-like subgroup Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 286
KOG4280|consensus 574 100.0
cd01373337 KISc_KLP2_like Kinesin motor domain, KLP2-like sub 100.0
cd01370338 KISc_KIP3_like Kinesin motor domain, KIP3-like sub 100.0
cd01368345 KISc_KIF23_like Kinesin motor domain, KIF23-like s 100.0
KOG0245|consensus 1221 100.0
KOG0243|consensus 1041 100.0
cd01367322 KISc_KIF2_like Kinesin motor domain, KIF2-like gro 100.0
cd01365356 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like p 100.0
cd01375334 KISc_KIF9_like Kinesin motor domain, KIF9-like sub 100.0
PLN03188 1320 kinesin-12 family protein; Provisional 100.0
cd01372341 KISc_KIF4 Kinesin motor domain, KIF4-like subfamil 100.0
cd01374321 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like 100.0
cd01371333 KISc_KIF3 Kinesin motor domain, kinesins II or KIF 100.0
cd01376319 KISc_KID_like Kinesin motor domain, KIF22/Kid-like 100.0
KOG0242|consensus 675 100.0
cd01369325 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy 100.0
KOG0240|consensus 607 100.0
cd01364352 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spind 100.0
KOG0247|consensus 809 100.0
cd01366329 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ 100.0
PF00225335 Kinesin: Kinesin motor domain; InterPro: IPR001752 100.0
smart00129335 KISc Kinesin motor, catalytic domain. ATPase. Micr 100.0
cd00106328 KISc Kinesin motor domain. This catalytic (head) d 100.0
KOG0239|consensus 670 100.0
KOG0246|consensus 676 100.0
KOG0241|consensus 1714 100.0
COG5059 568 KIP1 Kinesin-like protein [Cytoskeleton] 99.96
KOG0244|consensus 913 99.95
cd01363186 Motor_domain Myosin and Kinesin motor domain. Thes 99.85
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 94.19
PF01935229 DUF87: Domain of unknown function DUF87; InterPro: 88.47
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 87.87
COG5059568 KIP1 Kinesin-like protein [Cytoskeleton] 86.43
PF04851184 ResIII: Type III restriction enzyme, res subunit; 85.68
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 84.97
smart00382148 AAA ATPases associated with a variety of cellular 83.28
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 80.81
PRK06620214 hypothetical protein; Validated 80.62
>KOG4280|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.1e-41  Score=338.35  Aligned_cols=156  Identities=36%  Similarity=0.492  Sum_probs=137.8

Q ss_pred             CCCCccccccccccccCCCCCCCCcChHHHHHHHHHHHHHHHHHhhhcCCCCCCeEEEEEEEEEEEcccccccchhhhcc
Q psy15014          1 MLQTGSGKTYTMGTGFETDVSEEMLGIIPRAITHLFEGIQNIAEQARQNGDTPPEVVVQAQFLELYNEEVSGLEHITCVQ   80 (286)
Q Consensus         1 YGqTGSGKTyTm~G~~~~~~~~~~~GIiPRal~~LF~~~~~~~~~~~~~~~~~~~~~v~~S~~EIYnE~i~DLL~~~~~~   80 (286)
                      ||||||||||||.|.     +++..|||||++++||..|+..++        ...|.|+|||+|||||.|+|||.     
T Consensus        92 YGQTGsGKTyTM~G~-----~~~~~GiiPraf~~LF~~I~~~~~--------~~~f~vrvS~lEiYnE~i~DLL~-----  153 (574)
T KOG4280|consen   92 YGQTGSGKTYTMIGP-----DPELRGLIPRAFEHLFRHIDERKE--------KTRFLVRVSYLEIYNESIRDLLS-----  153 (574)
T ss_pred             eccCCCCCceEeeCC-----ChhhCCchhHHHHHHHHHHHhccc--------cceEEEEeehHHHHhHHHHHHhC-----
Confidence            999999999999996     378999999999999999998754        34799999999999999977773     


Q ss_pred             ccccccCCCCCCCccccccchhhhhHhhhcchhhhHHHHHHHHHHHhhhhhccccccchhhHHHHHHHhhhchhhhhhHH
Q psy15014         81 AHSIYSSSDSDSNSEDRQSVDSAYSAELANLTTEIDIKQKLIEELEKSHRRMQGIKQHYEDKFQQLQAKIRSTEEERDKV  160 (286)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (286)
                                                                                                      
T Consensus       154 --------------------------------------------------------------------------------  153 (574)
T KOG4280|consen  154 --------------------------------------------------------------------------------  153 (574)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hhhcccCCCccccccccCCCCCccccccCCCCceEEEcCCCcEEEeccEEEEcCCHHHHHHHHHHHHhcCCcccCCCCCC
Q psy15014        161 LASLNKNNTFRFQIIDLFDDTRDYGLSKMKSNIKIHEDSGHSIYVTGATSKSIRSAQEAMNALRQGALSRTTASTQMNSQ  240 (286)
Q Consensus       161 ~~~~~~~~~~~~~~~dLl~~~~~~~~~~~~~~l~i~e~~~~~v~v~gl~~~~V~S~eea~~lL~~G~~~R~~~sT~~N~~  240 (286)
                                         +..       ...|.|+++++.||||+||+++.|.++++++.+|..|..+|++++|.||.+
T Consensus       154 -------------------~~~-------~~~l~lre~p~~Gv~V~nlse~~v~s~~d~~~~l~~G~~nR~vgat~mn~~  207 (574)
T KOG4280|consen  154 -------------------PVN-------PKGLELREDPKCGVYVENLSEMDVESAEDAQQLLVVGLANRRVGATSMNEE  207 (574)
T ss_pred             -------------------ccC-------cCCceeeEcCCCceEecCcceeecCCHHHHHHHHHHHHhhcchhhccCCcc
Confidence                               221       367999999999999999999999999999999999999999999999999


Q ss_pred             CCCCceeEEEEEEEeeecccCCCCCceeEEEEEEEeCCCCcC
Q psy15014        241 SSRSHAIFTLHIQQKRLVKVEDPEGEIGEFLLFLTFPTGSAS  282 (286)
Q Consensus       241 SSRSHaIftI~v~~~~~~~~~~~~~~~~~s~L~lVDLAGS~~  282 (286)
                      |||||+||||+|++...  ..+.....+.++|+||||||||.
T Consensus       208 SsRSH~ift~~i~~~~~--~~~~~~~~~~~rlnlvDLagsEr  247 (574)
T KOG4280|consen  208 SSRSHAIFTIHIESSEK--SDGGLMSGRSSKLNLVDLAGSER  247 (574)
T ss_pred             cccceEEEEEEEEeecc--cCCCccccccceeeeeeccchhh
Confidence            99999999999999332  22334456778999999999986

>cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup Back     alignment and domain information
>cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup Back     alignment and domain information
>cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup Back     alignment and domain information
>KOG0245|consensus Back     alignment and domain information
>KOG0243|consensus Back     alignment and domain information
>cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group Back     alignment and domain information
>cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins Back     alignment and domain information
>cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling Back     alignment and domain information
>PLN03188 kinesin-12 family protein; Provisional Back     alignment and domain information
>cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily Back     alignment and domain information
>cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis Back     alignment and domain information
>cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins Back     alignment and domain information
>cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup Back     alignment and domain information
>KOG0242|consensus Back     alignment and domain information
>cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup Back     alignment and domain information
>KOG0240|consensus Back     alignment and domain information
>cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division Back     alignment and domain information
>KOG0247|consensus Back     alignment and domain information
>cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins Back     alignment and domain information
>PF00225 Kinesin: Kinesin motor domain; InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport Back     alignment and domain information
>smart00129 KISc Kinesin motor, catalytic domain Back     alignment and domain information
>cd00106 KISc Kinesin motor domain Back     alignment and domain information
>KOG0239|consensus Back     alignment and domain information
>KOG0246|consensus Back     alignment and domain information
>KOG0241|consensus Back     alignment and domain information
>COG5059 KIP1 Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>KOG0244|consensus Back     alignment and domain information
>cd01363 Motor_domain Myosin and Kinesin motor domain Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>COG5059 KIP1 Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query286
2kin_A238 Kinesin (Monomeric) From Rattus Norvegicus Length = 3e-11
4atx_C340 Rigor Kinesin Motor Domain With An Ordered Neck-Lin 5e-10
1mkj_A 349 Human Kinesin Motor Domain With Docked Neck Linker 6e-10
1bg2_A325 Human Ubiquitous Kinesin Motor Domain Length = 325 7e-10
1goj_A 355 Structure Of A Fast Kinesin: Implications For Atpas 7e-10
2y5w_A 365 Crystal Structure Of Drosophila Melanogaster Kinesi 2e-09
2owm_A 443 Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3 2e-07
3dc4_A344 Crystal Structure Of The Drosophila Kinesin Family 1e-06
3pxn_A344 Crystal Structure Of The Drosophila Kinesin Family 1e-06
4h1g_A715 Structure Of Candida Albicans Kar3 Motor Domain Fus 3e-06
3t0q_A349 Motor Domain Structure Of The Kar3-Like Kinesin Fro 5e-06
2vvg_A350 Crystal Structure Of The G.Intestinalis Kinesin 2 G 6e-06
1t5c_A 349 Crystal Structure Of The Motor Domain Of Human Kine 6e-06
1ia0_K 394 Kif1a Head-Microtubule Complex Structure In Atp-For 1e-05
3b6v_A395 Crystal Structure Of The Motor Domain Of Human Kine 1e-05
1i5s_A 367 Crystal Structure Of The Kif1a Motor Domain Complex 2e-05
3lre_A355 Crystal Structure Analysis Of Human Kinesin-8 Motor 2e-05
1i6i_A 366 Crystal Structure Of The Kif1a Motor Domain Complex 2e-05
3u06_A412 Crystal Structure Of The Kinesin-14 Ncdg347d Length 2e-05
2ncd_A420 Ncd (Non-Claret Disjunctional) Dimer From D. Melano 2e-05
1cz7_A406 The Crystal Structure Of A Minus-End Directed Micro 2e-05
1n6m_A409 Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRY 2e-05
1vfv_A 366 Crystal Structure Of The Kif1a Motor Domain Complex 3e-05
2xt3_A344 Human Kif7, A Kinesin Involved In Hedgehog Signalli 3e-05
4a14_A344 Human Kif7, A Kinesin Involved In Hedgehog Signalli 3e-05
2rep_A376 Crystal Structure Of The Motor Domain Of Human Kine 4e-05
2wbe_C373 Kinesin-5-Tubulin Complex With Amppnp Length = 373 4e-05
2wbe_C373 Kinesin-5-Tubulin Complex With Amppnp Length = 373 2e-04
2gry_A420 Crystal Structure Of The Human Kif2 Motor Domain In 5e-05
3gbj_A354 Crystal Structure Of The Motor Domain Of Kinesin Ki 5e-05
3l1c_A383 Kinesin-14 Protein Ncd, T436s Mutant Length = 383 7e-05
3bfn_A 388 Crystal Structure Of The Motor Domain Of Human Kine 8e-05
1v8j_A410 The Crystal Structure Of The Minimal Functional Dom 9e-05
3edl_D331 Kinesin13-Microtubule Ring Complex Length = 331 1e-04
4etp_A403 C-Terminal Motor And Motor Homology Domain Of Kar3v 1e-04
2heh_A387 Crystal Structure Of The Kif2c Motor Domain (Casp T 1e-04
1x88_A359 Human Eg5 Motor Domain Bound To Mg-Adp And Monastro 1e-04
4a1z_A368 Eg5-1 Length = 368 1e-04
4ap0_A370 The Mitotic Kinesin Eg5 In Complex With Mg-Adp And 1e-04
3hqd_A369 Human Kinesin Eg5 Motor Domain In Complex With Ampp 1e-04
4gkr_A371 Structure Of The C-Terminal Motor Domain Of Kar3 Fr 1e-04
4gkr_A371 Structure Of The C-Terminal Motor Domain Of Kar3 Fr 5e-04
4a28_A368 Eg5-2 Length = 368 1e-04
1ii6_A368 Crystal Structure Of The Mitotic Kinesin Eg5 In Com 1e-04
3zcw_A348 Eg5 - New Allosteric Binding Site Length = 348 1e-04
1q0b_A367 Crystal Structure Of The Motor Protein Ksp In Compl 1e-04
4aqv_C373 Model Of Human Kinesin-5 Motor Domain (3hqd) And Ma 1e-04
3b6u_A372 Crystal Structure Of The Motor Domain Of Human Kine 2e-04
3kar_A346 The Motor Domain Of Kinesin-Like Protein Kar3, A Sa 2e-04
1f9w_A347 Crystal Structures Of Mutants Reveal A Signalling P 2e-04
1f9v_A347 Crystal Structures Of Mutants Reveal A Signalling P 2e-04
1f9t_A358 Crystal Structures Of Kinesin Mutants Reveal A Sign 2e-04
1f9u_A347 Crystal Structures Of Mutants Reveal A Signalling P 2e-04
1sdm_A 369 Crystal Structure Of Kinesin-Like Calmodulin Bindin 3e-04
>pdb|2KIN|A Chain A, Kinesin (Monomeric) From Rattus Norvegicus Length = 238 Back     alignment and structure 
Iteration: 1

 Score = 65.5 bits (158), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 59/100 (59%), Gaps = 4/100 (4%)
Query: 161 LASLNKNNTFRFQI--IDLF-DDTRDYGLSKMKSNIKIHEDSGHSIYVTGATSKSIRSAQ 217
           + S+++N  F  ++   +++ D  RD  L   K+N+ +HED     YV G T + + S +
Sbjct: 119 IYSMDENLEFHIKVSYFEIYLDKIRDL-LDVSKTNLAVHEDKNRVPYVKGCTERFVSSPE 177
Query: 218 EAMNALRQGALSRTTASTQMNSQSSRSHAIFTLHIQQKRL 257
           E M+ + +G  +R  A T MN  SSRSH+IF ++I+Q+ +
Sbjct: 178 EVMDVIDEGKANRHVAVTNMNEHSSRSHSIFLINIKQENV 217
>pdb|4ATX|C Chain C, Rigor Kinesin Motor Domain With An Ordered Neck-Linker, Docked On Tubulin Dimer, Modelled Into The 8a Cryo-Em Map Of Doublecortin-Microtubules Decorated With Kinesin Length = 340 Back     alignment and structure
>pdb|1MKJ|A Chain A, Human Kinesin Motor Domain With Docked Neck Linker Length = 349 Back     alignment and structure
>pdb|1BG2|A Chain A, Human Ubiquitous Kinesin Motor Domain Length = 325 Back     alignment and structure
>pdb|1GOJ|A Chain A, Structure Of A Fast Kinesin: Implications For Atpase Mechanism And Interactions With Microtubules Length = 355 Back     alignment and structure
>pdb|2Y5W|A Chain A, Crystal Structure Of Drosophila Melanogaster Kinesin-1 Motor Domain Dimer Length = 365 Back     alignment and structure
>pdb|2OWM|A Chain A, Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3) Length = 443 Back     alignment and structure
>pdb|3DC4|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Nod In Complex With Adp Length = 344 Back     alignment and structure
>pdb|3PXN|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Kin10NOD IN Complex With Divalent Manganese And Adp Length = 344 Back     alignment and structure
>pdb|4H1G|A Chain A, Structure Of Candida Albicans Kar3 Motor Domain Fused To Maltose- Binding Protein Length = 715 Back     alignment and structure
>pdb|3T0Q|A Chain A, Motor Domain Structure Of The Kar3-Like Kinesin From Ashbya Gossypii Length = 349 Back     alignment and structure
>pdb|2VVG|A Chain A, Crystal Structure Of The G.Intestinalis Kinesin 2 Gikin2a Motor Domain Length = 350 Back     alignment and structure
>pdb|1T5C|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinetochore Protein Cenp-E Length = 349 Back     alignment and structure
>pdb|1IA0|K Chain K, Kif1a Head-Microtubule Complex Structure In Atp-Form Length = 394 Back     alignment and structure
>pdb|3B6V|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3c In Complex With Adp Length = 395 Back     alignment and structure
>pdb|1I5S|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Adp Length = 367 Back     alignment and structure
>pdb|3LRE|A Chain A, Crystal Structure Analysis Of Human Kinesin-8 Motor Domain Length = 355 Back     alignment and structure
>pdb|1I6I|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppcp Length = 366 Back     alignment and structure
>pdb|3U06|A Chain A, Crystal Structure Of The Kinesin-14 Ncdg347d Length = 412 Back     alignment and structure
>pdb|2NCD|A Chain A, Ncd (Non-Claret Disjunctional) Dimer From D. Melanogaster Length = 420 Back     alignment and structure
>pdb|1CZ7|A Chain A, The Crystal Structure Of A Minus-End Directed Microtubule Motor Protein Ncd Reveals Variable Dimer Conformations Length = 406 Back     alignment and structure
>pdb|1N6M|A Chain A, Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRYSTAL Structure Of The Kinesin Motor Protein, Ncd Length = 409 Back     alignment and structure
>pdb|1VFV|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppnp Length = 366 Back     alignment and structure
>pdb|2XT3|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 Back     alignment and structure
>pdb|4A14|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 Back     alignment and structure
>pdb|2REP|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member C1 Length = 376 Back     alignment and structure
>pdb|2WBE|C Chain C, Kinesin-5-Tubulin Complex With Amppnp Length = 373 Back     alignment and structure
>pdb|2WBE|C Chain C, Kinesin-5-Tubulin Complex With Amppnp Length = 373 Back     alignment and structure
>pdb|2GRY|A Chain A, Crystal Structure Of The Human Kif2 Motor Domain In Complex With Adp Length = 420 Back     alignment and structure
>pdb|3GBJ|A Chain A, Crystal Structure Of The Motor Domain Of Kinesin Kif13b Bound With Adp Length = 354 Back     alignment and structure
>pdb|3L1C|A Chain A, Kinesin-14 Protein Ncd, T436s Mutant Length = 383 Back     alignment and structure
>pdb|3BFN|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 22 Length = 388 Back     alignment and structure
>pdb|1V8J|A Chain A, The Crystal Structure Of The Minimal Functional Domain Of The Microtubule Destabilizer Kif2c Complexed With Mg-adp Length = 410 Back     alignment and structure
>pdb|3EDL|D Chain D, Kinesin13-Microtubule Ring Complex Length = 331 Back     alignment and structure
>pdb|4ETP|A Chain A, C-Terminal Motor And Motor Homology Domain Of Kar3vik1 Fused To A Synthetic Heterodimeric Coiled Coil Length = 403 Back     alignment and structure
>pdb|2HEH|A Chain A, Crystal Structure Of The Kif2c Motor Domain (Casp Target) Length = 387 Back     alignment and structure
>pdb|1X88|A Chain A, Human Eg5 Motor Domain Bound To Mg-Adp And Monastrol Length = 359 Back     alignment and structure
>pdb|4A1Z|A Chain A, Eg5-1 Length = 368 Back     alignment and structure
>pdb|4AP0|A Chain A, The Mitotic Kinesin Eg5 In Complex With Mg-Adp And Ispinesib Length = 370 Back     alignment and structure
>pdb|3HQD|A Chain A, Human Kinesin Eg5 Motor Domain In Complex With Amppnp And Mg2+ Length = 369 Back     alignment and structure
>pdb|4GKR|A Chain A, Structure Of The C-Terminal Motor Domain Of Kar3 From Candida Glabrata Length = 371 Back     alignment and structure
>pdb|4GKR|A Chain A, Structure Of The C-Terminal Motor Domain Of Kar3 From Candida Glabrata Length = 371 Back     alignment and structure
>pdb|4A28|A Chain A, Eg5-2 Length = 368 Back     alignment and structure
>pdb|1II6|A Chain A, Crystal Structure Of The Mitotic Kinesin Eg5 In Complex With Mg-Adp. Length = 368 Back     alignment and structure
>pdb|3ZCW|A Chain A, Eg5 - New Allosteric Binding Site Length = 348 Back     alignment and structure
>pdb|1Q0B|A Chain A, Crystal Structure Of The Motor Protein Ksp In Complex With Adp And Monastrol Length = 367 Back     alignment and structure
>pdb|4AQV|C Chain C, Model Of Human Kinesin-5 Motor Domain (3hqd) And Mammalian Tubulin Heterodimer (1jff) Docked Into The 9.7-angstrom Cryo-em Map Of Microtubule-bound Kinesin-5 Motor Domain In The Ampppnp State. Length = 373 Back     alignment and structure
>pdb|3B6U|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3b In Complex With Adp Length = 372 Back     alignment and structure
>pdb|3KAR|A Chain A, The Motor Domain Of Kinesin-Like Protein Kar3, A Saccharomyces Cerevisiae Kinesin-Related Protein Length = 346 Back     alignment and structure
>pdb|1F9W|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 Back     alignment and structure
>pdb|1F9V|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 Back     alignment and structure
>pdb|1F9T|A Chain A, Crystal Structures Of Kinesin Mutants Reveal A Signalling Pathway For Activation Of The Motor Atpase Length = 358 Back     alignment and structure
>pdb|1F9U|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 Back     alignment and structure
>pdb|1SDM|A Chain A, Crystal Structure Of Kinesin-Like Calmodulin Binding Protein Length = 369 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query286
4a14_A344 Kinesin, kinesin-like protein KIF7; motor protein, 5e-28
4a14_A344 Kinesin, kinesin-like protein KIF7; motor protein, 4e-19
1x88_A359 Kinesin-like protein KIF11; switch II, motor domai 2e-25
1x88_A359 Kinesin-like protein KIF11; switch II, motor domai 1e-15
1bg2_A325 Kinesin; motor protein, ATPase, microtubule associ 4e-25
1bg2_A325 Kinesin; motor protein, ATPase, microtubule associ 1e-15
2y65_A 365 Kinesin, kinesin heavy chain; motor protein; HET: 6e-25
2y65_A365 Kinesin, kinesin heavy chain; motor protein; HET: 2e-15
2wbe_C373 Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit 2e-24
2wbe_C373 Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit 1e-15
2owm_A 443 Nckin3-434, related to kinesin-like protein KIF1C; 3e-24
2owm_A443 Nckin3-434, related to kinesin-like protein KIF1C; 8e-15
3bfn_A 388 Kinesin-like protein KIF22; limited proteolysis, s 1e-23
3bfn_A388 Kinesin-like protein KIF22; limited proteolysis, s 3e-14
3b6u_A 372 Kinesin-like protein KIF3B; structural genomics co 1e-23
3b6u_A372 Kinesin-like protein KIF3B; structural genomics co 3e-14
2zfi_A 366 Kinesin-like protein KIF1A, kinesin heavy chain is 2e-23
2zfi_A366 Kinesin-like protein KIF1A, kinesin heavy chain is 7e-14
1goj_A 355 Kinesin, kinesin heavy chain; motor protein, ATPas 2e-23
1goj_A355 Kinesin, kinesin heavy chain; motor protein, ATPas 2e-14
2h58_A330 Kinesin-like protein KIFC3 variant; motor domain, 6e-23
2h58_A330 Kinesin-like protein KIFC3 variant; motor domain, 8e-15
3lre_A355 Kinesin-like protein KIF18A; motor protein, nucleo 6e-23
3lre_A355 Kinesin-like protein KIF18A; motor protein, nucleo 8e-14
1t5c_A 349 CENP-E protein, centromeric protein E; kinesin mot 3e-22
1t5c_A349 CENP-E protein, centromeric protein E; kinesin mot 2e-13
2nr8_A358 Kinesin-like protein KIF9; motor domain, ADP, stru 3e-22
2nr8_A358 Kinesin-like protein KIF9; motor domain, ADP, stru 8e-14
2vvg_A350 Kinesin-2; motor protein, nucleotide-binding, micr 7e-22
2vvg_A350 Kinesin-2; motor protein, nucleotide-binding, micr 2e-13
3gbj_A354 KIF13B protein; kinesin, motor domain, ADP, struct 8e-22
3gbj_A354 KIF13B protein; kinesin, motor domain, ADP, struct 7e-13
2rep_A376 Kinesin-like protein KIFC1; structural genomics co 1e-21
2rep_A376 Kinesin-like protein KIFC1; structural genomics co 8e-16
1f9v_A347 Kinesin-like protein KAR3; kinesin-related protein 3e-21
1f9v_A347 Kinesin-like protein KAR3; kinesin-related protein 2e-13
3cob_A 369 Kinesin heavy chain-like protein; motor, switch II 3e-21
3cob_A369 Kinesin heavy chain-like protein; motor, switch II 3e-14
1v8k_A410 Kinesin-like protein KIF2C; microtubule destabiliz 8e-21
1v8k_A410 Kinesin-like protein KIF2C; microtubule destabiliz 4e-16
4etp_A403 Kinesin-like protein KAR3; kinesin motor protein, 9e-21
4etp_A403 Kinesin-like protein KAR3; kinesin motor protein, 5e-13
3dc4_A344 Kinesin-like protein NOD; catalytic domain, ATPase 1e-20
3dc4_A344 Kinesin-like protein NOD; catalytic domain, ATPase 2e-19
3t0q_A349 AGR253WP; kinesin, alpha and beta proteins, P-loop 1e-20
3t0q_A349 AGR253WP; kinesin, alpha and beta proteins, P-loop 4e-13
2heh_A387 KIF2C protein; kinesin, motor domain, ADP, structu 2e-20
2heh_A387 KIF2C protein; kinesin, motor domain, ADP, structu 2e-16
1ry6_A 360 Internal kinesin; kinesin motor domain, nucleotide 2e-20
1ry6_A360 Internal kinesin; kinesin motor domain, nucleotide 6e-14
3u06_A 412 Protein claret segregational; motor domain, stalk 4e-20
3u06_A412 Protein claret segregational; motor domain, stalk 3e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
>4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} PDB: 2xt3_A* Length = 344 Back     alignment and structure
 Score =  109 bits (275), Expect = 5e-28
 Identities = 27/135 (20%), Positives = 50/135 (37%), Gaps = 20/135 (14%)

Query: 143 FQQLQAKIRSTEEERDKVLASLNKNNTFRF------QIIDLFDDTRDYGLSKMKSNIKIH 196
             +    I   +     V  S        +      +  DL +            +I++ 
Sbjct: 121 MAEAFKLIDENDLLDCLVHVS--------YLEVYKEEFRDLLEVGTA------SRDIQLR 166

Query: 197 EDSGHSIYVTGATSKSIRSAQEAMNALRQGALSRTTASTQMNSQSSRSHAIFTLHIQQKR 256
           ED   ++ + G     +    E ++ L  G  +R T +T +N  SSRSH +FT+ ++Q+ 
Sbjct: 167 EDERGNVVLCGVKEVDVEGLDEVLSLLEMGNAARHTGATHLNHLSSRSHTVFTVTLEQRG 226

Query: 257 LVKVEDPEGEIGEFL 271
                 P    G+ L
Sbjct: 227 RAPSRLPRPAPGQLL 241
>4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} PDB: 2xt3_A* Length = 344 Back     alignment and structure
>1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Length = 359 Back     alignment and structure
>1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Length = 359 Back     alignment and structure
>1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Length = 325 Back     alignment and structure
>1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Length = 325 Back     alignment and structure
>2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Length = 365 Back     alignment and structure
>2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Length = 365 Back     alignment and structure
>2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Length = 373 Back     alignment and structure
>2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Length = 373 Back     alignment and structure
>2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Length = 443 Back     alignment and structure
>2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Length = 443 Back     alignment and structure
>3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Length = 388 Back     alignment and structure
>3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Length = 388 Back     alignment and structure
>3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Length = 372 Back     alignment and structure
>3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Length = 372 Back     alignment and structure
>2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Length = 366 Back     alignment and structure
>2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Length = 366 Back     alignment and structure
>1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Length = 355 Back     alignment and structure
>1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Length = 355 Back     alignment and structure
>2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Length = 330 Back     alignment and structure
>2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Length = 330 Back     alignment and structure
>3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} Length = 355 Back     alignment and structure
>3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} Length = 355 Back     alignment and structure
>1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Length = 349 Back     alignment and structure
>1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Length = 349 Back     alignment and structure
>2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Length = 350 Back     alignment and structure
>2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Length = 350 Back     alignment and structure
>3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} Length = 354 Back     alignment and structure
>3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} Length = 354 Back     alignment and structure
>2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Length = 376 Back     alignment and structure
>2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Length = 376 Back     alignment and structure
>1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Length = 347 Back     alignment and structure
>1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Length = 347 Back     alignment and structure
>3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Length = 369 Back     alignment and structure
>3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Length = 369 Back     alignment and structure
>1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Length = 410 Back     alignment and structure
>1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Length = 410 Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Length = 403 Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Length = 403 Back     alignment and structure
>3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Length = 344 Back     alignment and structure
>3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Length = 344 Back     alignment and structure
>3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Length = 349 Back     alignment and structure
>3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Length = 349 Back     alignment and structure
>2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Length = 387 Back     alignment and structure
>2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Length = 387 Back     alignment and structure
>1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Length = 360 Back     alignment and structure
>1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Length = 360 Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Length = 412 Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Length = 412 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query286
1t5c_A 349 CENP-E protein, centromeric protein E; kinesin mot 100.0
2vvg_A350 Kinesin-2; motor protein, nucleotide-binding, micr 100.0
2owm_A 443 Nckin3-434, related to kinesin-like protein KIF1C; 100.0
4a14_A344 Kinesin, kinesin-like protein KIF7; motor protein, 100.0
3lre_A355 Kinesin-like protein KIF18A; motor protein, nucleo 100.0
1bg2_A325 Kinesin; motor protein, ATPase, microtubule associ 100.0
2h58_A330 Kinesin-like protein KIFC3 variant; motor domain, 100.0
3cob_A 369 Kinesin heavy chain-like protein; motor, switch II 100.0
2zfi_A 366 Kinesin-like protein KIF1A, kinesin heavy chain is 100.0
3bfn_A 388 Kinesin-like protein KIF22; limited proteolysis, s 100.0
3gbj_A354 KIF13B protein; kinesin, motor domain, ADP, struct 100.0
2heh_A387 KIF2C protein; kinesin, motor domain, ADP, structu 100.0
1v8k_A410 Kinesin-like protein KIF2C; microtubule destabiliz 100.0
2y65_A 365 Kinesin, kinesin heavy chain; motor protein; HET: 100.0
3b6u_A 372 Kinesin-like protein KIF3B; structural genomics co 100.0
1goj_A 355 Kinesin, kinesin heavy chain; motor protein, ATPas 100.0
2nr8_A358 Kinesin-like protein KIF9; motor domain, ADP, stru 100.0
2rep_A376 Kinesin-like protein KIFC1; structural genomics co 100.0
3nwn_A359 Kinesin-like protein KIF9; motor domain, ADP, stru 100.0
2wbe_C373 Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit 100.0
1ry6_A 360 Internal kinesin; kinesin motor domain, nucleotide 100.0
3t0q_A349 AGR253WP; kinesin, alpha and beta proteins, P-loop 100.0
3u06_A 412 Protein claret segregational; motor domain, stalk 100.0
1f9v_A347 Kinesin-like protein KAR3; kinesin-related protein 100.0
1x88_A359 Kinesin-like protein KIF11; switch II, motor domai 100.0
4etp_A403 Kinesin-like protein KAR3; kinesin motor protein, 100.0
4h1g_A715 Maltose binding protein-cakar3 motor domain fusio; 100.0
3dc4_A344 Kinesin-like protein NOD; catalytic domain, ATPase 100.0
2o0a_A298 S.cerevisiae chromosome XVI reading frame ORF YPL2 98.99
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 81.89
>1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=1.2e-43  Score=337.19  Aligned_cols=157  Identities=34%  Similarity=0.509  Sum_probs=135.6

Q ss_pred             CCCCccccccccccccCCCCCCCCcChHHHHHHHHHHHHHHHHHhhhcCCCCCCeEEEEEEEEEEEcccccccchhhhcc
Q psy15014          1 MLQTGSGKTYTMGTGFETDVSEEMLGIIPRAITHLFEGIQNIAEQARQNGDTPPEVVVQAQFLELYNEEVSGLEHITCVQ   80 (286)
Q Consensus         1 YGqTGSGKTyTm~G~~~~~~~~~~~GIiPRal~~LF~~~~~~~~~~~~~~~~~~~~~v~~S~~EIYnE~i~DLL~~~~~~   80 (286)
                      ||||||||||||+|      .++++|||||++++||+.++..         +...|.|++||+|||||+|+|||.     
T Consensus        84 YGqTGSGKTyTM~G------~~~~~Giipr~~~~lF~~i~~~---------~~~~~~v~vS~~EIYnE~i~DLL~-----  143 (349)
T 1t5c_A           84 YGQTASGKTYTMMG------SEDHLGVIPRAIHDIFQKIKKF---------PDREFLLRVSYMEIYNETITDLLC-----  143 (349)
T ss_dssp             EESTTSSHHHHHTB------CSSSBCHHHHHHHHHHHHGGGC---------TTEEEEEEEEEEEEETTEEEESSS-----
T ss_pred             ecCCCCCCCeEEec------CCCCCchHHHHHHHHHHHHHhC---------cCCcEEEEEEEEEEeCCEEEEccC-----
Confidence            99999999999999      5678999999999999999764         256899999999999999987773     


Q ss_pred             ccccccCCCCCCCccccccchhhhhHhhhcchhhhHHHHHHHHHHHhhhhhccccccchhhHHHHHHHhhhchhhhhhHH
Q psy15014         81 AHSIYSSSDSDSNSEDRQSVDSAYSAELANLTTEIDIKQKLIEELEKSHRRMQGIKQHYEDKFQQLQAKIRSTEEERDKV  160 (286)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (286)
                                                                                                      
T Consensus       144 --------------------------------------------------------------------------------  143 (349)
T 1t5c_A          144 --------------------------------------------------------------------------------  143 (349)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hhhcccCCCccccccccCCCCCccccccCCCCceEEEcCCCcEEEeccEEEEcCCHHHHHHHHHHHHhcCCcccCCCCCC
Q psy15014        161 LASLNKNNTFRFQIIDLFDDTRDYGLSKMKSNIKIHEDSGHSIYVTGATSKSIRSAQEAMNALRQGALSRTTASTQMNSQ  240 (286)
Q Consensus       161 ~~~~~~~~~~~~~~~dLl~~~~~~~~~~~~~~l~i~e~~~~~v~v~gl~~~~V~S~eea~~lL~~G~~~R~~~sT~~N~~  240 (286)
                                         +...      ...|+|+|++++++||+||+++.|.+++|++++|..|..+|++++|.||++
T Consensus       144 -------------------~~~~------~~~l~i~ed~~~~~~v~gl~~~~v~s~~e~~~ll~~g~~~R~~~~T~~N~~  198 (349)
T 1t5c_A          144 -------------------GTQK------MKPLIIREDVNRNVYVADLTEEVVYTSEMALKWITKGEKSRHYGETKMNQR  198 (349)
T ss_dssp             -------------------SSCT------TCCEEEEETTTTEEEETTCCCEECSSHHHHHHHHHHHHHTTSSSSSSSSCT
T ss_pred             -------------------CCCC------CCCceEEECCCCCEEecCCEEEEeCCHHHHHHHHHHhhcccccccccCCCC
Confidence                               1111      467999999999999999999999999999999999999999999999999


Q ss_pred             CCCCceeEEEEEEEeeecccCCCCCceeEEEEEEEeCCCCcC
Q psy15014        241 SSRSHAIFTLHIQQKRLVKVEDPEGEIGEFLLFLTFPTGSAS  282 (286)
Q Consensus       241 SSRSHaIftI~v~~~~~~~~~~~~~~~~~s~L~lVDLAGS~~  282 (286)
                      |||||+||+|.|++..........+....++|+||||||||+
T Consensus       199 SSRSH~if~i~v~~~~~~~~~~~~~~~~~skL~lVDLAGSEr  240 (349)
T 1t5c_A          199 SSRSHTIFRMILESREKGEPSNCEGSVKVSHLNLVDLAGSER  240 (349)
T ss_dssp             TTTCEEEEEEEEEEEECC-------CEEEEEEEEEECCCGGG
T ss_pred             CCCceEEEEEEEEEeccCCCcCcCccEEEEEEEEEECCCCcc
Confidence            999999999999997754433344567889999999999996
>2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Back     alignment and structure
>2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Back     alignment and structure
>4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} SCOP: c.37.1.0 PDB: 2xt3_A* Back     alignment and structure
>3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Back     alignment and structure
>2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Back     alignment and structure
>3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Back     alignment and structure
>2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Back     alignment and structure
>3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} SCOP: c.37.1.9 Back     alignment and structure
>2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Back     alignment and structure
>1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Back     alignment and structure
>2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Back     alignment and structure
>3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Back     alignment and structure
>1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Back     alignment and structure
>2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Back     alignment and structure
>3nwn_A Kinesin-like protein KIF9; motor domain, ADP, structural genomics, structural consortium, SGC, contractIle protein; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Back     alignment and structure
>1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Back     alignment and structure
>3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Back     alignment and structure
>1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Back     alignment and structure
>1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>4h1g_A Maltose binding protein-cakar3 motor domain fusio; kinesin motor domain, motor protein, chimera; HET: MTT ADP EDO; 2.15A {Escherichia coli} Back     alignment and structure
>3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Back     alignment and structure
>2o0a_A S.cerevisiae chromosome XVI reading frame ORF YPL253C; VIK1, motor homology domain, kinesin, motor domain, microtubule-binding; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 286
d1x88a1345 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), 4e-08
d2zfia1349 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), 7e-08
d1goja_ 354 c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5 6e-07
d1bg2a_323 c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId 2e-06
d1f9va_342 c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun 7e-06
d1sdma_ 364 c.37.1.9 (A:) Kinesin heavy chain-like protein {Po 4e-04
>d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Length = 345 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Kinesin
species: Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]

 Score = 51.5 bits (122), Expect = 4e-08
 Identities = 26/98 (26%), Positives = 45/98 (45%)

Query: 176 DLFDDTRDYGLSKMKSNIKIHEDSGHSIYVTGATSKSIRSAQEAMNALRQGALSRTTAST 235
           +LFD          +  +     +   + + G    ++ +  E    L +GA  RTTA+T
Sbjct: 150 ELFDLLNPSSDVSERLQMFDDPRNKRGVIIKGLEEITVHNKDEVYQILEKGAAKRTTAAT 209

Query: 236 QMNSQSSRSHAIFTLHIQQKRLVKVEDPEGEIGEFLLF 273
            MN+ SSRSH++F++ I  K      +   +IG+  L 
Sbjct: 210 LMNAYSSRSHSVFSVTIHMKETTIDGEELVKIGKLNLV 247
>d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Length = 349 Back     information, alignment and structure
>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Length = 354 Back     information, alignment and structure
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 364 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query286
d1v8ka_362 Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 100.0
d1sdma_ 364 Kinesin heavy chain-like protein {Potato (Solanum 100.0
d1ry6a_330 Kinesin {Malaria parasite (Plasmodium falciparum) 100.0
d2zfia1349 Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 100.0
d1bg2a_323 Kinesin {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1goja_ 354 Kinesin {Neurospora crassa [TaxId: 5141]} 100.0
d1x88a1345 Kinesin {Human (Homo sapiens), mitotic kinesin eg5 100.0
d2ncda_368 Kinesin motor Ncd (non-claret disjunctional) {Frui 100.0
d1f9va_342 Kinesin motor Ncd (non-claret disjunctional) {Bake 100.0
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 85.86
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 81.16
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 80.8
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 80.8
>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Kinesin
species: Mouse (Mus musculus), kif2c [TaxId: 10090]

Probab=100.00  E-value=5.4e-39  Score=303.67  Aligned_cols=152  Identities=29%  Similarity=0.335  Sum_probs=124.2

Q ss_pred             CCCCccccccccccccCCCCCCCCcChHHHHHHHHHHHHHHHHHhhhcCCCCCCeEEEEEEEEEEEcccccccchhhhcc
Q psy15014          1 MLQTGSGKTYTMGTGFETDVSEEMLGIIPRAITHLFEGIQNIAEQARQNGDTPPEVVVQAQFLELYNEEVSGLEHITCVQ   80 (286)
Q Consensus         1 YGqTGSGKTyTm~G~~~~~~~~~~~GIiPRal~~LF~~~~~~~~~~~~~~~~~~~~~v~~S~~EIYnE~i~DLL~~~~~~   80 (286)
                      ||||||||||||+|+..+.....++||+||++++||..++.....       ...|.|++||+|||||+|+|||..    
T Consensus       120 YGqTGSGKTyTm~G~~~~~~~~~~~Giipr~~~~lf~~~~~~~~~-------~~~~~v~vS~~EIyne~i~DLL~~----  188 (362)
T d1v8ka_         120 YGQTGSGKTHTMGGDLSGKSQNASKGIYAMASRDVFLLKNQPRYR-------NLNLEVYVTFFEIYNGKVFDLLNK----  188 (362)
T ss_dssp             EESTTSSHHHHHHCBC----CBGGGSHHHHHHHHHHHHHTSHHHH-------TTCCEEEEEEEEEETTEEEETTTT----
T ss_pred             eccCCCCCceeeeecCCCCcccccCCeeeehhhhHHHHhhccccc-------ccchhheeeeeeecCCeEEecccC----
Confidence            999999999999997655555668999999999999998765543       568999999999999999888731    


Q ss_pred             ccccccCCCCCCCccccccchhhhhHhhhcchhhhHHHHHHHHHHHhhhhhccccccchhhHHHHHHHhhhchhhhhhHH
Q psy15014         81 AHSIYSSSDSDSNSEDRQSVDSAYSAELANLTTEIDIKQKLIEELEKSHRRMQGIKQHYEDKFQQLQAKIRSTEEERDKV  160 (286)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (286)
                                                                                                      
T Consensus       189 --------------------------------------------------------------------------------  188 (362)
T d1v8ka_         189 --------------------------------------------------------------------------------  188 (362)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hhhcccCCCccccccccCCCCCccccccCCCCceEEEcCCCcEEEeccEEEEcCCHHHHHHHHHHHHhcCCcccCCCCCC
Q psy15014        161 LASLNKNNTFRFQIIDLFDDTRDYGLSKMKSNIKIHEDSGHSIYVTGATSKSIRSAQEAMNALRQGALSRTTASTQMNSQ  240 (286)
Q Consensus       161 ~~~~~~~~~~~~~~~dLl~~~~~~~~~~~~~~l~i~e~~~~~v~v~gl~~~~V~S~eea~~lL~~G~~~R~~~sT~~N~~  240 (286)
                                                   ...+.+++++.+++++.|++++.|.+++|++++|..|..+|.+++|.+|.+
T Consensus       189 -----------------------------~~~~~~~~~~~~~~~v~gl~e~~v~s~~e~~~~l~~g~~~R~~~~T~~N~~  239 (362)
T d1v8ka_         189 -----------------------------KAKLRVLEDSRQQVQVVGLQEYLVTCADDVIKMINMGSACRTSGQTFANSN  239 (362)
T ss_dssp             -----------------------------TEEEEEEECSSCCEEEETCCCEEESSHHHHHHHHHHHHHTCC--------C
T ss_pred             -----------------------------CccccccccccCCcccCCCEEEEecCHHHHHHHHhccccccccccccCccc
Confidence                                         345678999999999999999999999999999999999999999999999


Q ss_pred             CCCCceeEEEEEEEeeecccCCCCCceeEEEEEEEeCCCCcC
Q psy15014        241 SSRSHAIFTLHIQQKRLVKVEDPEGEIGEFLLFLTFPTGSAS  282 (286)
Q Consensus       241 SSRSHaIftI~v~~~~~~~~~~~~~~~~~s~L~lVDLAGS~~  282 (286)
                      |||||+||+|.|.+..          ...++|+||||||||.
T Consensus       240 SSRSH~i~~i~i~~~~----------~~~~~l~~VDLAGsEr  271 (362)
T d1v8ka_         240 SSRSHACFQILLRTKG----------RLHGKFSLVDLAGNER  271 (362)
T ss_dssp             CCSSEEEEEEEEESSS----------SEEEEEEEEECCCCCC
T ss_pred             CcceeeEEEEEEEecc----------eeeeeEeeeecccccc
Confidence            9999999999998632          2467999999999996
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Back     information, alignment and structure
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure