Psyllid ID: psy15111
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 93 | ||||||
| 388503300 | 261 | unknown [Lotus japonicus] | 0.505 | 0.180 | 0.88 | 4e-14 | |
| 281333437 | 712 | 90 kDa heat shock protein [Thitarodes pu | 0.473 | 0.061 | 0.933 | 1e-13 | |
| 409053072 | 716 | heat shock protein 90 [Grapholita molest | 0.483 | 0.062 | 0.913 | 1e-13 | |
| 375112069 | 716 | heat shock protein 90, partial [Cydia po | 0.483 | 0.062 | 0.913 | 1e-13 | |
| 301299151 | 732 | heat shock protein 90 [Macrobrachium nip | 0.526 | 0.066 | 0.816 | 1e-13 | |
| 295722 | 85 | heat shock protein 90 [Gallus gallus] | 0.483 | 0.529 | 0.866 | 1e-13 | |
| 116667188 | 256 | Chain A, Structure Of Human Hsp90-Alpha | 0.655 | 0.238 | 0.682 | 2e-13 | |
| 113208383 | 717 | heat shock protein 90 [Mamestra brassica | 0.473 | 0.061 | 0.909 | 2e-13 | |
| 229597855 | 249 | Chain A, Structure Of Hsp90 Bound With A | 0.591 | 0.220 | 0.7 | 2e-13 | |
| 302565977 | 249 | Chain A, Structure Of Hsp90 With Small M | 0.591 | 0.220 | 0.7 | 2e-13 |
| >gi|388503300|gb|AFK39716.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
Score = 82.0 bits (201), Expect = 4e-14, Method: Compositional matrix adjust.
Identities = 44/50 (88%), Positives = 45/50 (90%), Gaps = 3/50 (6%)
Query: 26 MADN--QSSGDGVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSD 73
M+D Q SGD VETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSD
Sbjct: 1 MSDKMEQESGD-VETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSD 49
|
Source: Lotus japonicus Species: Lotus japonicus Genus: Lotus Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|281333437|gb|ADA61011.1| 90 kDa heat shock protein [Thitarodes pui] | Back alignment and taxonomy information |
|---|
| >gi|409053072|gb|AFV09397.1| heat shock protein 90 [Grapholita molesta] | Back alignment and taxonomy information |
|---|
| >gi|375112069|gb|AFA35118.1| heat shock protein 90, partial [Cydia pomonella] | Back alignment and taxonomy information |
|---|
| >gi|301299151|gb|ADK66920.1| heat shock protein 90 [Macrobrachium nipponense] | Back alignment and taxonomy information |
|---|
| >gi|295722|emb|CAA33132.1| heat shock protein 90 [Gallus gallus] | Back alignment and taxonomy information |
|---|
| >gi|116667188|pdb|2FWY|A Chain A, Structure Of Human Hsp90-Alpha Bound To The Potent Water Soluble Inhibitor Pu-H64 gi|116667189|pdb|2FWZ|A Chain A, Structure Of Human Hsp90-alpha Bound To The Potent Water Soluble Inhibitor Pu-h71 gi|116667585|pdb|2H55|A Chain A, Structure Of Human Hsp90-Alpha Bound To The Potent Water Soluble Inhibitor Pu-Dz8 gi|349587602|pdb|3O0I|A Chain A, Structure Of The Human Hsp90-Alpha N-Domain Bound To The Hsp90 Inhibitor Pu-H54 | Back alignment and taxonomy information |
|---|
| >gi|113208383|dbj|BAF03554.1| heat shock protein 90 [Mamestra brassicae] | Back alignment and taxonomy information |
|---|
| >gi|229597855|pdb|3FT5|A Chain A, Structure Of Hsp90 Bound With A Novel Fragment gi|242556486|pdb|3FT8|A Chain A, Structure Of Hsp90 Bound With A Noval Fragment. gi|300508416|pdb|3HYY|A Chain A, Crystal Structure Of Hsp90 With Fragment 37-D04 gi|300508417|pdb|3HYZ|A Chain A, Crystal Structure Of Hsp90 With Fragment 42-C03 gi|300508418|pdb|3HYZ|B Chain B, Crystal Structure Of Hsp90 With Fragment 42-C03 gi|300508419|pdb|3HZ1|A Chain A, Crystal Structure Of Hsp90 With Fragments 37-D04 And 42-C03 gi|300508420|pdb|3HZ5|A Chain A, Crystal Structure Of Hsp90 With Fragment Z064 gi|302565935|pdb|2XAB|A Chain A, Structure Of Hsp90 With An Inhibitor Bound gi|302565936|pdb|2XAB|B Chain B, Structure Of Hsp90 With An Inhibitor Bound gi|302565980|pdb|2XJX|A Chain A, Structre Of Hsp90 With Small Molecule Inhibitor Bound gi|305677626|pdb|2XDK|A Chain A, Structure Of Hsp90 With Small Molecule Inhibitor Bound gi|305677627|pdb|2XDL|A Chain A, Structure Of Hsp90 With Small Molecule Inhibitor Bound gi|305677628|pdb|2XDS|A Chain A, Structre Of Hsp90 With Small Molecule Inhibitor Bound gi|305677630|pdb|2XDX|A Chain A, Structre Of Hsp90 With Small Molecule Inhibitor Bound gi|305677631|pdb|2XHR|A Chain A, Structure Of Hsp90 With Small Molecule Inhibitor Bound gi|305677632|pdb|2XHT|A Chain A, Structure Of Hsp90 With Small Molecule Inhibitor Bound gi|305677636|pdb|2XK2|A Chain A, Structre Of Hsp90 With Small Molecule Inhibitor Bound | Back alignment and taxonomy information |
|---|
| >gi|302565977|pdb|2XJG|A Chain A, Structure Of Hsp90 With Small Molecule Inhibitor Bound gi|305677633|pdb|2XHX|A Chain A, Structure Of Hsp90 With Small Molecule Inhibitor Bound | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 93 | ||||||
| UNIPROTKB|H0YJF5 | 52 | HSP90AA1 "Heat shock protein H | 0.419 | 0.75 | 1.0 | 1.4e-14 | |
| UNIPROTKB|F1NKM6 | 220 | F1NKM6 "Uncharacterized protei | 0.526 | 0.222 | 0.795 | 1.8e-14 | |
| UNIPROTKB|F1NKM8 | 217 | F1NKM8 "Uncharacterized protei | 0.526 | 0.225 | 0.795 | 1.8e-14 | |
| UNIPROTKB|J9NTW0 | 239 | SLC29A1 "Uncharacterized prote | 0.548 | 0.213 | 0.788 | 1.8e-14 | |
| UNIPROTKB|G3V2J8 | 174 | HSP90AA1 "Heat shock protein H | 0.537 | 0.287 | 0.8 | 1.8e-14 | |
| UNIPROTKB|F1LTA7 | 643 | F1LTA7 "Uncharacterized protei | 0.494 | 0.071 | 0.847 | 4.1e-14 | |
| UNIPROTKB|Q14568 | 343 | HSP90AA2 "Putative heat shock | 0.537 | 0.145 | 0.8 | 5.1e-14 | |
| ZFIN|ZDB-GENE-031001-3 | 734 | hsp90aa1.2 "heat shock protein | 0.408 | 0.051 | 1.0 | 7.9e-14 | |
| UNIPROTKB|Q5T9W8 | 168 | HSP90AB1 "Heat shock protein H | 0.408 | 0.226 | 0.973 | 7.9e-14 | |
| UNIPROTKB|D4A2S2 | 249 | D4A2S2 "Uncharacterized protei | 0.430 | 0.160 | 0.9 | 1.3e-13 |
| UNIPROTKB|H0YJF5 HSP90AA1 "Heat shock protein HSP 90-alpha" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Score = 186 (70.5 bits), Expect = 1.4e-14, P = 1.4e-14
Identities = 39/39 (100%), Positives = 39/39 (100%)
Query: 36 VETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDV 74
VETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDV
Sbjct: 2 VETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDV 40
|
|
| UNIPROTKB|F1NKM6 F1NKM6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NKM8 F1NKM8 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NTW0 SLC29A1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3V2J8 HSP90AA1 "Heat shock protein HSP 90-alpha" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LTA7 F1LTA7 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q14568 HSP90AA2 "Putative heat shock protein HSP 90-alpha A2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-031001-3 hsp90aa1.2 "heat shock protein 90, alpha (cytosolic), class A member 1, tandem duplicate 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5T9W8 HSP90AB1 "Heat shock protein HSP 90-beta" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4A2S2 D4A2S2 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 93 | |||
| PTZ00272 | 701 | PTZ00272, PTZ00272, heat shock protein 83 kDa (Hsp | 6e-18 | |
| COG0326 | 623 | COG0326, HtpG, Molecular chaperone, HSP90 family [ | 8e-17 | |
| PRK05218 | 613 | PRK05218, PRK05218, heat shock protein 90; Provisi | 1e-16 | |
| PTZ00130 | 814 | PTZ00130, PTZ00130, heat shock protein 90; Provisi | 3e-11 |
| >gnl|CDD|240341 PTZ00272, PTZ00272, heat shock protein 83 kDa (Hsp83); Provisional | Back alignment and domain information |
|---|
Score = 76.3 bits (187), Expect = 6e-18
Identities = 35/37 (94%), Positives = 36/37 (97%)
Query: 37 ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSD 73
ETFAFQAEI QLMSLIINTFYSNKEIFLRELISN+SD
Sbjct: 3 ETFAFQAEINQLMSLIINTFYSNKEIFLRELISNASD 39
|
Length = 701 |
| >gnl|CDD|223403 COG0326, HtpG, Molecular chaperone, HSP90 family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|235366 PRK05218, PRK05218, heat shock protein 90; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185466 PTZ00130, PTZ00130, heat shock protein 90; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 93 | |||
| COG0326 | 623 | HtpG Molecular chaperone, HSP90 family [Posttransl | 99.83 | |
| KOG0020|consensus | 785 | 99.79 | ||
| PTZ00130 | 814 | heat shock protein 90; Provisional | 99.79 | |
| KOG0019|consensus | 656 | 99.77 | ||
| PTZ00272 | 701 | heat shock protein 83 kDa (Hsp83); Provisional | 99.75 | |
| PRK05218 | 613 | heat shock protein 90; Provisional | 99.64 | |
| PRK14083 | 601 | HSP90 family protein; Provisional | 99.36 | |
| PF13589 | 137 | HATPase_c_3: Histidine kinase-, DNA gyrase B-, and | 94.14 |
| >COG0326 HtpG Molecular chaperone, HSP90 family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.83 E-value=4e-21 Score=164.39 Aligned_cols=55 Identities=51% Similarity=0.703 Sum_probs=52.0
Q ss_pred chhhhHHHHHHHHHHHHHHhhcCChhHHHHHHhhchhhhh-hhhhhccCccchhhc
Q psy15111 36 VETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDVQ-NIDFTGNQTQDLWCR 90 (93)
Q Consensus 36 ~et~~FQaei~~LL~liinSLYSnKEIFLRELISNASDAl-k~R~~~~~~~~~~~~ 90 (93)
.+++.||+|++|||+||||||||||||||||||||||||| |+||.+.+++++.++
T Consensus 4 ~e~~~Fq~ev~~ll~lmihSlYSnKeIFLRELISNAsDAidKlr~~al~~~~~~~~ 59 (623)
T COG0326 4 QETRGFQAEVKQLLDLMIHSLYSNKEIFLRELISNASDAIDKLRFEALSDPELGEG 59 (623)
T ss_pred hhhhhhhHHHHHHHHHHHHhccCCcHHHHHHHHhhhHHHHHHHHHHhccCccccCC
Confidence 4789999999999999999999999999999999999999 999999999988753
|
|
| >KOG0020|consensus | Back alignment and domain information |
|---|
| >PTZ00130 heat shock protein 90; Provisional | Back alignment and domain information |
|---|
| >KOG0019|consensus | Back alignment and domain information |
|---|
| >PTZ00272 heat shock protein 83 kDa (Hsp83); Provisional | Back alignment and domain information |
|---|
| >PRK05218 heat shock protein 90; Provisional | Back alignment and domain information |
|---|
| >PRK14083 HSP90 family protein; Provisional | Back alignment and domain information |
|---|
| >PF13589 HATPase_c_3: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; PDB: 3IED_A 2XCM_B 2JKI_B 3OPD_A 2O1V_B 2GQP_A 2O1W_C 1YT2_A 1TC6_A 2H8M_B | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 93 | ||||
| 2fwy_A | 256 | Structure Of Human Hsp90-Alpha Bound To The Potent | 3e-16 | ||
| 3ft5_A | 249 | Structure Of Hsp90 Bound With A Novel Fragment Leng | 3e-16 | ||
| 2xjg_A | 249 | Structure Of Hsp90 With Small Molecule Inhibitor Bo | 3e-16 | ||
| 2xjj_A | 249 | Structre Of Hsp90 With Small Molecule Inhibitor Bou | 3e-16 | ||
| 2xdu_A | 236 | Structre Of Hsp90 With Small Molecule Inhibitor Bou | 5e-16 | ||
| 1uyi_A | 236 | Human Hsp90-Alpha With 8-(2,5-Dimethoxy-Benzyl)-2-F | 5e-16 | ||
| 2jjc_A | 218 | Hsp90 Alpha Atpase Domain With Bound Small Molecule | 6e-16 | ||
| 2yee_A | 252 | Hsp90 Inhibitors And Drugs From Fragment And Virtua | 6e-16 | ||
| 2ye7_A | 252 | Hsp90 Inhibitors And Drugs From Fragment And Virtua | 6e-16 | ||
| 1yc1_A | 264 | Crystal Structures Of Human Hsp90alpha Complexed Wi | 7e-16 | ||
| 3qdd_A | 237 | Hsp90a N-Terminal Domain In Complex With Biib021 Le | 7e-16 | ||
| 1uy6_A | 236 | Human Hsp90-Alpha With 9-Butyl-8-(3,4,5-Trimethoxy- | 7e-16 | ||
| 2ccs_A | 236 | Human Hsp90 With 4-Chloro-6-(4-Piperazin-1-Yl-1h-Py | 7e-16 | ||
| 3bm9_A | 226 | Discovery Of Benzisoxazoles As Potent Inhibitors Of | 7e-16 | ||
| 2ye2_A | 252 | Hsp90 Inhibitors And Drugs From Fragment And Virtua | 7e-16 | ||
| 4awo_A | 230 | Complex Of Hsp90 Atpase Domain With Tropane Derived | 7e-16 | ||
| 2bsm_A | 235 | Novel, Potent Small Molecule Inhibitors Of The Mole | 7e-16 | ||
| 2yi0_A | 229 | Structural Characterization Of 5-Aryl-4-(5-Substitu | 7e-16 | ||
| 1byq_A | 228 | Hsp90 N-Terminal Domain Bound To Adp-Mg Length = 22 | 7e-16 | ||
| 3d0b_A | 232 | Crystal Structure Of Benzamide Tetrahydro-4h-Carbaz | 7e-16 | ||
| 4egh_A | 232 | Hsp90-Alpha Atpase Domain In Complex With (4-Hydrox | 8e-16 | ||
| 4eeh_A | 229 | Hsp90 Alpha N-Terminal Domain In Complex With An In | 8e-16 | ||
| 3b24_A | 229 | Hsp90 Alpha N-Terminal Domain In Complex With An Am | 8e-16 | ||
| 3r4m_A | 228 | Optimization Of Potent, Selective, And Orally Bioav | 8e-16 | ||
| 3inw_A | 228 | Hsp90 N-Terminal Domain With Pochoxime A Length = 2 | 8e-16 | ||
| 3hhu_A | 224 | Human Heat-Shock Protein 90 (Hsp90) In Complex With | 8e-16 | ||
| 3tuh_A | 209 | Crystal Structure Of The N-Terminal Domain Of An Hs | 8e-16 | ||
| 3k98_A | 232 | Hsp90 N-Terminal Domain In Complex With (1r)-2-(5-C | 8e-16 | ||
| 3k97_A | 251 | Hsp90 N-Terminal Domain In Complex With 4-Chloro-6- | 8e-16 | ||
| 3eko_A | 226 | Dihydroxylphenyl Amides As Inhibitors Of The Hsp90 | 8e-16 | ||
| 2qfo_A | 207 | Hsp90 Complexed With A143571 And A516383 Length = 2 | 8e-16 | ||
| 2qf6_A | 207 | Hsp90 Complexed With A56322 Length = 207 | 9e-16 | ||
| 2k5b_A | 210 | Human Cdc37-Hsp90 Docking Model Based On Nmr Length | 9e-16 | ||
| 1osf_A | 215 | Human Hsp90 In Complex With 17-desmethoxy-17-n,n- D | 9e-16 | ||
| 2yjw_A | 209 | Tricyclic Series Of Hsp90 Inhibitors Length = 209 | 2e-15 | ||
| 4gqt_A | 227 | N-Terminal Domain Of C. Elegans Hsp90 Length = 227 | 1e-14 | ||
| 1uym_A | 220 | Human Hsp90-Beta With Pu3 (9-Butyl-8(3,4,5-Trimetho | 2e-14 | ||
| 3nmq_A | 239 | Hsp90b N-Terminal Domain In Complex With Ec44, A Py | 2e-14 | ||
| 3o6o_A | 214 | Crystal Structure Of The N-Terminal Domain Of An Hs | 2e-14 | ||
| 3opd_A | 231 | Crystal Structure Of The N-Terminal Domain Of An Hs | 2e-14 | ||
| 3h80_A | 231 | Crystal Structure Of The Amino-Terminal Domain Of H | 4e-14 | ||
| 2xcm_A | 214 | Complex Of Hsp90 N-Terminal, Sgt1 Cs And Rar1 Chord | 4e-14 | ||
| 2jki_A | 223 | Complex Of Hsp90 N-terminal And Sgt1 Cs Domain Leng | 6e-14 | ||
| 1zw9_A | 240 | Yeast Hsp82 In Complex With The Novel Hsp90 Inhibit | 7e-13 | ||
| 3c0e_A | 240 | Yeast Hsp82 N-Terminal Domain: Effects Of Mutants 9 | 7e-13 | ||
| 1bgq_A | 225 | Radicicol Bound To The Atp Binding Site Of The N-Te | 7e-13 | ||
| 2cgf_A | 225 | A Radicicol Analogue Bound To The Atp Binding Site | 7e-13 | ||
| 1a4h_A | 230 | Structure Of The N-Terminal Domain Of The Yeast Hsp | 8e-13 | ||
| 2yga_A | 220 | E88g-n92l Mutant Of N-term Hsp90 Complexed With Gel | 8e-13 | ||
| 2ygf_A | 220 | L89v, L93i And V136m Mutant Of N-term Hsp90 Complex | 8e-13 | ||
| 1ah8_A | 220 | Structure Of The Orthorhombic Form Of The N-Termina | 8e-13 | ||
| 3k60_A | 223 | Crystal Structure Of N-Terminal Domain Of Plasmodiu | 8e-13 | ||
| 2bre_A | 219 | Structure Of A Hsp90 Inhibitor Bound To The N-Termi | 9e-13 | ||
| 2yge_A | 220 | E88g-n92l Mutant Of N-term Hsp90 Complexed With Gel | 9e-13 | ||
| 2xx2_A | 214 | Macrolactone Inhibitor Bound To Hsp90 N-Term Length | 9e-13 | ||
| 1am1_A | 213 | Atp Binding Site In The Hsp90 Molecular Chaperone L | 9e-13 | ||
| 1us7_A | 214 | Complex Of Hsp90 And P50 Length = 214 | 9e-13 | ||
| 2wep_A | 220 | Yeast Hsp90 N-Terminal Domain Li-Iv Mutant With Adp | 2e-12 | ||
| 2cg9_A | 677 | Crystal Structure Of An Hsp90-Sba1 Closed Chaperone | 3e-12 | ||
| 2esa_A | 236 | Grp94 N-Terminal Domain Bound To Geldanamycin: Effe | 1e-10 | ||
| 1u2o_A | 236 | Crystal Structure Of The N-Domain Of Grp94 Lacking | 1e-10 | ||
| 1qy5_A | 269 | Crystal Structure Of The N-Domain Of The Er Hsp90 C | 2e-10 | ||
| 1u0y_A | 273 | N-Domain Of Grp94, With The Charged Domain, In Comp | 2e-10 | ||
| 2ior_A | 235 | Crystal Structure Of The N-Terminal Domain Of Htpg, | 4e-10 | ||
| 2o1u_A | 666 | Structure Of Full Length Grp94 With Amp-Pnp Bound L | 4e-10 | ||
| 2o1w_A | 506 | Structure Of N-Terminal Plus Middle Domains (N+m) O | 5e-10 | ||
| 2iop_A | 624 | Crystal Structure Of Full-Length Htpg, The Escheric | 5e-09 | ||
| 1y4s_A | 559 | Conformation Rearrangement Of Heat Shock Protein 90 | 5e-09 | ||
| 3ied_A | 272 | Crystal Structure Of N-Terminal Domain Of Plasmodiu | 2e-08 | ||
| 3peh_A | 281 | Crystal Structure Of The N-Terminal Domain Of An Hs | 7e-08 |
| >pdb|2FWY|A Chain A, Structure Of Human Hsp90-Alpha Bound To The Potent Water Soluble Inhibitor Pu-H64 Length = 256 | Back alignment and structure |
|
| >pdb|3FT5|A Chain A, Structure Of Hsp90 Bound With A Novel Fragment Length = 249 | Back alignment and structure |
| >pdb|2XJG|A Chain A, Structure Of Hsp90 With Small Molecule Inhibitor Bound Length = 249 | Back alignment and structure |
| >pdb|2XJJ|A Chain A, Structre Of Hsp90 With Small Molecule Inhibitor Bound Length = 249 | Back alignment and structure |
| >pdb|2XDU|A Chain A, Structre Of Hsp90 With Small Molecule Inhibitor Bound Length = 236 | Back alignment and structure |
| >pdb|1UYI|A Chain A, Human Hsp90-Alpha With 8-(2,5-Dimethoxy-Benzyl)-2-Fluoro-9- Pent-9h-Purin-6-Ylamine Length = 236 | Back alignment and structure |
| >pdb|2JJC|A Chain A, Hsp90 Alpha Atpase Domain With Bound Small Molecule Fragment Length = 218 | Back alignment and structure |
| >pdb|2YEE|A Chain A, Hsp90 Inhibitors And Drugs From Fragment And Virtual Screening Length = 252 | Back alignment and structure |
| >pdb|2YE7|A Chain A, Hsp90 Inhibitors And Drugs From Fragment And Virtual Screening Length = 252 | Back alignment and structure |
| >pdb|1YC1|A Chain A, Crystal Structures Of Human Hsp90alpha Complexed With Dihydroxyphenylpyrazoles Length = 264 | Back alignment and structure |
| >pdb|3QDD|A Chain A, Hsp90a N-Terminal Domain In Complex With Biib021 Length = 237 | Back alignment and structure |
| >pdb|1UY6|A Chain A, Human Hsp90-Alpha With 9-Butyl-8-(3,4,5-Trimethoxy-Benzyl)-9h-Purin-6-Ylamine Length = 236 | Back alignment and structure |
| >pdb|2CCS|A Chain A, Human Hsp90 With 4-Chloro-6-(4-Piperazin-1-Yl-1h-Pyrazol-3- Yl)-Benzene-1,2-Diol Length = 236 | Back alignment and structure |
| >pdb|3BM9|A Chain A, Discovery Of Benzisoxazoles As Potent Inhibitors Of Chaperone Hsp90 Length = 226 | Back alignment and structure |
| >pdb|2YE2|A Chain A, Hsp90 Inhibitors And Drugs From Fragment And Virtual Screening Length = 252 | Back alignment and structure |
| >pdb|4AWO|A Chain A, Complex Of Hsp90 Atpase Domain With Tropane Derived Inhibitors Length = 230 | Back alignment and structure |
| >pdb|2BSM|A Chain A, Novel, Potent Small Molecule Inhibitors Of The Molecular Chaperone Hsp90 Discovered Through Structure-Based Design Length = 235 | Back alignment and structure |
| >pdb|2YI0|A Chain A, Structural Characterization Of 5-Aryl-4-(5-Substituted-2-4- Dihydroxyphenyl)-1,2,3-Thiadiazole Hsp90 Inhibitors. Length = 229 | Back alignment and structure |
| >pdb|1BYQ|A Chain A, Hsp90 N-Terminal Domain Bound To Adp-Mg Length = 228 | Back alignment and structure |
| >pdb|3D0B|A Chain A, Crystal Structure Of Benzamide Tetrahydro-4h-Carbazol-4-One Bound To Hsp90 Length = 232 | Back alignment and structure |
| >pdb|4EGH|A Chain A, Hsp90-Alpha Atpase Domain In Complex With (4-Hydroxyphenyl)morpholin- 4-Yl Methanone Length = 232 | Back alignment and structure |
| >pdb|4EEH|A Chain A, Hsp90 Alpha N-Terminal Domain In Complex With An Inhibitor 3-(4- Hydroxy-Phenyl)-1h-Indazol-6-Ol Length = 229 | Back alignment and structure |
| >pdb|3B24|A Chain A, Hsp90 Alpha N-Terminal Domain In Complex With An Aminotriazine Fragment Molecule Length = 229 | Back alignment and structure |
| >pdb|3R4M|A Chain A, Optimization Of Potent, Selective, And Orally Bioavailable Pyrrolodinopyrimidine-Containing Inhibitors Of Heat Shock Protein 90. Identification Of Development Candidate 2-Amino-4-{4-Chloro-2-[2-(4- Fluoro-1h-Pyrazol-1-Yl)ethoxy]-6-Methylphenyl}-N-(2,2- Difluoropropyl)-5,7-Dihydro-6h-Pyrrolo[3, 4-D]pyrimidine-6-Carboxamide Length = 228 | Back alignment and structure |
| >pdb|3INW|A Chain A, Hsp90 N-Terminal Domain With Pochoxime A Length = 228 | Back alignment and structure |
| >pdb|3HHU|A Chain A, Human Heat-Shock Protein 90 (Hsp90) In Complex With {4-[3- (2,4-Dihydroxy-5-Isopropyl-Phenyl)-5-Thioxo- 1,5-Dihydro- [1,2,4]triazol-4-Yl]-Benzyl}-Carbamic Acid Ethyl Ester {zk 2819} Length = 224 | Back alignment and structure |
| >pdb|3TUH|A Chain A, Crystal Structure Of The N-Terminal Domain Of An Hsp90 In The Presence Of An The Inhibitor Ganetespib Length = 209 | Back alignment and structure |
| >pdb|3K98|A Chain A, Hsp90 N-Terminal Domain In Complex With (1r)-2-(5-Chloro-2, 4-Dihydroxybenzoyl)-N-Ethylisoindoline-1-Carboxamide Length = 232 | Back alignment and structure |
| >pdb|3K97|A Chain A, Hsp90 N-Terminal Domain In Complex With 4-Chloro-6-{[(2r)-2- (2-Methylphenyl)pyrrolidin-1-Yl]carbonyl}benzene-1, 3-Diol Length = 251 | Back alignment and structure |
| >pdb|3EKO|A Chain A, Dihydroxylphenyl Amides As Inhibitors Of The Hsp90 Molecular Chaperone Length = 226 | Back alignment and structure |
| >pdb|2QFO|A Chain A, Hsp90 Complexed With A143571 And A516383 Length = 207 | Back alignment and structure |
| >pdb|2QF6|A Chain A, Hsp90 Complexed With A56322 Length = 207 | Back alignment and structure |
| >pdb|2K5B|A Chain A, Human Cdc37-Hsp90 Docking Model Based On Nmr Length = 210 | Back alignment and structure |
| >pdb|1OSF|A Chain A, Human Hsp90 In Complex With 17-desmethoxy-17-n,n- Dimethylaminoethylamino-geldanamycin Length = 215 | Back alignment and structure |
| >pdb|2YJW|A Chain A, Tricyclic Series Of Hsp90 Inhibitors Length = 209 | Back alignment and structure |
| >pdb|4GQT|A Chain A, N-Terminal Domain Of C. Elegans Hsp90 Length = 227 | Back alignment and structure |
| >pdb|1UYM|A Chain A, Human Hsp90-Beta With Pu3 (9-Butyl-8(3,4,5-Trimethoxy-Benzyl)-9h-Purin-6-Ylamine) Length = 220 | Back alignment and structure |
| >pdb|3NMQ|A Chain A, Hsp90b N-Terminal Domain In Complex With Ec44, A Pyrrolo-Pyrimidine Methoxypyridine Inhibitor Length = 239 | Back alignment and structure |
| >pdb|3O6O|A Chain A, Crystal Structure Of The N-Terminal Domain Of An Hsp90 From Trypanosoma Brucei, Tb10.26.1080 In The Presence Of An The Inhibitor Biib021 Length = 214 | Back alignment and structure |
| >pdb|3OPD|A Chain A, Crystal Structure Of The N-Terminal Domain Of An Hsp90 From Trypanosoma Brucei, Tb10.26.1080 In The Presence Of A Benzamide Derivative Length = 231 | Back alignment and structure |
| >pdb|3H80|A Chain A, Crystal Structure Of The Amino-Terminal Domain Of Hsp90 From Leishmania Major, Lmjf33.0312:m1-K213 Length = 231 | Back alignment and structure |
| >pdb|2XCM|A Chain A, Complex Of Hsp90 N-Terminal, Sgt1 Cs And Rar1 Chord2 Domain Length = 214 | Back alignment and structure |
| >pdb|2JKI|A Chain A, Complex Of Hsp90 N-terminal And Sgt1 Cs Domain Length = 223 | Back alignment and structure |
| >pdb|1ZW9|A Chain A, Yeast Hsp82 In Complex With The Novel Hsp90 Inhibitor 8-(6-Bromo- Benzo[1, 3]dioxol-5-Ylsulfanyl)-9-(3-Isopropylamino-Propyl)- Adenine Length = 240 | Back alignment and structure |
| >pdb|3C0E|A Chain A, Yeast Hsp82 N-Terminal Domain: Effects Of Mutants 98-99 Ks- Aa Length = 240 | Back alignment and structure |
| >pdb|1BGQ|A Chain A, Radicicol Bound To The Atp Binding Site Of The N-Terminal Domain Of The Yeast Hsp90 Chaperone Length = 225 | Back alignment and structure |
| >pdb|2CGF|A Chain A, A Radicicol Analogue Bound To The Atp Binding Site Of The N- Terminal Domain Of The Yeast Hsp90 Chaperone Length = 225 | Back alignment and structure |
| >pdb|1A4H|A Chain A, Structure Of The N-Terminal Domain Of The Yeast Hsp90 Chaperone In Complex With Geldanamycin Length = 230 | Back alignment and structure |
| >pdb|2YGA|A Chain A, E88g-n92l Mutant Of N-term Hsp90 Complexed With Geldanamycin Length = 220 | Back alignment and structure |
| >pdb|2YGF|A Chain A, L89v, L93i And V136m Mutant Of N-term Hsp90 Complexed With Geldanamycin Length = 220 | Back alignment and structure |
| >pdb|1AH8|A Chain A, Structure Of The Orthorhombic Form Of The N-Terminal Domain Of The Yeast Hsp90 Chaperone Length = 220 | Back alignment and structure |
| >pdb|3K60|A Chain A, Crystal Structure Of N-Terminal Domain Of Plasmodium Falciparum Hsp90 (Pf07_0029) Bound To Adp Length = 223 | Back alignment and structure |
| >pdb|2BRE|A Chain A, Structure Of A Hsp90 Inhibitor Bound To The N-Terminus Of Yeast Hsp90. Length = 219 | Back alignment and structure |
| >pdb|2YGE|A Chain A, E88g-n92l Mutant Of N-term Hsp90 Complexed With Geldanamycin Length = 220 | Back alignment and structure |
| >pdb|2XX2|A Chain A, Macrolactone Inhibitor Bound To Hsp90 N-Term Length = 214 | Back alignment and structure |
| >pdb|1AM1|A Chain A, Atp Binding Site In The Hsp90 Molecular Chaperone Length = 213 | Back alignment and structure |
| >pdb|1US7|A Chain A, Complex Of Hsp90 And P50 Length = 214 | Back alignment and structure |
| >pdb|2WEP|A Chain A, Yeast Hsp90 N-Terminal Domain Li-Iv Mutant With Adp Length = 220 | Back alignment and structure |
| >pdb|2CG9|A Chain A, Crystal Structure Of An Hsp90-Sba1 Closed Chaperone Complex Length = 677 | Back alignment and structure |
| >pdb|2ESA|A Chain A, Grp94 N-Terminal Domain Bound To Geldanamycin: Effects Of Mutants 168- 169 Ks-Aa Length = 236 | Back alignment and structure |
| >pdb|1U2O|A Chain A, Crystal Structure Of The N-Domain Of Grp94 Lacking The Charged Domain In Complex With Neca Length = 236 | Back alignment and structure |
| >pdb|1QY5|A Chain A, Crystal Structure Of The N-Domain Of The Er Hsp90 Chaperone Grp94 In Complex With The Specific Ligand Neca Length = 269 | Back alignment and structure |
| >pdb|1U0Y|A Chain A, N-Domain Of Grp94, With The Charged Domain, In Complex With The Novel Ligand N-Propyl Carboxyamido Adenosine Length = 273 | Back alignment and structure |
| >pdb|2IOR|A Chain A, Crystal Structure Of The N-Terminal Domain Of Htpg, The Escherichia Coli Hsp90, Bound To Adp Length = 235 | Back alignment and structure |
| >pdb|2O1U|A Chain A, Structure Of Full Length Grp94 With Amp-Pnp Bound Length = 666 | Back alignment and structure |
| >pdb|2O1W|A Chain A, Structure Of N-Terminal Plus Middle Domains (N+m) Of Grp94 Length = 506 | Back alignment and structure |
| >pdb|2IOP|A Chain A, Crystal Structure Of Full-Length Htpg, The Escherichia Coli Hsp90, Bound To Adp Length = 624 | Back alignment and structure |
| >pdb|1Y4S|A Chain A, Conformation Rearrangement Of Heat Shock Protein 90 Upon Adp Binding Length = 559 | Back alignment and structure |
| >pdb|3IED|A Chain A, Crystal Structure Of N-Terminal Domain Of Plasmodium Falciparum Hsp90 (Pf14_0417) In Complex With Amppn Length = 272 | Back alignment and structure |
| >pdb|3PEH|A Chain A, Crystal Structure Of The N-Terminal Domain Of An Hsp90 From Plasmodium Falciparum, Pfl1070c In The Presence Of A Thienopyrimidine Derivative Length = 281 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 93 | |||
| 1yc1_A | 264 | HSP 86, heat shock protein HSP 90-alpha; cell-cycl | 6e-27 | |
| 3nmq_A | 239 | Heat shock protein HSP 90-beta; ATPase, chaperone- | 1e-26 | |
| 3t0h_A | 228 | Heat shock protein HSP 90-alpha; chaperone, ATPase | 4e-26 | |
| 3o0i_A | 256 | HSP90AA1 protein; HSP90 heat-shock proteins, chape | 8e-26 | |
| 3peh_A | 281 | Endoplasmin homolog; structural genomics, structur | 1e-25 | |
| 1qy5_A | 269 | Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N | 1e-25 | |
| 2wer_A | 220 | ATP-dependent molecular chaperone HSP82; ATPase, A | 1e-25 | |
| 2gqp_A | 236 | Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, | 2e-25 | |
| 2cg9_A | 677 | ATP-dependent molecular chaperone HSP82; chaperone | 6e-25 | |
| 2o1u_A | 666 | Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, | 8e-25 | |
| 2ior_A | 235 | Chaperone protein HTPG; heat shock protein, HSP90; | 2e-24 | |
| 2ioq_A | 624 | Chaperone protein HTPG; heat shock protein, HSP90; | 2e-22 | |
| 1y4s_A | 559 | Chaperone protein HTPG; HSP90, molecular chaperone | 3e-22 | |
| 3ied_A | 272 | Heat shock protein; HSP90, chaperone, structural g | 3e-15 |
| >1yc1_A HSP 86, heat shock protein HSP 90-alpha; cell-cycle, cancer, drug design, cell cycle; HET: 4BC; 1.70A {Homo sapiens} SCOP: d.122.1.1 PDB: 1yc3_A* 1yc4_A* Length = 264 | Back alignment and structure |
|---|
Score = 98.1 bits (245), Expect = 6e-27
Identities = 42/70 (60%), Positives = 49/70 (70%), Gaps = 1/70 (1%)
Query: 4 NQSSGDAITLGLIERVTKNTTLMADNQSSGDGVETFAFQAEIAQLMSLIINTFYSNKEIF 63
+ + G + L + K+ +D + VETFAFQAEIAQLMSLIINTFYSNKEIF
Sbjct: 14 SMTGGQQMGRDLYDDDDKDRWG-SDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIF 72
Query: 64 LRELISNSSD 73
LRELISNSSD
Sbjct: 73 LRELISNSSD 82
|
| >3nmq_A Heat shock protein HSP 90-beta; ATPase, chaperone-chaperone inhibitor complex; HET: 7PP; 2.20A {Homo sapiens} Length = 239 | Back alignment and structure |
|---|
| >3t0h_A Heat shock protein HSP 90-alpha; chaperone, ATPase; 1.20A {Homo sapiens} PDB: 3r4m_A 3t0z_A* 3t10_A* 3t1k_A* 3t2s_A* 1uyl_A 1uy7_A* 1uy8_A* 1uy9_A* 1uyc_A* 1uyd_A* 1uye_A* 1uyf_A* 1uyg_A* 1uyh_A* 1uyk_A* 1uy6_A 2cdd_A* 2uwd_A* 2vci_A* ... Length = 228 | Back alignment and structure |
|---|
| >3o0i_A HSP90AA1 protein; HSP90 heat-shock proteins, chaperone-inhibitor complex; HET: P54; 1.47A {Homo sapiens} PDB: 2fwz_A* 2fwy_A* 2h55_A* Length = 256 | Back alignment and structure |
|---|
| >3peh_A Endoplasmin homolog; structural genomics, structural genomics consortium, SGC, HE protein, chaperone, ATP binding; HET: IBD; 2.75A {Plasmodium falciparum 3D7} PDB: 3pej_A* Length = 281 | Back alignment and structure |
|---|
| >1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Length = 269 | Back alignment and structure |
|---|
| >2wer_A ATP-dependent molecular chaperone HSP82; ATPase, ATP-binding, phosphoprotein, stress respo nucleotide-binding; HET: RDC; 1.60A {Saccharomyces cerevisiae} PDB: 2weq_A* 2wep_A* 1zwh_A* 1zw9_A* 2fxs_A* 3c11_A* 3c0e_A* 2yge_A* 2ygf_A* 2akp_A Length = 220 | Back alignment and structure |
|---|
| >2gqp_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, ligand, NECA, NPCA, adenosine; HET: PA7 PG4 1PE; 1.50A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1tc0_A* 1tbw_A* 1u0z_A* 1u2o_A* 1ysz_A* 1yt0_A* 1yt1_A* 2exl_A* 2fyp_A* 2gfd_A* 1tc6_A* 2h8m_A* 2hch_A* 2hg1_A* 3o2f_A* 2esa_A* Length = 236 | Back alignment and structure |
|---|
| >2cg9_A ATP-dependent molecular chaperone HSP82; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} Length = 677 | Back alignment and structure |
|---|
| >2o1u_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, AMP-PNP, GP96; HET: ANP; 2.40A {Canis lupus familiaris} PDB: 2o1v_A* 2o1w_A 2o1t_A Length = 666 | Back alignment and structure |
|---|
| >2ior_A Chaperone protein HTPG; heat shock protein, HSP90; HET: ADP; 1.65A {Escherichia coli} Length = 235 | Back alignment and structure |
|---|
| >2ioq_A Chaperone protein HTPG; heat shock protein, HSP90; 3.50A {Escherichia coli} PDB: 2iop_A Length = 624 | Back alignment and structure |
|---|
| >1y4s_A Chaperone protein HTPG; HSP90, molecular chaperone, ATPase; HET: ADP; 2.90A {Escherichia coli} PDB: 1y4u_A Length = 559 | Back alignment and structure |
|---|
| >3ied_A Heat shock protein; HSP90, chaperone, structural genomics, structura genomics consortium, SGC, stress response; HET: AN2; 2.01A {Plasmodium falciparum} Length = 272 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 93 | |||
| 3ied_A | 272 | Heat shock protein; HSP90, chaperone, structural g | 99.84 | |
| 3nmq_A | 239 | Heat shock protein HSP 90-beta; ATPase, chaperone- | 99.81 | |
| 3peh_A | 281 | Endoplasmin homolog; structural genomics, structur | 99.79 | |
| 3o0i_A | 256 | HSP90AA1 protein; HSP90 heat-shock proteins, chape | 99.78 | |
| 3t0h_A | 228 | Heat shock protein HSP 90-alpha; chaperone, ATPase | 99.77 | |
| 1qy5_A | 269 | Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N | 99.73 | |
| 2cg9_A | 677 | ATP-dependent molecular chaperone HSP82; chaperone | 99.66 | |
| 2gqp_A | 236 | Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, | 99.63 | |
| 2o1u_A | 666 | Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, | 99.62 | |
| 1y4s_A | 559 | Chaperone protein HTPG; HSP90, molecular chaperone | 99.6 | |
| 1yc1_A | 264 | HSP 86, heat shock protein HSP 90-alpha; cell-cycl | 99.6 | |
| 2wer_A | 220 | ATP-dependent molecular chaperone HSP82; ATPase, A | 99.59 | |
| 2ioq_A | 624 | Chaperone protein HTPG; heat shock protein, HSP90; | 99.59 | |
| 2ior_A | 235 | Chaperone protein HTPG; heat shock protein, HSP90; | 99.4 | |
| 1h7s_A | 365 | PMS1 protein homolog 2; DNA repair, GHL ATPase, mi | 81.9 | |
| 1b63_A | 333 | MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A | 81.15 |
| >3ied_A Heat shock protein; HSP90, chaperone, structural genomics, structura genomics consortium, SGC, stress response; HET: AN2; 2.01A {Plasmodium falciparum} | Back alignment and structure |
|---|
Probab=99.84 E-value=1.5e-22 Score=158.52 Aligned_cols=55 Identities=40% Similarity=0.700 Sum_probs=50.2
Q ss_pred CCcchhhhHHHHHHHHHHHHHHhhcCChhHHHHHHhhchhhhh-hhhhhccCccchh
Q psy15111 33 GDGVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDVQ-NIDFTGNQTQDLW 88 (93)
Q Consensus 33 ~~~~et~~FQaei~~LL~liinSLYSnKEIFLRELISNASDAl-k~R~~~~~~~~~~ 88 (93)
..+.|+|+||+|++|||+||+|+|||||||||||||||||||| |+| ++++++.++
T Consensus 21 ~~~~e~~~Fqae~~~ll~li~~slYs~keiFlRELISNasDA~dK~r-~~l~~~~~~ 76 (272)
T 3ied_A 21 GSPVEKYNFKAEVNKVMDIIVNSLYTDKDVFLRELISNASDACDKKR-IILENNKLI 76 (272)
T ss_dssp TEECEEEECCHHHHHHHHHHHHCTTCCTTHHHHHHHHHHHHHHHHHH-HHHHHHHHH
T ss_pred ccccceechHHHHHHHHHHHHhhcCCCHHHHHHHHHHhhHHHHHHHH-HhccChhhh
Confidence 3456899999999999999999999999999999999999999 999 888877665
|
| >3nmq_A Heat shock protein HSP 90-beta; ATPase, chaperone-chaperone inhibitor complex; HET: 7PP; 2.20A {Homo sapiens} SCOP: d.122.1.1 | Back alignment and structure |
|---|
| >3peh_A Endoplasmin homolog; structural genomics, structural genomics consortium, SGC, HE protein, chaperone, ATP binding; HET: IBD; 2.75A {Plasmodium falciparum 3D7} PDB: 3pej_A* | Back alignment and structure |
|---|
| >3o0i_A HSP90AA1 protein; HSP90 heat-shock proteins, chaperone-inhibitor complex; HET: P54; 1.47A {Homo sapiens} PDB: 2fwz_A* 2fwy_A* 2h55_A* | Back alignment and structure |
|---|
| >3t0h_A Heat shock protein HSP 90-alpha; chaperone, ATPase; 1.20A {Homo sapiens} SCOP: d.122.1.1 PDB: 3r4m_A 3t0z_A* 3t10_A* 3t1k_A* 3t2s_A* 1uyl_A 1uy7_A* 1uy8_A* 1uy9_A* 1uyc_A* 1uyd_A* 1uye_A* 1uyf_A* 1uyg_A* 1uyh_A* 1uyk_A* 1uy6_A 2cdd_A* 2uwd_A* 2vci_A* ... | Back alignment and structure |
|---|
| >1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* | Back alignment and structure |
|---|
| >2cg9_A ATP-dependent molecular chaperone HSP82; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2gqp_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, ligand, NECA, NPCA, adenosine; HET: PA7 PG4 1PE; 1.50A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1tc0_A* 1tbw_A* 1u0z_A* 1u2o_A* 1ysz_A* 1yt0_A* 1yt1_A* 2exl_A* 2fyp_A* 2gfd_A* 1tc6_A* 2h8m_A* 2hch_A* 2hg1_A* 3o2f_A* 2esa_A* | Back alignment and structure |
|---|
| >2o1u_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, AMP-PNP, GP96; HET: ANP; 2.40A {Canis lupus familiaris} PDB: 2o1v_A* 2o1w_A 2o1t_A | Back alignment and structure |
|---|
| >1y4s_A Chaperone protein HTPG; HSP90, molecular chaperone, ATPase; HET: ADP; 2.90A {Escherichia coli} PDB: 1y4u_A | Back alignment and structure |
|---|
| >1yc1_A HSP 86, heat shock protein HSP 90-alpha; cell-cycle, cancer, drug design, cell cycle; HET: 4BC; 1.70A {Homo sapiens} SCOP: d.122.1.1 PDB: 1yc3_A* 1yc4_A* | Back alignment and structure |
|---|
| >2wer_A ATP-dependent molecular chaperone HSP82; ATPase, ATP-binding, phosphoprotein, stress respo nucleotide-binding; HET: RDC; 1.60A {Saccharomyces cerevisiae} PDB: 2weq_A* 2wep_A* 1zwh_A* 1zw9_A* 2fxs_A* 3c11_A* 3c0e_A* 2yge_A* 2ygf_A* 2akp_A | Back alignment and structure |
|---|
| >2ioq_A Chaperone protein HTPG; heat shock protein, HSP90; 3.50A {Escherichia coli} PDB: 2iop_A | Back alignment and structure |
|---|
| >2ior_A Chaperone protein HTPG; heat shock protein, HSP90; HET: ADP; 1.65A {Escherichia coli} | Back alignment and structure |
|---|
| >1h7s_A PMS1 protein homolog 2; DNA repair, GHL ATPase, mismatch repair, HNPCC; 1.95A {Homo sapiens} SCOP: d.14.1.3 d.122.1.2 PDB: 1h7u_A* 1ea6_A* | Back alignment and structure |
|---|
| >1b63_A MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A {Escherichia coli K12} SCOP: d.14.1.3 d.122.1.2 PDB: 1nhh_A* 1nhi_A* 1bkn_A 1nhj_A* 1b62_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 93 | ||||
| d2gqpa1 | 227 | d.122.1.1 (A:74-337) HSP90 {Dog (Canis familiaris) | 2e-20 | |
| d1uyla_ | 208 | d.122.1.1 (A:) HSP90 {Human (Homo sapiens) [TaxId: | 5e-20 | |
| d2iwxa1 | 213 | d.122.1.1 (A:2-214) HSP90 {Baker's yeast (Saccharo | 6e-20 |
| >d2gqpa1 d.122.1.1 (A:74-337) HSP90 {Dog (Canis familiaris) [TaxId: 9615]} Length = 227 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase superfamily: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase family: Heat shock protein 90, HSP90, N-terminal domain domain: HSP90 species: Dog (Canis familiaris) [TaxId: 9615]
Score = 79.7 bits (196), Expect = 2e-20
Identities = 27/37 (72%), Positives = 32/37 (86%)
Query: 37 ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSD 73
E FAFQAE+ ++M LIIN+ Y NKEIFLRELISN+SD
Sbjct: 1 EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASD 37
|
| >d1uyla_ d.122.1.1 (A:) HSP90 {Human (Homo sapiens) [TaxId: 9606]} Length = 208 | Back information, alignment and structure |
|---|
| >d2iwxa1 d.122.1.1 (A:2-214) HSP90 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 213 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 93 | |||
| d2gqpa1 | 227 | HSP90 {Dog (Canis familiaris) [TaxId: 9615]} | 99.84 | |
| d1uyla_ | 208 | HSP90 {Human (Homo sapiens) [TaxId: 9606]} | 99.84 | |
| d2iwxa1 | 213 | HSP90 {Baker's yeast (Saccharomyces cerevisiae) [T | 99.82 | |
| d2hkja3 | 219 | Topoisomerase VI-B subunit {Archaeon Sulfolobus sh | 92.8 |
| >d2gqpa1 d.122.1.1 (A:74-337) HSP90 {Dog (Canis familiaris) [TaxId: 9615]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase superfamily: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase family: Heat shock protein 90, HSP90, N-terminal domain domain: HSP90 species: Dog (Canis familiaris) [TaxId: 9615]
Probab=99.84 E-value=1.2e-22 Score=150.44 Aligned_cols=53 Identities=53% Similarity=0.803 Sum_probs=48.5
Q ss_pred hhhhHHHHHHHHHHHHHHhhcCChhHHHHHHhhchhhhh-hhhhhccCccchhh
Q psy15111 37 ETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDVQ-NIDFTGNQTQDLWC 89 (93)
Q Consensus 37 et~~FQaei~~LL~liinSLYSnKEIFLRELISNASDAl-k~R~~~~~~~~~~~ 89 (93)
|+|+||+|+++||+|++|||||||+||||||||||+||| |+||++..++.+..
T Consensus 1 e~~~Fq~e~~~ll~ll~~sLYs~~~iflRELiqNA~DA~~k~r~~~~~~~~~~~ 54 (227)
T d2gqpa1 1 EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALA 54 (227)
T ss_dssp TEECCCHHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHHHHHHHHHHHHCTTTTT
T ss_pred CceeeehhHHHHHHHHHhcccCCCchhHHHHHhhHHHHHHHHHHHhccCccccc
Confidence 579999999999999999999999999999999999999 89999877766543
|
| >d1uyla_ d.122.1.1 (A:) HSP90 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iwxa1 d.122.1.1 (A:2-214) HSP90 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2hkja3 d.122.1.2 (A:10-228) Topoisomerase VI-B subunit {Archaeon Sulfolobus shibatae [TaxId: 2286]} | Back information, alignment and structure |
|---|