Psyllid ID: psy15130

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260---
MTPASLVGLESTIMSCLVSSRLVLSCLVLSCLVLSCLPAFLWWVQTCAMQRAKHLHCTLHVKSNLTNANVFHVSENFCTDTQLVMAYSRYIICIALHDAWQTRPIQTSATHIKDIRQKTANLSDTHKRLLQCSKTLLQLNFLKHVQTNEFHCIARCIAQARDVSQGADFLMVKPALPYLDIISEVKSRHPAYPLFVYQERCITVSGHFEANEKAMEMILEKIAEDPSSGSCSNVSYALRYGTEGWGELLHRFTRTSVGFLNFG
ccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEccccccccHHHHHHHHHHHccccccccccccccccccccHHHHccccccHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEHHccHHHHHHHHHHHHHHHHccccccccc
cccccHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEccccccccEEEEccccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHccccEEEEEEEEEEEcccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEccc
MTPASLVGLESTIMSCLVSSRLVLSCLVLSCLVLSCLPAFLWWVQTCAMQRAKHLHCTLhvksnltnanVFHVsenfctdtqLVMAYSRYIICIALHdawqtrpiqtsaTHIKDIRQKTANLSDTHKRLLQCSKTLLQLNFLKHVQTNEFHCIARCIAQARdvsqgadflmvkpalpyldiisevksrhpayplfvyqercitvsgHFEANEKAMEMILEKIaedpssgscsnvsYALRYGTEGWGELLHRFtrtsvgflnfg
MTPASLVGLESTIMSCLVSSRLVLSCLVLSCLVLSCLPAFLWWVQTCAMQRAKHLHCTLHVKSNLTNANVFHVSENFCTDTQLVMAYSRYIICIALHDAWQTRPIQTSATHIKDIRQKTANLSDTHKRLLQCSKTLLQLNFLKHVQTNEFHCIARCIAQARDVSQGADFLMVKPALPYLDIISEVKSRHPAYPLFVYQERCITVSGHFEANEKAMEMILEKIaedpssgscSNVSYALRYGTEGWGELLHRftrtsvgflnfg
MTPASLVGLESTIMsclvssrlvlsclvlsclvlsclPAFLWWVQTCAMQRAKHLHCTLHVKSNLTNANVFHVSENFCTDTQLVMAYSRYIICIALHDAWQTRPIQTSATHIKDIRQKTANLSDTHKRLLQCSKTLLQLNFLKHVQTNEFHCIARCIAQARDVSQGADFLMVKPALPYLDIISEVKSRHPAYPLFVYQERCITVSGHFEANEKAMEMILEKIAEDPSSGSCSNVSYALRYGTEGWGELLHRFTRTSVGFLNFG
******VGLESTIMSCLVSSRLVLSCLVLSCLVLSCLPAFLWWVQTCAMQRAKHLHCTLHVKSNLTNANVFHVSENFCTDTQLVMAYSRYIICIALHDAWQTRPIQTSATHIKDIRQKTANLSDTHKRLLQCSKTLLQLNFLKHVQTNEFHCIARCIAQARDVSQGADFLMVKPALPYLDIISEVKSRHPAYPLFVYQERCITVSGHFEANEKAMEMILEKI********CSNVSYALRYGTEGWGELLHRFTRTSVGFLN**
****SLVGLESTIMSCLVSSRLVLSCLVLSCLVLSCLPAFLWWVQTCAMQRAKHLHCTLHVKSNLTNANVFHVSENFCTDTQLVMAYSRYIICIALHDAWQTRPIQTSATHIKDIRQKTANLSDTHKRLLQCSKTLLQLNFLKHVQTNEFHCIARCIAQARDVSQGADFLMVKPALPYLDIISEVKSRHPAYPLFVYQERCITVSGHFEANEKAMEMILEKIAEDPSSGSCSNVSYALRYGTEGWGELLHRFTRTSVGFLNFG
MTPASLVGLESTIMSCLVSSRLVLSCLVLSCLVLSCLPAFLWWVQTCAMQRAKHLHCTLHVKSNLTNANVFHVSENFCTDTQLVMAYSRYIICIALHDAWQTRPIQTSATHIKDIRQKTANLSDTHKRLLQCSKTLLQLNFLKHVQTNEFHCIARCIAQARDVSQGADFLMVKPALPYLDIISEVKSRHPAYPLFVYQERCITVSGHFEANEKAMEMILEKIAEDPSSGSCSNVSYALRYGTEGWGELLHRFTRTSVGFLNFG
****SLVGLESTIMSCLVSSRLVLSCLVLSCLVLSCLPAFLWWVQTCAMQRAKHLHCTLHVKSNLTNANVFHVSENFCTDTQLVMAYSRYIICIALHDAWQTRPIQTSATHIKDIRQKTANLSDTHKRLLQCSKTLLQLNFLKHVQTNEFHCIARCIAQARDVSQGADFLMVKPALPYLDIISEVKSRHPAYPLFVYQERCITVSGHFEANEKAMEMILEKIAEDPSSGSCSNVSYALRYGTEGWGELLHRFTRTSVGFLNFG
oooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTPASLVGLESTIMSCLVSSRLVLSCLVLSCLVLSCLPAFLWWVQTCAMQRAKHLHCTLHVKSNLTNANVFHVSENFCTDTQLVMAYSRYIICIALHDAWQTRPIQTSATHIKDIRQKTANLSDTHKRLLQCSKTLLQLNFLKHVQTNEFHCIARCIAQARDVSQGADFLMVKPALPYLDIISEVKSRHPAYPLFVYQERCITVSGHFEANEKAMEMILEKIAEDPSSGSCSNVSYALRYGTEGWGELLHRFTRTSVGFLNFG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query263 2.2.26 [Sep-21-2011]
P06214330 Delta-aminolevulinic acid yes N/A 0.174 0.139 0.607 2e-10
P10518330 Delta-aminolevulinic acid yes N/A 0.174 0.139 0.607 2e-10
Q5R971330 Delta-aminolevulinic acid yes N/A 0.163 0.130 0.604 2e-09
P13716330 Delta-aminolevulinic acid yes N/A 0.163 0.130 0.604 2e-09
Q60HH9330 Delta-aminolevulinic acid N/A N/A 0.163 0.130 0.604 3e-09
Q58DK5329 Delta-aminolevulinic acid yes N/A 0.163 0.130 0.604 5e-09
P51513 510 RNA-binding protein Nova- no N/A 0.152 0.078 0.65 6e-09
Q9JKN6 507 RNA-binding protein Nova- no N/A 0.152 0.078 0.65 6e-09
Q2PFW9 483 RNA-binding protein Nova- N/A N/A 0.152 0.082 0.65 6e-09
Q80WA4 474 RNA-binding protein Nova- no N/A 0.152 0.084 0.65 7e-09
>sp|P06214|HEM2_RAT Delta-aminolevulinic acid dehydratase OS=Rattus norvegicus GN=Alad PE=1 SV=1 Back     alignment and function desciption
 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/51 (60%), Positives = 36/51 (70%), Gaps = 5/51 (9%)

Query: 158 AQARDVSQGADFLMVKPALPYLDIISEVKSRHPAYPLFVYQERCITVSGHF 208
           A ARD+ +GAD LMVKP LPYLD++ EVK +HP  PL VYQ     VSG F
Sbjct: 237 AVARDIQEGADILMVKPGLPYLDMVQEVKDKHPELPLAVYQ-----VSGEF 282
Catalyzes an early step in the biosynthesis of tetrapyrroles. Binds two molecules of 5-aminolevulinate per subunit, each at a distinct site, and catalyzes their condensation to form porphobilinogen.
Rattus norvegicus (taxid: 10116)
EC: 4EC: .EC: 2EC: .EC: 1EC: .EC: 2EC: 4
>sp|P10518|HEM2_MOUSE Delta-aminolevulinic acid dehydratase OS=Mus musculus GN=Alad PE=1 SV=1 Back     alignment and function description
>sp|Q5R971|HEM2_PONAB Delta-aminolevulinic acid dehydratase OS=Pongo abelii GN=ALAD PE=2 SV=2 Back     alignment and function description
>sp|P13716|HEM2_HUMAN Delta-aminolevulinic acid dehydratase OS=Homo sapiens GN=ALAD PE=1 SV=1 Back     alignment and function description
>sp|Q60HH9|HEM2_MACFA Delta-aminolevulinic acid dehydratase OS=Macaca fascicularis GN=ALAD PE=2 SV=2 Back     alignment and function description
>sp|Q58DK5|HEM2_BOVIN Delta-aminolevulinic acid dehydratase OS=Bos taurus GN=ALAD PE=2 SV=1 Back     alignment and function description
>sp|P51513|NOVA1_HUMAN RNA-binding protein Nova-1 OS=Homo sapiens GN=NOVA1 PE=1 SV=1 Back     alignment and function description
>sp|Q9JKN6|NOVA1_MOUSE RNA-binding protein Nova-1 OS=Mus musculus GN=Nova1 PE=1 SV=2 Back     alignment and function description
>sp|Q2PFW9|NOVA1_MACFA RNA-binding protein Nova-1 OS=Macaca fascicularis GN=NOVA1 PE=2 SV=1 Back     alignment and function description
>sp|Q80WA4|NOVA1_RAT RNA-binding protein Nova-1 (Fragment) OS=Rattus norvegicus GN=Nova1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query263
307210159 379 Delta-aminolevulinic acid dehydratase [H 0.235 0.163 0.535 9e-11
332030521336 Delta-aminolevulinic acid dehydratase [A 0.174 0.136 0.607 3e-09
350416298339 PREDICTED: delta-aminolevulinic acid deh 0.174 0.135 0.588 5e-09
350416295336 PREDICTED: delta-aminolevulinic acid deh 0.174 0.136 0.588 5e-09
340711485336 PREDICTED: delta-aminolevulinic acid deh 0.174 0.136 0.588 5e-09
32278593395 hypothetical protein SINV_80267 [Solenop 0.167 0.463 0.591 7e-09
354482641330 PREDICTED: delta-aminolevulinic acid deh 0.174 0.139 0.607 8e-09
6978483330 delta-aminolevulinic acid dehydratase [R 0.174 0.139 0.607 9e-09
156545691335 PREDICTED: delta-aminolevulinic acid deh 0.174 0.137 0.568 9e-09
188036180330 Chain A, Crystal Structure Of 5-Aminolev 0.174 0.139 0.607 1e-08
>gi|307210159|gb|EFN86832.1| Delta-aminolevulinic acid dehydratase [Harpegnathos saltator] Back     alignment and taxonomy information
 Score = 73.2 bits (178), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 38/71 (53%), Positives = 45/71 (63%), Gaps = 9/71 (12%)

Query: 158 AQARDVSQGADFLMVKPALPYLDIISEVKSRHPAYPLFVYQERCITVSGHF----EANEK 213
           A ARDV +GAD LMVKP LPYLDII  +K  HP YPLFVYQ     VSG +     A +K
Sbjct: 282 AAARDVEEGADMLMVKPGLPYLDIIKRIKDAHPEYPLFVYQ-----VSGEYAMLRHAADK 336

Query: 214 AMEMILEKIAE 224
            +  +LE + E
Sbjct: 337 NIIKLLETVHE 347

Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|332030521|gb|EGI70209.1| Delta-aminolevulinic acid dehydratase [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|350416298|ref|XP_003490903.1| PREDICTED: delta-aminolevulinic acid dehydratase-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
>gi|350416295|ref|XP_003490902.1| PREDICTED: delta-aminolevulinic acid dehydratase-like isoform 1 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340711485|ref|XP_003394306.1| PREDICTED: delta-aminolevulinic acid dehydratase-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|322785933|gb|EFZ12552.1| hypothetical protein SINV_80267 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|354482641|ref|XP_003503506.1| PREDICTED: delta-aminolevulinic acid dehydratase [Cricetulus griseus] gi|344250553|gb|EGW06657.1| Delta-aminolevulinic acid dehydratase [Cricetulus griseus] Back     alignment and taxonomy information
>gi|6978483|ref|NP_037031.1| delta-aminolevulinic acid dehydratase [Rattus norvegicus] gi|122836|sp|P06214.1|HEM2_RAT RecName: Full=Delta-aminolevulinic acid dehydratase; Short=ALADH; AltName: Full=Porphobilinogen synthase gi|55626|emb|CAA28621.1| unnamed protein product [Rattus norvegicus] gi|38197566|gb|AAH61806.1| Aminolevulinate, delta-, dehydratase [Rattus norvegicus] gi|149059612|gb|EDM10550.1| aminolevulinate, delta-, dehydratase, isoform CRA_a [Rattus norvegicus] gi|149059613|gb|EDM10551.1| aminolevulinate, delta-, dehydratase, isoform CRA_a [Rattus norvegicus] gi|149059614|gb|EDM10552.1| aminolevulinate, delta-, dehydratase, isoform CRA_a [Rattus norvegicus] Back     alignment and taxonomy information
>gi|156545691|ref|XP_001604460.1| PREDICTED: delta-aminolevulinic acid dehydratase-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|188036180|pdb|2Z1B|A Chain A, Crystal Structure Of 5-Aminolevulinic Acid Dehydratase (Alad) From Mus Musculs gi|188036181|pdb|2Z1B|B Chain B, Crystal Structure Of 5-Aminolevulinic Acid Dehydratase (Alad) From Mus Musculs gi|188036182|pdb|2Z1B|C Chain C, Crystal Structure Of 5-Aminolevulinic Acid Dehydratase (Alad) From Mus Musculs gi|188036183|pdb|2Z1B|D Chain D, Crystal Structure Of 5-Aminolevulinic Acid Dehydratase (Alad) From Mus Musculs gi|12832182|dbj|BAB21998.1| unnamed protein product [Mus musculus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query263
RGD|2083330 Alad "aminolevulinate dehydrat 0.174 0.139 0.607 3.6e-10
UNIPROTKB|G8JLA5109 NOVA1 "RNA-binding protein Nov 0.148 0.357 0.641 8.1e-09
MGI|MGI:96853330 Alad "aminolevulinate, delta-, 0.174 0.139 0.607 9.7e-09
ZFIN|ZDB-GENE-050417-123331 alad "aminolevulinate dehydrat 0.163 0.129 0.625 1.8e-08
UNIPROTKB|F1PZA0337 ALAD "Delta-aminolevulinic aci 0.174 0.136 0.588 4.4e-08
UNIPROTKB|Q58DK5329 ALAD "Delta-aminolevulinic aci 0.163 0.130 0.604 1.6e-07
UNIPROTKB|B7Z3I9313 ALAD "Delta-aminolevulinic aci 0.163 0.137 0.604 2e-07
UNIPROTKB|P13716330 ALAD "Delta-aminolevulinic aci 0.163 0.130 0.604 2.3e-07
UNIPROTKB|Q5R971330 ALAD "Delta-aminolevulinic aci 0.163 0.130 0.604 2.3e-07
UNIPROTKB|J3KQU3277 NOVA1 "RNA-binding protein Nov 0.152 0.144 0.65 2.4e-07
RGD|2083 Alad "aminolevulinate dehydratase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 152 (58.6 bits), Expect = 3.6e-10, Sum P(2) = 3.6e-10
 Identities = 31/51 (60%), Positives = 36/51 (70%)

Query:   158 AQARDVSQGADFLMVKPALPYLDIISEVKSRHPAYPLFVYQERCITVSGHF 208
             A ARD+ +GAD LMVKP LPYLD++ EVK +HP  PL VYQ     VSG F
Sbjct:   237 AVARDIQEGADILMVKPGLPYLDMVQEVKDKHPELPLAVYQ-----VSGEF 282
GO:0001666 "response to hypoxia" evidence=IEP
GO:0004655 "porphobilinogen synthase activity" evidence=ISO;ISS;IDA
GO:0005615 "extracellular space" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0006782 "protoporphyrinogen IX biosynthetic process" evidence=IEA
GO:0006783 "heme biosynthetic process" evidence=ISO;ISS;IDA
GO:0006979 "response to oxidative stress" evidence=IEP
GO:0007584 "response to nutrient" evidence=IDA
GO:0008270 "zinc ion binding" evidence=ISO;ISS
GO:0009635 "response to herbicide" evidence=IEP
GO:0009636 "response to toxic substance" evidence=IEP
GO:0009725 "response to hormone stimulus" evidence=IEP
GO:0010033 "response to organic substance" evidence=IDA
GO:0010035 "response to inorganic substance" evidence=IEP
GO:0010038 "response to metal ion" evidence=IEP;IDA
GO:0010039 "response to iron ion" evidence=IEP
GO:0010043 "response to zinc ion" evidence=IDA
GO:0010044 "response to aluminum ion" evidence=IEP
GO:0010212 "response to ionizing radiation" evidence=IEP
GO:0010266 "response to vitamin B1" evidence=IEP
GO:0010269 "response to selenium ion" evidence=IEP
GO:0010288 "response to lead ion" evidence=IEP
GO:0014070 "response to organic cyclic compound" evidence=IEP
GO:0014823 "response to activity" evidence=IEP
GO:0031667 "response to nutrient levels" evidence=IEP
GO:0032025 "response to cobalt ion" evidence=IEP
GO:0032496 "response to lipopolysaccharide" evidence=IEP
GO:0032791 "lead ion binding" evidence=ISO;ISS
GO:0033197 "response to vitamin E" evidence=IEP
GO:0033273 "response to vitamin" evidence=IEP
GO:0042221 "response to chemical stimulus" evidence=IDA
GO:0042493 "response to drug" evidence=IEP;IDA
GO:0042802 "identical protein binding" evidence=ISO
GO:0043200 "response to amino acid stimulus" evidence=IEP
GO:0045471 "response to ethanol" evidence=IDA
GO:0046685 "response to arsenic-containing substance" evidence=IEP;IDA
GO:0046686 "response to cadmium ion" evidence=IEP;IDA
GO:0046689 "response to mercury ion" evidence=IEP
GO:0051260 "protein homooligomerization" evidence=ISO
GO:0051384 "response to glucocorticoid stimulus" evidence=IEP
GO:0051597 "response to methylmercury" evidence=IEP
GO:0070541 "response to platinum ion" evidence=IEP
GO:0070542 "response to fatty acid" evidence=IEP
GO:0071284 "cellular response to lead ion" evidence=IEP
GO:0071353 "cellular response to interleukin-4" evidence=ISO
UNIPROTKB|G8JLA5 NOVA1 "RNA-binding protein Nova-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:96853 Alad "aminolevulinate, delta-, dehydratase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050417-123 alad "aminolevulinate dehydratase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1PZA0 ALAD "Delta-aminolevulinic acid dehydratase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q58DK5 ALAD "Delta-aminolevulinic acid dehydratase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|B7Z3I9 ALAD "Delta-aminolevulinic acid dehydratase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P13716 ALAD "Delta-aminolevulinic acid dehydratase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R971 ALAD "Delta-aminolevulinic acid dehydratase" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
UNIPROTKB|J3KQU3 NOVA1 "RNA-binding protein Nova-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer4.2.10.691
4th Layer4.2.1.24LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query263
smart01004321 smart01004, ALAD, Delta-aminolevulinic acid dehydr 6e-17
pfam00490322 pfam00490, ALAD, Delta-aminolevulinic acid dehydra 7e-17
PRK09283323 PRK09283, PRK09283, delta-aminolevulinic acid dehy 3e-16
cd04824320 cd04824, eu_ALAD_PBGS_cysteine_rich, Porphobilinog 2e-15
cd00384314 cd00384, ALAD_PBGS, Porphobilinogen synthase (PBGS 3e-15
COG0113330 COG0113, HemB, Delta-aminolevulinic acid dehydrata 2e-14
cd04823320 cd04823, ALAD_PBGS_aspartate_rich, Porphobilinogen 7e-13
PRK13384322 PRK13384, PRK13384, delta-aminolevulinic acid dehy 5e-08
>gnl|CDD|214968 smart01004, ALAD, Delta-aminolevulinic acid dehydratase Back     alignment and domain information 
 Score = 78.6 bits (195), Expect = 6e-17
 Identities = 28/56 (50%), Positives = 33/56 (58%), Gaps = 11/56 (19%)

Query: 160 ARDVSQGADFLMVKPALPYLDIISEVKSRHPAYPLFVYQERCITVSGHFEANEKAM 215
           A D+++GAD +MVKPALPYLDII  VK      P+  YQ     VSG     E AM
Sbjct: 234 ALDIAEGADMVMVKPALPYLDIIRRVKDEFD-LPVAAYQ-----VSG-----EYAM 278

This entry represents porphobilinogen (PBG) synthase (PBGS, or 5-aminoaevulinic acid dehydratase, or ALAD, ), which functions during the second stage of tetrapyrrole biosynthesis. This enzyme catalyses a Knorr-type condensation reaction between two molecules of ALA to generate porphobilinogen, the pyrrolic building block used in later steps. The structure of the enzyme is based on a TIM barrel topology made up of eight identical subunits, where each subunit binds to a metal ion that is essential for activity, usually zinc (in yeast, mammals and certain bacteria) or magnesium (in plants and other bacteria). A lysine has been implicated in the catalytic mechanism. The lack of PBGS enzyme causes a rare porphyric disorder known as ALAD porphyria, which appears to involve conformational changes in the enzyme. Length = 321
>gnl|CDD|215945 pfam00490, ALAD, Delta-aminolevulinic acid dehydratase Back     alignment and domain information
>gnl|CDD|236450 PRK09283, PRK09283, delta-aminolevulinic acid dehydratase; Validated Back     alignment and domain information
>gnl|CDD|240128 cd04824, eu_ALAD_PBGS_cysteine_rich, Porphobilinogen synthase (PBGS), which is also called delta-aminolevulinic acid dehydratase (ALAD), catalyzes the condensation of two 5-aminolevulinic acid (ALA) molecules to form the pyrrole porphobilinogen (PBG), which is the second step in the biosynthesis of tetrapyrroles, such as heme, vitamin B12 and chlorophyll Back     alignment and domain information
>gnl|CDD|238226 cd00384, ALAD_PBGS, Porphobilinogen synthase (PBGS), which is also called delta-aminolevulinic acid dehydratase (ALAD), catalyzes the condensation of two 5-aminolevulinic acid (ALA) molecules to form the pyrrole porphobilinogen (PBG), which is the second step in the biosynthesis of tetrapyrroles, such as heme, vitamin B12 and chlorophyll Back     alignment and domain information
>gnl|CDD|223191 COG0113, HemB, Delta-aminolevulinic acid dehydratase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|240127 cd04823, ALAD_PBGS_aspartate_rich, Porphobilinogen synthase (PBGS), which is also called delta-aminolevulinic acid dehydratase (ALAD), catalyzes the condensation of two 5-aminolevulinic acid (ALA) molecules to form the pyrrole porphobilinogen (PBG), which is the second step in the biosynthesis of tetrapyrroles, such as heme, vitamin B12 and chlorophyll Back     alignment and domain information
>gnl|CDD|172020 PRK13384, PRK13384, delta-aminolevulinic acid dehydratase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 263
cd04824320 eu_ALAD_PBGS_cysteine_rich Porphobilinogen synthas 100.0
cd00384314 ALAD_PBGS Porphobilinogen synthase (PBGS), which i 100.0
PRK13384322 delta-aminolevulinic acid dehydratase; Provisional 100.0
cd04823320 ALAD_PBGS_aspartate_rich Porphobilinogen synthase 100.0
COG0113330 HemB Delta-aminolevulinic acid dehydratase [Coenzy 100.0
PRK09283323 delta-aminolevulinic acid dehydratase; Validated 100.0
PF00490324 ALAD: Delta-aminolevulinic acid dehydratase; Inter 100.0
KOG2794|consensus340 100.0
KOG2191|consensus 402 99.56
cd0239665 PCBP_like_KH K homology RNA-binding domain, PCBP_l 91.79
cd0239361 PNPase_KH Polynucleotide phosphorylase (PNPase) K 85.21
PRK08185283 hypothetical protein; Provisional 84.54
cd0239462 vigilin_like_KH K homology RNA-binding domain_vigi 83.09
cd0010564 KH-I K homology RNA-binding domain, type I. KH bin 81.95
KOG2190|consensus 485 81.83
cd08205367 RuBisCO_IV_RLP Ribulose bisphosphate carboxylase l 81.21
smart0032269 KH K homology RNA-binding domain. 81.21
>cd04824 eu_ALAD_PBGS_cysteine_rich Porphobilinogen synthase (PBGS), which is also called delta-aminolevulinic acid dehydratase (ALAD), catalyzes the condensation of two 5-aminolevulinic acid (ALA) molecules to form the pyrrole porphobilinogen (PBG), which is the second step in the biosynthesis of tetrapyrroles, such as heme, vitamin B12 and chlorophyll Back     alignment and domain information 
Probab=100.00  E-value=9.4e-77  Score=550.75  Aligned_cols=196  Identities=27%  Similarity=0.346  Sum_probs=184.0

Q ss_pred             HHHHHHhhCCCeEEEeeeccccCCCCCcceeeeCCCcccccccccccchhchHHHHHHHHhH-hhHhhcccccccCCCcc
Q psy15130         29 LSCLVLSCLPAFLWWVQTCAMQRAKHLHCTLHVKSNLTNANVFHVSENFCTDTQLVMAYSRY-IICIALHDAWQTRPIQT  107 (263)
Q Consensus        29 ~~~~ik~~fP~l~v~~DvCLceYT~HGHCGil~~dg~i~~Nd~tv~~~~~rla~~Al~~A~A-Ad~VAPsdmm~~~Psdm  107 (263)
                      ++|.||++||+++|+|||||||||+||||||++++|.|+ ||+|| +   +|++||++||+| ||+|||||||       
T Consensus        97 air~iK~~~pdl~vi~Dvclc~YT~hGHcGil~~~g~vd-ND~Tl-~---~L~k~Avs~A~AGADiVAPSdMM-------  164 (320)
T cd04824          97 AIKLIREEFPELLIACDVCLCEYTSHGHCGILYEDGTIN-NEASV-K---RLAEVALAYAKAGAHIVAPSDMM-------  164 (320)
T ss_pred             HHHHHHHhCCCcEEEEeeeccCCCCCCcceeECCCCcCc-CHHHH-H---HHHHHHHHHHHhCCCEEeccccc-------
Confidence            789999999999999999999999999999998889999 99998 4   567999999999 9999977776       


Q ss_pred             cchhHHHHHHHHHhCCC-CCceeeee-eccccc--ccccc---------cccccccch---hHHHHHHHhchhcCCCeeE
Q psy15130        108 SATHIKDIRQKTANLSD-THKRLLQC-SKTLLQ--LNFLK---------HVQTNEFHC---IARCIAQARDVSQGADFLM  171 (263)
Q Consensus       108 ~DGrI~aIR~aLd~~G~-~~v~im~y-~k~~ss--gPFRd---------~~~~yq~~~---~~~~~e~~~Di~EGAD~Im  171 (263)
                       ||||++||++||++|| +++.||+| +||+|+  ||||+         +|++||+||   +++++|+.+|++|||||||
T Consensus       165 -DGrV~aIR~aLD~~G~~~~v~ImSYsaKyaS~fYGPFRdAa~Sap~~gDRksYQmdp~n~~eAlre~~~D~~EGAD~lM  243 (320)
T cd04824         165 -DGRVRAIKQALIQAGLGNKVSVMSYSAKFASCLYGPFRDAACSAPSFGDRRCYQLPPGARGLALRAVERDVSEGADMIM  243 (320)
T ss_pred             -ccHHHHHHHHHHHCCCccCCeeeehHHHhhhhccchHHHHhcCCCCCCCccccCCCCcCHHHHHHHHHhhHHhCCCEEE
Confidence             9999999999999999 99999999 899888  99997         589999987   5678999999999999999


Q ss_pred             ecCCccHHHHHHHHHhhCCCCCeeecccceeeccCchhHHHHHHHHH--------HHhhccCCCCCccccccccccccc
Q psy15130        172 VKPALPYLDIISEVKSRHPAYPLFVYQERCITVSGHFEANEKAMEMI--------LEKIAEDPSSGSCSNVSYALRYGT  242 (263)
Q Consensus       172 VKPg~~yLDII~~ik~~~~~~Pi~aYqERvItVSGEyami~aAa~~~--------l~kia~dp~ags~l~iSY~~l~Gp  242 (263)
                      ||||++|||||+++|++|+++|+++||     |||||+|||+|+++|        +|.+....++|++++|||++.+.+
T Consensus       244 VKPal~YLDIi~~~k~~~~~~PvaaYq-----VSGEYaMikaAa~~G~iDe~~~~~Esl~~ikRAGAd~IiTYfA~~~a  317 (320)
T cd04824         244 VKPGTPYLDIVREAKDKHPDLPLAVYH-----VSGEYAMLHAAAEAGAFDLKRAVLEAMTGFRRAGADIIITYFTPELL  317 (320)
T ss_pred             EcCCchHHHHHHHHHHhccCCCEEEEE-----ccHHHHHHHHHHHcCCCcHHHHHHHHHHHHHhcCCCEEEeecHHHHH
Confidence            999999999999999999899999999     999999999999988        888888899999999999987643

This reaction involves the formation of a Schiff base link between the substrate and the enzyme. PBGSs are metalloenzymes, some of which have a second, allosteric metal binding site, beside the metal ion binding site in their active site. Although PBGS is a family of homologous enzymes, its metal ion utilization at catalytic site varies between zinc and magnesium and/or potassium. PBGS can be classified into two groups based on differences in their active site metal binding site. The eukaryotic PBGSs represented by this model, which contain a cysteine-rich zinc binding motif (DXCXCX(Y/F)X3G(H/Q)CG), require zinc for their activity, they
>cd00384 ALAD_PBGS Porphobilinogen synthase (PBGS), which is also called delta-aminolevulinic acid dehydratase (ALAD), catalyzes the condensation of two 5-aminolevulinic acid (ALA) molecules to form the pyrrole porphobilinogen (PBG), which is the second step in the biosynthesis of tetrapyrroles, such as heme, vitamin B12 and chlorophyll Back     alignment and domain information
>PRK13384 delta-aminolevulinic acid dehydratase; Provisional Back     alignment and domain information
>cd04823 ALAD_PBGS_aspartate_rich Porphobilinogen synthase (PBGS), which is also called delta-aminolevulinic acid dehydratase (ALAD), catalyzes the condensation of two 5-aminolevulinic acid (ALA) molecules to form the pyrrole porphobilinogen (PBG), which is the second step in the biosynthesis of tetrapyrroles, such as heme, vitamin B12 and chlorophyll Back     alignment and domain information
>COG0113 HemB Delta-aminolevulinic acid dehydratase [Coenzyme metabolism] Back     alignment and domain information
>PRK09283 delta-aminolevulinic acid dehydratase; Validated Back     alignment and domain information
>PF00490 ALAD: Delta-aminolevulinic acid dehydratase; InterPro: IPR001731 Tetrapyrroles are large macrocyclic compounds derived from a common biosynthetic pathway [] Back     alignment and domain information
>KOG2794|consensus Back     alignment and domain information
>KOG2191|consensus Back     alignment and domain information
>cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like Back     alignment and domain information
>cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) Back     alignment and domain information
>PRK08185 hypothetical protein; Provisional Back     alignment and domain information
>cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>cd00105 KH-I K homology RNA-binding domain, type I Back     alignment and domain information
>KOG2190|consensus Back     alignment and domain information
>cd08205 RuBisCO_IV_RLP Ribulose bisphosphate carboxylase like proteins, Rubisco-Form IV Back     alignment and domain information
>smart00322 KH K homology RNA-binding domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query263
2z1b_A330 Crystal Structure Of 5-Aminolevulinic Acid Dehydrat 2e-11
1pv8_A330 Crystal Structure Of A Low Activity F12l Mutant Of 2e-10
1e51_A330 Crystal Structure Of Native Human Erythrocyte 5- Am 2e-10
2z0i_A330 Crystal Structure Of 5-Aminolevulinic Acid Dehydrat 3e-10
1w5q_A337 Stepwise Introduction Of Zinc Binding Site Into Por 7e-07
1w5p_A337 Stepwise Introduction Of Zinc Binding Site Into Por 7e-07
1w5o_A337 Stepwise Introduction Of Zinc Binding Site Into Por 8e-07
1w56_A337 Stepwise Introduction Of Zinc Binding Site Into Por 8e-07
1w5m_A337 Stepwise Introduction Of Zinc Binding Site Into Por 8e-07
1w5n_A337 Stepwise Introduction Of Zinc Binding Site Into Por 9e-07
1w54_A337 Stepwise Introduction Of A Zinc Binding Site Into P 9e-07
2c14_A337 5-(4-Carboxy-2-Oxo-Butylamino)-4-Oxo-Pentanoic Acid 9e-07
1b4k_A337 High Resolution Crystal Structure Of A Mg2-Dependen 9e-07
1gzg_A337 Complex Of A Mg2-Dependent Porphobilinogen Synthase 9e-07
2c13_A337 5-Hydroxy-Levulinic Acid Bound To Porphobilinogen S 4e-06
2c15_A337 5-(4-Carboxy-2-Oxo-Butoxy)-4-Oxo-Pentanoic Acid Aci 4e-06
1i8j_A323 Crystal Structure Of Porphobilinogen Synthase Compl 3e-04
1b4e_A323 X-Ray Structure Of 5-Aminolevulinic Acid Dehydratas 3e-04
1l6s_A323 Crystal Structure Of Porphobilinogen Synthase Compl 3e-04
2anr_A178 Crystal Structure (Ii) Of Nova-1 Kh1KH2 DOMAIN TAND 4e-04
2ann_A178 Crystal Structure (I) Of Nova-1 Kh1KH2 DOMAIN TANDE 5e-04
>pdb|2Z1B|A Chain A, Crystal Structure Of 5-Aminolevulinic Acid Dehydratase (Alad) From Mus Musculs Length = 330 Back     alignment and structure 
Iteration: 1

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 31/51 (60%), Positives = 36/51 (70%), Gaps = 5/51 (9%)
Query: 158 AQARDVSQGADFLMVKPALPYLDIISEVKSRHPAYPLFVYQERCITVSGHF 208
           A ARD+ +GAD LMVKP LPYLD++ EVK +HP  PL VYQ     VSG F
Sbjct: 237 AVARDIQEGADMLMVKPGLPYLDMVREVKDKHPELPLAVYQ-----VSGEF 282
>pdb|1PV8|A Chain A, Crystal Structure Of A Low Activity F12l Mutant Of Human Porphobilinogen Synthase Length = 330 Back     alignment and structure
>pdb|1E51|A Chain A, Crystal Structure Of Native Human Erythrocyte 5- Aminolaevulinic Acid Dehydratase Length = 330 Back     alignment and structure
>pdb|2Z0I|A Chain A, Crystal Structure Of 5-Aminolevulinic Acid Dehydratase (Alad) From Mus Musculus Length = 330 Back     alignment and structure
>pdb|1W5Q|A Chain A, Stepwise Introduction Of Zinc Binding Site Into Porphobilinogen Synthase Of Pseudomonas Aeruginosa (Mutations A129c, D131c, D139c, P132e, K229r) Length = 337 Back     alignment and structure
>pdb|1W5P|A Chain A, Stepwise Introduction Of Zinc Binding Site Into Porphobilinogen Synthase Of Pseudomonas Aeruginosa (Mutations A129c, D131c, D139c, P132e) Length = 337 Back     alignment and structure
>pdb|1W5O|A Chain A, Stepwise Introduction Of Zinc Binding Site Into Porphobilinogen Synthase Of Pseudomonas Aeruginosa (Mutations A129c, D131c And D139c) Length = 337 Back     alignment and structure
>pdb|1W56|A Chain A, Stepwise Introduction Of Zinc Binding Site Into Porphobilinogen Synthase Of Pseudomonas Aeruginosa (Mutations A129c And D131c) Length = 337 Back     alignment and structure
>pdb|1W5M|A Chain A, Stepwise Introduction Of Zinc Binding Site Into Porphobilinogen Synthase Of Pseudomonas Aeruginosa (Mutations A129c And D139c) Length = 337 Back     alignment and structure
>pdb|1W5N|A Chain A, Stepwise Introduction Of Zinc Binding Site Into Porphobilinogen Synthase Of Pseudomonas Aeruginosa (Mutations D131c And D139c) Length = 337 Back     alignment and structure
>pdb|1W54|A Chain A, Stepwise Introduction Of A Zinc Binding Site Into Porphobilinogen Synthase From Pseudomonas Aeruginosa (mutation D139c) Length = 337 Back     alignment and structure
>pdb|2C14|A Chain A, 5-(4-Carboxy-2-Oxo-Butylamino)-4-Oxo-Pentanoic Acid Acid Bound To Porphobilinogen Synthase From Pseudomonas Aeruginosa Length = 337 Back     alignment and structure
>pdb|1B4K|A Chain A, High Resolution Crystal Structure Of A Mg2-Dependent 5-Aminolevulinic Acid Dehydratase Length = 337 Back     alignment and structure
>pdb|1GZG|A Chain A, Complex Of A Mg2-Dependent Porphobilinogen Synthase From Pseudomonas Aeruginosa (Mutant D139n) With 5-Fluorolevulinic Acid Length = 337 Back     alignment and structure
>pdb|2C13|A Chain A, 5-Hydroxy-Levulinic Acid Bound To Porphobilinogen Synthase From Pseudomonas Aeruginosa Length = 337 Back     alignment and structure
>pdb|2C15|A Chain A, 5-(4-Carboxy-2-Oxo-Butoxy)-4-Oxo-Pentanoic Acid Acid Bound To Porphobilinogen Synthase From Pseudomonas Aeruginosa Length = 337 Back     alignment and structure
>pdb|1I8J|A Chain A, Crystal Structure Of Porphobilinogen Synthase Complexed With The Inhibitor 4,7-Dioxosebacic Acid Length = 323 Back     alignment and structure
>pdb|1B4E|A Chain A, X-Ray Structure Of 5-Aminolevulinic Acid Dehydratase Complexed With The Inhibitor Levulinic Acid Length = 323 Back     alignment and structure
>pdb|1L6S|A Chain A, Crystal Structure Of Porphobilinogen Synthase Complexed With The Inhibitor 4,7-Dioxosebacic Acid Length = 323 Back     alignment and structure
>pdb|2ANR|A Chain A, Crystal Structure (Ii) Of Nova-1 Kh1KH2 DOMAIN TANDEM WITH 25NT RNA Hairpin Length = 178 Back     alignment and structure
>pdb|2ANN|A Chain A, Crystal Structure (I) Of Nova-1 Kh1KH2 DOMAIN TANDEM WITH 25 NT RNA Hairpin Length = 178 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query263
1pv8_A330 Delta-aminolevulinic acid dehydratase; porphobilin 6e-19
1h7n_A342 5-aminolaevulinic acid dehydratase; lyase, aldolas 1e-18
1w1z_A328 Delta-aminolevulinic acid dehydratase; synthase, t 5e-16
3obk_A356 Delta-aminolevulinic acid dehydratase; ssgcid, str 6e-16
1l6s_A323 Porphobilinogen synthase; dehydratase, lyase; HET: 1e-15
1w5q_A337 Delta-aminolevulinic acid dehydratase; synthase, e 1e-15
1we8_A104 Tudor and KH domain containing protein; structural 7e-09
1x4m_A94 FAR upstream element binding protein 1; KH domain, 1e-07
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 4e-07
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 2e-06
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 4e-06
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 1e-05
1x4n_A92 FAR upstream element binding protein 1; KH domain, 2e-05
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 2e-04
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 3e-04
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 2e-04
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 3e-04
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 3e-04
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 4e-04
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 5e-04
>1pv8_A Delta-aminolevulinic acid dehydratase; porphobilinogen synthase, tetrapyrrole biosynthesis, reactio intermediate, lyase; HET: PB1; 2.20A {Homo sapiens} SCOP: c.1.10.3 PDB: 1e51_A* 2z0i_A 2z1b_A Length = 330 Back     alignment and structure
 Score = 83.7 bits (208), Expect = 6e-19
 Identities = 31/56 (55%), Positives = 35/56 (62%), Gaps = 10/56 (17%)

Query: 160 ARDVSQGADFLMVKPALPYLDIISEVKSRHPAYPLFVYQERCITVSGHFEANEKAM 215
            RDV +GAD LMVKP +PYLDI+ EVK +HP  PL VY      VSG     E AM
Sbjct: 239 DRDVREGADMLMVKPGMPYLDIVREVKDKHPDLPLAVYH-----VSG-----EFAM 284
>1h7n_A 5-aminolaevulinic acid dehydratase; lyase, aldolase, TIM barrel, tetrapyrrole synthesis; HET: SHF; 1.6A {Saccharomyces cerevisiae} SCOP: c.1.10.3 PDB: 1h7p_A* 1h7r_A* 1ohl_A* 1qml_A 1qnv_A 1w31_A* 1h7o_A* 1eb3_A* 1gjp_A* 1ylv_A* 1aw5_A Length = 342 Back     alignment and structure
>1w1z_A Delta-aminolevulinic acid dehydratase; synthase, tetrapyrrole biosynthesis, ALAD, porphyrin biosynt heme biosynthesis, lyase; 2.6A {Prosthecochloris vibrioformis} SCOP: c.1.10.3 PDB: 2c1h_A* Length = 328 Back     alignment and structure
>3obk_A Delta-aminolevulinic acid dehydratase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, lyase; HET: PBG; 2.50A {Toxoplasma gondii ME49} Length = 356 Back     alignment and structure
>1l6s_A Porphobilinogen synthase; dehydratase, lyase; HET: CME DSB; 1.70A {Escherichia coli} SCOP: c.1.10.3 PDB: 1i8j_A* 1l6y_A* 1b4e_A Length = 323 Back     alignment and structure
>1w5q_A Delta-aminolevulinic acid dehydratase; synthase, evolution, metalloenzyme, porphobilinogen synthase, protein engineering,; 1.4A {Pseudomonas aeruginosa} PDB: 1w5p_A* 1w5o_A 1w5n_A 1w56_A 1w5m_A 1w54_A 1gzg_A* 1b4k_A 2woq_A* 2c14_A* 2c16_A* 2c19_A* 2c15_A* 2c18_A* 2c13_A* Length = 337 Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query263
1h7n_A342 5-aminolaevulinic acid dehydratase; lyase, aldolas 100.0
1w5q_A337 Delta-aminolevulinic acid dehydratase; synthase, e 100.0
1w1z_A328 Delta-aminolevulinic acid dehydratase; synthase, t 100.0
1pv8_A330 Delta-aminolevulinic acid dehydratase; porphobilin 100.0
3obk_A356 Delta-aminolevulinic acid dehydratase; ssgcid, str 100.0
1l6s_A323 Porphobilinogen synthase; dehydratase, lyase; HET: 100.0
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 95.98
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 95.11
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 94.98
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 94.66
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 93.95
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 93.47
1we8_A104 Tudor and KH domain containing protein; structural 93.05
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 92.52
1x4m_A94 FAR upstream element binding protein 1; KH domain, 92.32
1x4n_A92 FAR upstream element binding protein 1; KH domain, 91.62
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 91.44
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 91.25
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 90.49
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 90.2
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 89.61
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 88.47
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 87.46
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 87.18
1j4w_A174 FUSE binding protein; single-stranded DNA binding 86.66
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 85.54
2dgr_A83 Ring finger and KH domain-containing protein 1; st 84.84
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 80.43
>1h7n_A 5-aminolaevulinic acid dehydratase; lyase, aldolase, TIM barrel, tetrapyrrole synthesis; HET: SHF; 1.6A {Saccharomyces cerevisiae} SCOP: c.1.10.3 PDB: 1h7p_A* 1h7r_A* 1ohl_A* 1qml_A 1qnv_A 1w31_A* 1h7o_A* 1eb3_A* 1gjp_A* 1ylv_A* 1aw5_A Back     alignment and structure
Probab=100.00  E-value=4.2e-77  Score=555.57  Aligned_cols=198  Identities=21%  Similarity=0.247  Sum_probs=185.6

Q ss_pred             HHHHHHHhhCCCeEEEeeeccccCCCCCcceeeeCCCcccccccccccchhchHHHHHHHHhH-hhHhhcccccccCCCc
Q psy15130         28 VLSCLVLSCLPAFLWWVQTCAMQRAKHLHCTLHVKSNLTNANVFHVSENFCTDTQLVMAYSRY-IICIALHDAWQTRPIQ  106 (263)
Q Consensus        28 ~~~~~ik~~fP~l~v~~DvCLceYT~HGHCGil~~dg~i~~Nd~tv~~~~~rla~~Al~~A~A-Ad~VAPsdmm~~~Psd  106 (263)
                      -++|.||+.|||++|+|||||||||+||||||++++|.|+ ||+||    .+|++||++||+| ||+|||||||      
T Consensus       114 rair~iK~~~pdl~VitDvcLc~YT~HGHcGil~~~g~V~-ND~Tl----~~Lak~Als~A~AGAdiVAPSdMM------  182 (342)
T 1h7n_A          114 QGIKFIREYFPELYIICDVCLCEYTSHGHCGVLYDDGTIN-RERSV----SRLAAVAVNYAKAGAHCVAPSDMI------  182 (342)
T ss_dssp             HHHHHHHHHCTTSEEEEEECSTTTBTTCCSSCBCTTSSBC-HHHHH----HHHHHHHHHHHHHTCSEEEECCCC------
T ss_pred             HHHHHHHHHCCCeEEEEeeecccccCCCceeEECCCCcCc-cHHHH----HHHHHHHHHHHHcCCCeeeccccc------
Confidence            5799999999999999999999999999999998889999 99998    4577999999999 9999977777      


Q ss_pred             ccchhHHHHHHHHHhCCC-CCceeeee-eccccc--ccccc---------cccccccch---hHHHHHHHhchhcCCCee
Q psy15130        107 TSATHIKDIRQKTANLSD-THKRLLQC-SKTLLQ--LNFLK---------HVQTNEFHC---IARCIAQARDVSQGADFL  170 (263)
Q Consensus       107 m~DGrI~aIR~aLd~~G~-~~v~im~y-~k~~ss--gPFRd---------~~~~yq~~~---~~~~~e~~~Di~EGAD~I  170 (263)
                        ||||++||++||++|| +|+.||+| +||+|+  |||||         +|++||++|   +++++|+.+|++||||||
T Consensus       183 --DGrV~aIR~aLd~~G~~~~v~ImsYsaKyASafYGPFRdAa~Sap~~GDRktYQmdpaN~~EAlre~~~Di~EGAD~v  260 (342)
T 1h7n_A          183 --DGRIRDIKRGLINANLAHKTFVLSYAAKFSGNLYGPFRDAACSAPSNGDRKCYQLPPAGRGLARRALERDMSEGADGI  260 (342)
T ss_dssp             --TTHHHHHHHHHHHTTCTTTCEEEEEEEEBCSSCCHHHHHHHTCCCSSSCSTTTSBCTTCHHHHHHHHHHHHHTTCSEE
T ss_pred             --ccHHHHHHHHHHHCCCccCceEeechHHHhHHhhHHHHHHHhcCCCCCCccccCCCCCCHHHHHHHHHhhHHhCCCeE
Confidence              9999999999999999 99999999 888888  99997         589999987   677899999999999999


Q ss_pred             EecCCccHHHHHHHHHhhCCCCCeeecccceeeccCchhHHHHHHHHH--------HHhhccCCCCCccccccccccccc
Q psy15130        171 MVKPALPYLDIISEVKSRHPAYPLFVYQERCITVSGHFEANEKAMEMI--------LEKIAEDPSSGSCSNVSYALRYGT  242 (263)
Q Consensus       171 mVKPg~~yLDII~~ik~~~~~~Pi~aYqERvItVSGEyami~aAa~~~--------l~kia~dp~ags~l~iSY~~l~Gp  242 (263)
                      |||||++|||||+++|++++++|+++||     |||||+|||+|+++|        +|.+....++|++++|||++.+.+
T Consensus       261 MVKPal~YLDIi~~vk~~~p~~P~aaYq-----VSGEYAMikaAa~~GwiD~~~~v~Esl~~~kRAGAd~IiTYfA~~~a  335 (342)
T 1h7n_A          261 IVKPSTFYLDIMRDASEICKDLPICAYH-----VSGEYAMLHAAAEKGVVDLKTIAFESHQGFLRAGARLIITYLAPEFL  335 (342)
T ss_dssp             EEESSGGGHHHHHHHHHHTTTSCEEEEE-----CHHHHHHHHHHHHTTSSCHHHHHHHHHHHHHHTTCSEEEETTHHHHH
T ss_pred             EEecCccHHHHHHHHHHhccCCCeEEEE-----cCcHHHHHHHHHHcCCccHHHHHHHHHHHHHhcCCCEEEeecHHHHH
Confidence            9999999999999999999899999999     999999999999987        888888899999999999987755


Q ss_pred             c
Q psy15130        243 E  243 (263)
Q Consensus       243 ~  243 (263)
                      .
T Consensus       336 ~  336 (342)
T 1h7n_A          336 D  336 (342)
T ss_dssp             H
T ss_pred             H
Confidence            3
>1w5q_A Delta-aminolevulinic acid dehydratase; synthase, evolution, metalloenzyme, porphobilinogen synthase, protein engineering,; 1.4A {Pseudomonas aeruginosa} PDB: 1w5p_A* 1w5o_A 1w5n_A 1w56_A 1w5m_A 1w54_A 1gzg_A* 1b4k_A 2woq_A* 2c14_A* 2c16_A* 2c19_A* 2c15_A* 2c18_A* 2c13_A* Back     alignment and structure
>1w1z_A Delta-aminolevulinic acid dehydratase; synthase, tetrapyrrole biosynthesis, ALAD, porphyrin biosynt heme biosynthesis, lyase; 2.6A {Prosthecochloris vibrioformis} SCOP: c.1.10.3 PDB: 2c1h_A* Back     alignment and structure
>1pv8_A Delta-aminolevulinic acid dehydratase; porphobilinogen synthase, tetrapyrrole biosynthesis, reactio intermediate, lyase; HET: PB1; 2.20A {Homo sapiens} SCOP: c.1.10.3 PDB: 1e51_A* 2z0i_A 2z1b_A Back     alignment and structure
>3obk_A Delta-aminolevulinic acid dehydratase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, lyase; HET: PBG; 2.50A {Toxoplasma gondii ME49} Back     alignment and structure
>1l6s_A Porphobilinogen synthase; dehydratase, lyase; HET: CME DSB; 1.70A {Escherichia coli} SCOP: c.1.10.3 PDB: 1i8j_A* 1l6y_A* 1b4e_A Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Back     alignment and structure
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 263
d1h7na_340 c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD 2e-07
d1we8a_104 d.51.1.1 (A:) Tudor and KH domain containing prote 4e-05
d2c1ha1319 c.1.10.3 (A:10-328) 5-aminolaevulinate dehydratase 1e-04
d1pv8a_320 c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD 2e-04
d2axya171 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum 3e-04
d1x4na179 d.51.1.1 (A:8-86) Far upstream binding element, FB 3e-04
d1dtja_74 d.51.1.1 (A:) Neuro-oncological ventral antigen 2, 5e-04
d1x4ma181 d.51.1.1 (A:8-88) Far upstream binding element, FB 6e-04
d2ctla184 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T 7e-04
d1j4wa271 d.51.1.1 (A:104-174) Far upstream binding element, 9e-04
d1zzka175 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie 0.001
d1j4wa174 d.51.1.1 (A:1-74) Far upstream binding element, FB 0.001
d1wvna170 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma 0.001
d2ctea181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 0.004
>d1h7na_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 340 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Aldolase
family: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase)
domain: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase)
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 49.2 bits (117), Expect = 2e-07
 Identities = 24/73 (32%), Positives = 32/73 (43%), Gaps = 10/73 (13%)

Query: 143 KHVQTNEFHCIARCIAQARDVSQGADFLMVKPALPYLDIISEVKSRHPAYPLFVYQERCI 202
           K  Q           A  RD+S+GAD ++VKP+  YLDI+ +        P+  Y     
Sbjct: 233 KCYQLPPAGRGLARRALERDMSEGADGIIVKPSTFYLDIMRDASEICKDLPICAYH---- 288

Query: 203 TVSGHFEANEKAM 215
            VSG     E AM
Sbjct: 289 -VSG-----EYAM 295
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2c1ha1 c.1.10.3 (A:10-328) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Prosthecochloris vibrioformis [TaxId: 1098]} Length = 319 Back     information, alignment and structure
>d1pv8a_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query263
d1gzga_329 5-aminolaevulinate dehydratase, ALAD (porphobilino 100.0
d2c1ha1319 5-aminolaevulinate dehydratase, ALAD (porphobilino 100.0
d1l6sa_323 5-aminolaevulinate dehydratase, ALAD (porphobilino 100.0
d1pv8a_320 5-aminolaevulinate dehydratase, ALAD (porphobilino 100.0
d1h7na_340 5-aminolaevulinate dehydratase, ALAD (porphobilino 100.0
d1x4ma181 Far upstream binding element, FBP {Mouse (Mus musc 94.91
d2axya171 Poly(RC)-binding protein 2 {Human (Homo sapiens) [ 94.78
d1wvna170 Poly(RC)-binding protein 1 {Human (Homo sapiens) [ 93.98
d1dtja_74 Neuro-oncological ventral antigen 2, nova-2, KH3 { 93.59
d1zzka175 HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} 93.48
d1j4wa271 Far upstream binding element, FBP {Human (Homo sap 93.09
d1we8a_104 Tudor and KH domain containing protein, Tdrkh {Mou 92.2
d1x4na179 Far upstream binding element, FBP {Mouse (Mus musc 91.33
d1j4wa174 Far upstream binding element, FBP {Human (Homo sap 90.93
d2ctja182 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 89.25
d2ctla184 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 84.99
d2ba0a384 Exosome complex RNA-binding protein 1, ECR1 {Archa 84.38
d2ctea181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 83.51
>d1gzga_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Aldolase
family: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase)
domain: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase)
species: Pseudomonas aeruginosa [TaxId: 287]

Probab=100.00  E-value=2.8e-75  Score=540.24  Aligned_cols=196  Identities=21%  Similarity=0.261  Sum_probs=183.6

Q ss_pred             HHHHHHHhhCCCeEEEeeeccccCCCCCcceeeeCCCcccccccccccchhchHHHHHHHHhH-hhHhhcccccccCCCc
Q psy15130         28 VLSCLVLSCLPAFLWWVQTCAMQRAKHLHCTLHVKSNLTNANVFHVSENFCTDTQLVMAYSRY-IICIALHDAWQTRPIQ  106 (263)
Q Consensus        28 ~~~~~ik~~fP~l~v~~DvCLceYT~HGHCGil~~dg~i~~Nd~tv~~~~~rla~~Al~~A~A-Ad~VAPsdmm~~~Psd  106 (263)
                      -++|.||+.||+++|||||||||||+||||||++++|.|+ ||.|| +   .|++||++||+| ||+|||||||      
T Consensus       104 rAIr~IK~~~p~l~vi~DVcLc~YT~hGHcGil~~~g~id-ND~Tl-~---~L~k~Al~~A~AGaDivAPSdMM------  172 (329)
T d1gzga_         104 RATRALRERFPELGIITDVALDPFTTHGQNGILDDDGYVL-NDVSI-D---VLVRQALSHAEAGAQVVAPSDMM------  172 (329)
T ss_dssp             HHHHHHHHHCTTSEEEEEECSTTTBTTCCSSCBCTTSCBC-HHHHH-H---HHHHHHHHHHHHTCSEEEECSCC------
T ss_pred             HHHHHHHHhhCcEEEEehhccchhhhhccCCcccCCCCcC-cHHHH-H---HHHHHHHHHHHccCCeeeccccc------
Confidence            4789999999999999999999999999999999999999 99999 4   466999999999 9999977777      


Q ss_pred             ccchhHHHHHHHHHhCCCCCceeeee-eccccc--ccccc-----------cccccccch---hHHHHHHHhchhcCCCe
Q psy15130        107 TSATHIKDIRQKTANLSDTHKRLLQC-SKTLLQ--LNFLK-----------HVQTNEFHC---IARCIAQARDVSQGADF  169 (263)
Q Consensus       107 m~DGrI~aIR~aLd~~G~~~v~im~y-~k~~ss--gPFRd-----------~~~~yq~~~---~~~~~e~~~Di~EGAD~  169 (263)
                        ||||++||++||++||+++.||+| +||+|+  |||||           +|++||+|+   .++++|+.+|++|||||
T Consensus       173 --DGrV~aIR~~Ld~~g~~~v~ImsYsaKfaS~fYGPFRda~~S~p~~~~gdr~sYQmd~~n~~eA~~e~~~D~~EGAD~  250 (329)
T d1gzga_         173 --DGRIGAIREALESAGHTNVRVMAYSAKYASAYYGPFRDAVGSASNLGKGNKATYQMDPANSDEALHEVAADLAEGADM  250 (329)
T ss_dssp             --TTHHHHHHHHHHHTTCTTCEEEEEEEEBCCGGGHHHHHHHTCHHHHTTCCCTTTSBCTTCSHHHHHHHHHHHHTTCSE
T ss_pred             --hhHHHHHHHHHHHcCCcCcceeehhhhhchhhhhhHHHHhhchhccCCCCccccccCCCCHHHHHHHHHHHHhcCCCe
Confidence              999999999999999999999999 888888  99996           579999987   77889999999999999


Q ss_pred             eEecCCccHHHHHHHHHhhCCCCCeeecccceeeccCchhHHHHHHHHH-------HHhhccCCCCCccccccccccccc
Q psy15130        170 LMVKPALPYLDIISEVKSRHPAYPLFVYQERCITVSGHFEANEKAMEMI-------LEKIAEDPSSGSCSNVSYALRYGT  242 (263)
Q Consensus       170 ImVKPg~~yLDII~~ik~~~~~~Pi~aYqERvItVSGEyami~aAa~~~-------l~kia~dp~ags~l~iSY~~l~Gp  242 (263)
                      ||||||++|||||+++|+++ ++|+++||     |||||+|+|+|+++|       +|.+....++|++++|||++.+.+
T Consensus       251 lMVKPa~~yLDii~~~~~~~-~~Pv~aYq-----VSGEYami~~a~~~g~~~~~~~~E~l~~~kRAGAd~IitY~a~~~a  324 (329)
T d1gzga_         251 VMVKPGMPYLDIVRRVKDEF-RAPTFVYQ-----VSGEYAMHMGAIQNGWLAESVILESLTAFKRAGADGILTYFAKQAA  324 (329)
T ss_dssp             EEEESSGGGHHHHHHHHHHH-CSCEEEEE-----CHHHHHHHHHHHHTTSSCTTHHHHHHHHHHHHTCSEEEETTHHHHH
T ss_pred             EEeccchhhhHHHHHHHHcc-CCCEEEEe-----CchHHHHHHHHHHcCCcchhHHHHHHHHHHhcCCCEEEEccHHHHH
Confidence            99999999999999999998 89999999     999999999999877       788888889999999999987653
>d2c1ha1 c.1.10.3 (A:10-328) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Prosthecochloris vibrioformis [TaxId: 1098]} Back     information, alignment and structure
>d1l6sa_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pv8a_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h7na_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure