Psyllid ID: psy15167


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70-----
MFMFTHPGGPDTNHVQRSQIGTRSGRWLSVSTMQRQLSWTRPSLLEGHKLAHDLGAGSPCLQCKDNCPGLDLHFW
cccccccccccccHHHHHcccccccccEEcccHHHHHHHHccccccccccccccccccccccccccccccccccc
cccEcccccccccccEEcccccccccEccccccHHHHcccHHHHHHHccHHHcccccccccccccccccccEccc
mfmfthpggpdtnhvqrsqigtrsgrWLSVSTMQrqlswtrpslleghklahdlgagspclqckdncpgldlhfw
mfmfthpggpdtnhvqrsqigtrSGRWLSVSTMQRQLSWTRPSLLEGHKLAHDLGAGSPCLQCKDNCPGLDLHFW
MFMFTHPGGPDTNHVQRSQIGTRSGRWLSVSTMQRQLSWTRPSLLEGHKLAHDLGAGSPCLQCKDNCPGLDLHFW
**************************WLSVSTMQRQLSWTRPSLLEGHKLAHDLGAGSPCLQCKDNCPGLDLH**
*F**************************************************DLGAGSPCLQCKDNCPGLDLHFW
**********DTNHVQRSQIGTRSGRWLSVSTMQRQLSWTRPSLLEGHKLAHDLGAGSPCLQCKDNCPGLDLHFW
*F****P*GPDTNHVQRSQIGTRSGRW***********WT***LLEGHKLAHDLGAGSPCLQCKDNCPGLDLHFW
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFMFTHPGGPDTNHVQRSQIGTRSGRWLSVSTMQRQLSWTRPSLLEGHKLAHDLGAGSPCLQCKDNCPGLDLHFW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query75 2.2.26 [Sep-21-2011]
Q2LAP6 419 Testin OS=Rattus norvegic yes N/A 0.346 0.062 0.615 3e-05
Q90YH9 422 Testin OS=Gallus gallus G yes N/A 0.346 0.061 0.615 5e-05
Q7ZXE9 422 Testin OS=Xenopus laevis N/A N/A 0.346 0.061 0.576 6e-05
Q2QLA1 422 Testin OS=Monodelphis dom yes N/A 0.346 0.061 0.576 0.0001
Q2QL92 421 Testin OS=Microcebus muri N/A N/A 0.346 0.061 0.576 0.0001
Q2IBH0 421 Testin OS=Eulemur macaco N/A N/A 0.346 0.061 0.576 0.0001
Q2QLH9 421 Testin OS=Otolemur garnet N/A N/A 0.346 0.061 0.576 0.0001
Q108U9 421 Testin OS=Loxodonta afric yes N/A 0.346 0.061 0.576 0.0001
A0M8U6 421 Testin OS=Canis familiari yes N/A 0.346 0.061 0.576 0.0002
Q6DIR5 422 Testin OS=Xenopus tropica yes N/A 0.346 0.061 0.576 0.0002
>sp|Q2LAP6|TES_RAT Testin OS=Rattus norvegicus GN=Tes PE=1 SV=1 Back     alignment and function desciption
 Score = 47.0 bits (110), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 16/26 (61%), Positives = 21/26 (80%)

Query: 50 LAHDLGAGSPCLQCKDNCPGLDLHFW 75
          L H+ G G+PCL+CK+NC G +LHFW
Sbjct: 12 LGHEQGFGAPCLKCKENCEGFELHFW 37




Scaffold protein that may play a role in cell adhesion, cell spreading and in the reorganization of the actin cytoskeleton. Plays a role in the regulation of cell proliferation. May act as a tumor suppressor.
Rattus norvegicus (taxid: 10116)
>sp|Q90YH9|TES_CHICK Testin OS=Gallus gallus GN=TES PE=2 SV=1 Back     alignment and function description
>sp|Q7ZXE9|TES_XENLA Testin OS=Xenopus laevis GN=tes PE=2 SV=1 Back     alignment and function description
>sp|Q2QLA1|TES_MONDO Testin OS=Monodelphis domestica GN=TES PE=3 SV=1 Back     alignment and function description
>sp|Q2QL92|TES_MICMU Testin OS=Microcebus murinus GN=TES PE=3 SV=1 Back     alignment and function description
>sp|Q2IBH0|TES_EULMM Testin OS=Eulemur macaco macaco GN=TES PE=3 SV=1 Back     alignment and function description
>sp|Q2QLH9|TES_OTOGA Testin OS=Otolemur garnettii GN=TES PE=3 SV=1 Back     alignment and function description
>sp|Q108U9|TES_LOXAF Testin OS=Loxodonta africana GN=TES PE=3 SV=1 Back     alignment and function description
>sp|A0M8U6|TES_CANFA Testin OS=Canis familiaris GN=TES PE=3 SV=1 Back     alignment and function description
>sp|Q6DIR5|TES_XENTR Testin OS=Xenopus tropicalis GN=tes PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query75
328724369 559 PREDICTED: testin-like [Acyrthosiphon pi 0.373 0.050 0.75 1e-06
195488727 816 GE14189 [Drosophila yakuba] gi|194178537 0.48 0.044 0.611 2e-06
195335231 816 GM19980 [Drosophila sechellia] gi|194126 0.48 0.044 0.611 2e-06
372810480 851 FI18181p1 [Drosophila melanogaster] 0.48 0.042 0.611 2e-06
195584212 816 GD25476 [Drosophila simulans] gi|1941939 0.48 0.044 0.611 2e-06
159884211 848 RE57334p [Drosophila melanogaster] 0.48 0.042 0.611 2e-06
195150369 816 GL10662 [Drosophila persimilis] gi|19410 0.48 0.044 0.638 3e-06
198457161 816 GA19661 [Drosophila pseudoobscura pseudo 0.48 0.044 0.638 3e-06
242025162 642 hypothetical protein Phum_PHUM607980 [Pe 0.373 0.043 0.714 4e-06
383852121 799 PREDICTED: uncharacterized protein LOC10 0.36 0.033 0.703 6e-06
>gi|328724369|ref|XP_001949083.2| PREDICTED: testin-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score = 57.4 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 21/28 (75%), Positives = 25/28 (89%)

Query: 48 HKLAHDLGAGSPCLQCKDNCPGLDLHFW 75
          HKLAH++G+GS CL+C D CPGLDLHFW
Sbjct: 26 HKLAHEVGSGSSCLKCGDACPGLDLHFW 53




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|195488727|ref|XP_002092436.1| GE14189 [Drosophila yakuba] gi|194178537|gb|EDW92148.1| GE14189 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|195335231|ref|XP_002034278.1| GM19980 [Drosophila sechellia] gi|194126248|gb|EDW48291.1| GM19980 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|372810480|gb|AEX98032.1| FI18181p1 [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195584212|ref|XP_002081908.1| GD25476 [Drosophila simulans] gi|194193917|gb|EDX07493.1| GD25476 [Drosophila simulans] Back     alignment and taxonomy information
>gi|159884211|gb|ABX00784.1| RE57334p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195150369|ref|XP_002016127.1| GL10662 [Drosophila persimilis] gi|194109974|gb|EDW32017.1| GL10662 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|198457161|ref|XP_001360570.2| GA19661 [Drosophila pseudoobscura pseudoobscura] gi|198135882|gb|EAL25145.2| GA19661 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|242025162|ref|XP_002432995.1| hypothetical protein Phum_PHUM607980 [Pediculus humanus corporis] gi|212518504|gb|EEB20257.1| hypothetical protein Phum_PHUM607980 [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|383852121|ref|XP_003701577.1| PREDICTED: uncharacterized protein LOC100875736 [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query75
FB|FBgn0034223 816 Tes "Testin ortholog" [Drosoph 0.48 0.044 0.611 4.2e-08
RGD|1566346 419 Tes "testis derived transcript 0.346 0.062 0.615 1e-05
ZFIN|ZDB-GENE-040718-59 542 tes "testis derived transcript 0.346 0.047 0.615 1.5e-05
UNIPROTKB|E1BYP6 413 TES "Testin" [Gallus gallus (t 0.346 0.062 0.615 1.7e-05
UNIPROTKB|Q90YH9 422 TES "Testin" [Gallus gallus (t 0.346 0.061 0.615 1.7e-05
UNIPROTKB|Q7ZXE9 422 tes "Testin" [Xenopus laevis ( 0.346 0.061 0.576 2.8e-05
UNIPROTKB|E2RDJ9 412 TES "Testin" [Canis lupus fami 0.346 0.063 0.576 4.4e-05
UNIPROTKB|J9JIM9 419 TES "Testin" [Sus scrofa (taxi 0.346 0.062 0.576 4.6e-05
UNIPROTKB|Q2YDE9 421 TES "Testin" [Bos taurus (taxi 0.346 0.061 0.576 4.6e-05
UNIPROTKB|A0M8U6 421 TES "Testin" [Canis lupus fami 0.346 0.061 0.576 4.6e-05
FB|FBgn0034223 Tes "Testin ortholog" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 137 (53.3 bits), Expect = 4.2e-08, P = 4.2e-08
 Identities = 22/36 (61%), Positives = 27/36 (75%)

Query:    40 TRPSLLEGHKLAHDLGAGSPCLQCKDNCPGLDLHFW 75
             +R   L+  KL H+ GAG+PC +CKD CPGLDLHFW
Sbjct:    24 SRREQLKRSKLGHEAGAGAPCAECKDKCPGLDLHFW 59




GO:0008270 "zinc ion binding" evidence=IEA
GO:0015629 "actin cytoskeleton" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
RGD|1566346 Tes "testis derived transcript" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040718-59 tes "testis derived transcript (3 LIM domains)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BYP6 TES "Testin" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q90YH9 TES "Testin" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q7ZXE9 tes "Testin" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|E2RDJ9 TES "Testin" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9JIM9 TES "Testin" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q2YDE9 TES "Testin" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|A0M8U6 TES "Testin" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

No hit with probability above 80.00