Psyllid ID: psy15193
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 106 | ||||||
| 242025524 | 273 | Negative elongation factor E, putative [ | 0.584 | 0.227 | 0.596 | 3e-14 | |
| 321457448 | 277 | hypothetical protein DAPPUDRAFT_301427 [ | 0.584 | 0.223 | 0.564 | 7e-14 | |
| 91078286 | 270 | PREDICTED: similar to Negative elongatio | 0.556 | 0.218 | 0.542 | 3e-12 | |
| 157133920 | 279 | hypothetical protein AaeL_AAEL003077 [Ae | 0.528 | 0.200 | 0.614 | 3e-12 | |
| 194865848 | 280 | GG15071 [Drosophila erecta] gi|190653416 | 0.584 | 0.221 | 0.516 | 6e-12 | |
| 195326059 | 280 | GM24927 [Drosophila sechellia] gi|194118 | 0.584 | 0.221 | 0.516 | 6e-12 | |
| 195491140 | 280 | GE21294 [Drosophila yakuba] gi|194179535 | 0.584 | 0.221 | 0.516 | 7e-12 | |
| 24661022 | 280 | negative elongation factor E [Drosophila | 0.584 | 0.221 | 0.516 | 7e-12 | |
| 195125830 | 281 | GI12420 [Drosophila mojavensis] gi|19391 | 0.584 | 0.220 | 0.532 | 8e-12 | |
| 225717970 | 294 | Negative elongation factor E [Caligus cl | 0.547 | 0.197 | 0.586 | 1e-11 |
| >gi|242025524|ref|XP_002433174.1| Negative elongation factor E, putative [Pediculus humanus corporis] gi|212518715|gb|EEB20436.1| Negative elongation factor E, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 82.4 bits (202), Expect = 3e-14, Method: Compositional matrix adjust.
Identities = 37/62 (59%), Positives = 49/62 (79%)
Query: 27 KVNGTHVQGVKLKVSLARRQLKVAPINDAASSTTWSAIACHQSLKGNHKDKRHQVIYDDD 86
+++G+ V GV+LKVSLARRQ V INDA+SS+TWS IA S KGNHKDKR ++Y++D
Sbjct: 211 EMDGSMVSGVQLKVSLARRQPVVEAINDASSSSTWSTIAASHSQKGNHKDKRDVIVYEED 270
Query: 87 IF 88
+F
Sbjct: 271 LF 272
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|321457448|gb|EFX68534.1| hypothetical protein DAPPUDRAFT_301427 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|91078286|ref|XP_971953.1| PREDICTED: similar to Negative elongation factor E CG5994-PA [Tribolium castaneum] gi|270003949|gb|EFA00397.1| hypothetical protein TcasGA2_TC003247 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|157133920|ref|XP_001663073.1| hypothetical protein AaeL_AAEL003077 [Aedes aegypti] gi|108881442|gb|EAT45667.1| AAEL003077-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|194865848|ref|XP_001971633.1| GG15071 [Drosophila erecta] gi|190653416|gb|EDV50659.1| GG15071 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|195326059|ref|XP_002029748.1| GM24927 [Drosophila sechellia] gi|194118691|gb|EDW40734.1| GM24927 [Drosophila sechellia] | Back alignment and taxonomy information |
|---|
| >gi|195491140|ref|XP_002093434.1| GE21294 [Drosophila yakuba] gi|194179535|gb|EDW93146.1| GE21294 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
| >gi|24661022|ref|NP_648241.1| negative elongation factor E [Drosophila melanogaster] gi|38372288|sp|P92204.1|NELFE_DROME RecName: Full=Negative elongation factor E gi|1749772|emb|CAA71123.1| ANON-66Da protein [Drosophila melanogaster] gi|1749776|emb|CAA71120.1| ANON-66Da protein [Drosophila melanogaster] gi|7295068|gb|AAF50394.1| negative elongation factor E [Drosophila melanogaster] gi|17945251|gb|AAL48683.1| RE14181p [Drosophila melanogaster] gi|220947970|gb|ACL86528.1| Nelf-E-PA [synthetic construct] gi|220957250|gb|ACL91168.1| Nelf-E-PA [synthetic construct] | Back alignment and taxonomy information |
|---|
| >gi|195125830|ref|XP_002007378.1| GI12420 [Drosophila mojavensis] gi|193918987|gb|EDW17854.1| GI12420 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
| >gi|225717970|gb|ACO14831.1| Negative elongation factor E [Caligus clemensi] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 106 | ||||||
| FB|FBgn0017430 | 280 | Nelf-E "Negative elongation fa | 0.566 | 0.214 | 0.533 | 1.6e-23 | |
| UNIPROTKB|Q95ZE9 | 281 | Nelf-E "Negative elongation fa | 0.566 | 0.213 | 0.533 | 1.8e-22 | |
| UNIPROTKB|K7GQ47 | 373 | RDBP "Uncharacterized protein" | 0.566 | 0.160 | 0.461 | 3.7e-10 | |
| UNIPROTKB|Q0V898 | 374 | RDBP "Negative elongation fact | 0.566 | 0.160 | 0.461 | 3.7e-10 | |
| UNIPROTKB|F1RQW5 | 378 | RDBP "Uncharacterized protein" | 0.566 | 0.158 | 0.461 | 3.8e-10 | |
| UNIPROTKB|B4DUN1 | 350 | NELFE "cDNA FLJ52247, highly s | 0.566 | 0.171 | 0.446 | 6.8e-10 | |
| UNIPROTKB|P18615 | 380 | NELFE "Negative elongation fac | 0.566 | 0.157 | 0.446 | 8.2e-10 | |
| UNIPROTKB|B4DYX9 | 387 | NELFE "cDNA FLJ56180, highly s | 0.566 | 0.155 | 0.446 | 8.5e-10 | |
| UNIPROTKB|F1LP40 | 344 | Rdbp "Protein Rdbp" [Rattus no | 0.537 | 0.165 | 0.451 | 3.8e-09 | |
| RGD|1303325 | 369 | Nelfe "negative elongation fac | 0.537 | 0.154 | 0.451 | 4.5e-09 |
| FB|FBgn0017430 Nelf-E "Negative elongation factor E" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 175 (66.7 bits), Expect = 1.6e-23, Sum P(2) = 1.6e-23
Identities = 32/60 (53%), Positives = 45/60 (75%)
Query: 27 KVNGTHVQGVKLKVSLARRQLKVAPINDAASSTTWSAIACHQSLKGNHKDKRHQVIYDDD 86
+++G +V G+ L+V LARRQ ++ PINDA+SS WS+IA +S KG+HKD R V YD+D
Sbjct: 218 EIHGKNVNGINLQVQLARRQPQIEPINDASSSAVWSSIAASKSQKGSHKDHREMVQYDED 277
|
|
| UNIPROTKB|Q95ZE9 Nelf-E "Negative elongation factor E" [Drosophila virilis (taxid:7244)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|K7GQ47 RDBP "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q0V898 RDBP "Negative elongation factor E" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RQW5 RDBP "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B4DUN1 NELFE "cDNA FLJ52247, highly similar to Negative elongation factor E" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P18615 NELFE "Negative elongation factor E" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B4DYX9 NELFE "cDNA FLJ56180, highly similar to Negative elongation factor E" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LP40 Rdbp "Protein Rdbp" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| RGD|1303325 Nelfe "negative elongation factor complex member E" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 106 | |||
| cd12305 | 75 | cd12305, RRM_NELFE, RNA recognition motif in negat | 0.002 |
| >gnl|CDD|240751 cd12305, RRM_NELFE, RNA recognition motif in negative elongation factor E (NELF-E) and similar proteins | Back alignment and domain information |
|---|
Score = 33.8 bits (78), Expect = 0.002
Identities = 14/17 (82%), Positives = 16/17 (94%)
Query: 29 NGTHVQGVKLKVSLARR 45
NGT VQGV+LKVSLAR+
Sbjct: 59 NGTTVQGVQLKVSLARK 75
|
This subfamily corresponds to the RRM of NELF-E, also termed RNA-binding protein RD. NELF-E is the RNA-binding subunit of cellular negative transcription elongation factor NELF (negative elongation factor) involved in transcriptional regulation of HIV-1 by binding to the stem of the viral transactivation-response element (TAR) RNA which is synthesized by cellular RNA polymerase II at the viral long terminal repeat. NELF is a heterotetrameric protein consisting of NELF A, B, C or the splice variant D, and E. NELF-E contains an RNA recognition motif (RRM), also termed RBD (RNA binding domain) or RNP (ribonucleoprotein domain). It plays a role in the control of HIV transcription by binding to TAR RNA. In addition, NELF-E is associated with the NELF-B subunit, probably via a leucine zipper motif. . Length = 75 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 106 | |||
| PF13893 | 56 | RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or | 90.99 | |
| PLN03134 | 144 | glycine-rich RNA-binding protein 4; Provisional | 88.05 | |
| PF03780 | 108 | Asp23: Asp23 family; InterPro: IPR005531 This entr | 81.68 | |
| KOG4207|consensus | 256 | 80.31 |
| >PF13893 RRM_5: RNA recognition motif | Back alignment and domain information |
|---|
Probab=90.99 E-value=0.29 Score=28.74 Aligned_cols=23 Identities=43% Similarity=0.515 Sum_probs=20.7
Q ss_pred HHHHHHHhcCceeeeeEEEeeee
Q psy15193 21 YQKLKRKVNGTHVQGVKLKVSLA 43 (106)
Q Consensus 21 ~qklk~emnGt~V~gIqLKVSiA 43 (106)
-++|++.|||..+.|-.|+|+.|
T Consensus 34 A~~a~~~l~~~~~~g~~l~V~~a 56 (56)
T PF13893_consen 34 AQKAIEQLNGRQFNGRPLKVSYA 56 (56)
T ss_dssp HHHHHHHHTTSEETTEEEEEEEE
T ss_pred HHHHHHHhCCCEECCcEEEEEEC
Confidence 36789999999999999999986
|
(a.k.a. RRM, RBD, or RNP domain); PDB: 2PE8_A 2PEH_A 2D9O_A 1A9N_D 2DIT_A 3S6E_A 2LQ5_A 1SJQ_A 2AD9_A 1X4D_A .... |
| >PLN03134 glycine-rich RNA-binding protein 4; Provisional | Back alignment and domain information |
|---|
| >PF03780 Asp23: Asp23 family; InterPro: IPR005531 This entry represents the alkaline shock protein 23 family | Back alignment and domain information |
|---|
| >KOG4207|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 106 | |||
| 3bs9_A | 87 | Nucleolysin TIA-1 isoform P40; RNA recognition mot | 95.58 | |
| 3md1_A | 83 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 95.36 | |
| 2bz2_A | 121 | Negative elongation factor E; NELF E, RNA recognit | 95.16 | |
| 2dgx_A | 96 | KIAA0430 protein; RRM domain, structural genomics, | 94.86 | |
| 1x5p_A | 97 | Negative elongation factor E; structure genomics, | 94.86 | |
| 1whw_A | 99 | Hypothetical protein riken cDNA 1200009A02; RNA re | 94.36 | |
| 3mdf_A | 85 | Peptidyl-prolyl CIS-trans isomerase E; RRM domain, | 94.04 | |
| 2err_A | 109 | Ataxin-2-binding protein 1; protein-RNA complex, R | 93.93 | |
| 2e5j_A | 97 | Methenyltetrahydrofolate synthetase domain contain | 93.81 | |
| 4fxv_A | 99 | ELAV-like protein 1; RNA recognition motif, putati | 93.65 | |
| 2x1f_A | 96 | MRNA 3'-END-processing protein RNA15; transcriptio | 93.62 | |
| 1x4g_A | 109 | Nucleolysin TIAR; structural genomics, RRM domain, | 93.57 | |
| 1wg1_A | 88 | KIAA1579 protein, homolog EXC-7; RBD, structural g | 93.52 | |
| 2lcw_A | 116 | RNA-binding protein FUS; RRM, nucleic acid binding | 92.61 | |
| 2dnp_A | 90 | RNA-binding protein 14; RRM domain, RBD, structura | 93.51 | |
| 2dgt_A | 92 | RNA-binding protein 30; RRM domain, structural gen | 93.48 | |
| 2cpd_A | 99 | Apobec-1 stimulating protein; RNA recognition moti | 93.41 | |
| 3md3_A | 166 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 93.34 | |
| 4a8x_A | 88 | RNA-binding protein with serine-rich domain 1; tra | 93.24 | |
| 1why_A | 97 | Hypothetical protein riken cDNA 1810017N16; RNA re | 93.23 | |
| 1nu4_A | 97 | U1A RNA binding domain; RNA recognition motif, U1 | 93.17 | |
| 1oo0_B | 110 | CG8781-PA, drosophila Y14; RNA recognition motif, | 93.05 | |
| 2do4_A | 100 | Squamous cell carcinoma antigen recognized by T- c | 93.05 | |
| 2jvr_A | 111 | Nucleolar protein 3; RNA recognition motif, nucleu | 93.05 | |
| 2cpi_A | 111 | CCR4-NOT transcription complex subunit 4; RNA reco | 93.04 | |
| 2cq3_A | 103 | RNA-binding protein 9; RRM domain, structural geno | 93.02 | |
| 2fc9_A | 101 | NCL protein; structure genomics, RRM_1 domain, str | 93.02 | |
| 2e5h_A | 94 | Zinc finger CCHC-type and RNA-binding motif- conta | 93.0 | |
| 2xnq_A | 97 | Nuclear polyadenylated RNA-binding protein 3; tran | 92.99 | |
| 2fc8_A | 102 | NCL protein; structure genomics, RRM_1 domain, str | 92.94 | |
| 1p27_B | 106 | RNA-binding protein 8A; nuclear protein, mRNA spli | 92.91 | |
| 2cqh_A | 93 | IGF-II mRNA-binding protein 2 isoform A; RNA recog | 92.83 | |
| 3s8s_A | 110 | Histone-lysine N-methyltransferase SETD1A; chromat | 92.71 | |
| 2cpe_A | 113 | RNA-binding protein EWS; RNA recognition motif, RR | 92.66 | |
| 2cqp_A | 98 | RNA-binding protein 12; RNA recognition motif, RRM | 92.61 | |
| 2cqb_A | 102 | Peptidyl-prolyl CIS-trans isomerase E; RNA recogni | 92.58 | |
| 2cq0_A | 103 | Eukaryotic translation initiation factor 3 subunit | 92.55 | |
| 2d9p_A | 103 | Polyadenylate-binding protein 3; RRM domain, struc | 92.42 | |
| 2fy1_A | 116 | RNA-binding motif protein, Y chromosome, family 1 | 92.39 | |
| 2hvz_A | 101 | Splicing factor, arginine/serine-rich 7; RRM, RNA | 92.38 | |
| 2cpz_A | 115 | CUG triplet repeat RNA-binding protein 1; RRM doma | 92.35 | |
| 2dnq_A | 90 | RNA-binding protein 4B; RRM domain,RBD, structural | 92.22 | |
| 2cpj_A | 99 | Non-POU domain-containing octamer-binding protein; | 92.21 | |
| 2dgo_A | 115 | Cytotoxic granule-associated RNA binding protein 1 | 92.18 | |
| 1x5t_A | 96 | Splicing factor 3B subunit 4; structure genomics, | 91.98 | |
| 2cqc_A | 95 | Arginine/serine-rich splicing factor 10; RNA recog | 91.93 | |
| 2dgu_A | 103 | Heterogeneous nuclear ribonucleoprotein Q; RRM dom | 91.89 | |
| 1x4c_A | 108 | Splicing factor, arginine/serine-rich 1; structura | 91.88 | |
| 2dgw_A | 91 | Probable RNA-binding protein 19; RRM domain, struc | 91.76 | |
| 2cph_A | 107 | RNA binding motif protein 19; RNA recognition moti | 91.71 | |
| 2dgv_A | 92 | HnRNP M, heterogeneous nuclear ribonucleoprotein M | 91.67 | |
| 2cqi_A | 103 | Nucleolysin TIAR; RNA recognition motif, RRM, RNA | 91.67 | |
| 2jvo_A | 108 | Nucleolar protein 3; nucleus, phosphorylation, rib | 91.64 | |
| 2cpf_A | 98 | RNA binding motif protein 19; RNA recognition moti | 91.62 | |
| 1fjc_A | 96 | Nucleolin RBD2, protein C23; RNP, RRM, RNA binding | 91.58 | |
| 2dnz_A | 95 | Probable RNA-binding protein 23; RNA recognition m | 91.56 | |
| 3p5t_L | 90 | Cleavage and polyadenylation specificity factor S; | 91.54 | |
| 1x4a_A | 109 | Splicing factor, arginine/serine-rich 1 (splicing | 91.53 | |
| 1x5s_A | 102 | Cold-inducible RNA-binding protein; structure geno | 91.47 | |
| 2dnm_A | 103 | SRP46 splicing factor; RRM domain, RBD, structural | 91.42 | |
| 1p1t_A | 104 | Cleavage stimulation factor, 64 kDa subunit; RNA r | 91.27 | |
| 1wf1_A | 110 | RNA-binding protein RALY; structural genomics, RRM | 91.21 | |
| 1fje_B | 175 | Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin | 91.16 | |
| 2khc_A | 118 | Testis-specific RNP-type RNA binding protein; RRM, | 91.15 | |
| 2kt5_A | 124 | RNA and export factor-binding protein 2; chaperone | 90.87 | |
| 2dnr_A | 91 | Synaptojanin-1; RRM domain, RBD, structural genomi | 90.87 | |
| 2la4_A | 101 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 90.86 | |
| 2do0_A | 114 | HnRNP M, heterogeneous nuclear ribonucleoprotein M | 90.84 | |
| 2cpx_A | 115 | Hypothetical protein FLJ11016; RRM domain, structu | 90.72 | |
| 2jrs_A | 108 | RNA-binding protein 39; RNA binding motif of RBM39 | 90.68 | |
| 1u6f_A | 139 | Tcubp1, RNA-binding protein UBP1; trypanosome, mRN | 90.62 | |
| 1whx_A | 111 | Hypothetical protein riken cDNA 1200009A02; RNA re | 90.55 | |
| 2la6_A | 99 | RNA-binding protein FUS; structural genomics, nort | 90.49 | |
| 4f25_A | 115 | Polyadenylate-binding protein 1; RRM fold, transla | 90.39 | |
| 3ex7_B | 126 | RNA-binding protein 8A; protein-RNA complex, mRNA | 90.39 | |
| 2ywk_A | 95 | Putative RNA-binding protein 11; RRM-domain, struc | 90.31 | |
| 1wex_A | 104 | Hypothetical protein (riken cDNA 2810036L13); stru | 90.24 | |
| 2cq2_A | 114 | Hypothetical protein LOC91801; RRM domain, structu | 90.2 | |
| 2ytc_A | 85 | PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s | 90.1 | |
| 2kvi_A | 96 | Nuclear polyadenylated RNA-binding protein 3; RNA- | 89.94 | |
| 3ulh_A | 107 | THO complex subunit 4; nuclear protein, RNA bindin | 89.88 | |
| 3egn_A | 143 | RNA-binding protein 40; RNA recognition motif (RRM | 89.5 | |
| 2ki2_A | 90 | SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA | 89.25 | |
| 2e44_A | 96 | Insulin-like growth factor 2 mRNA binding protein | 89.25 | |
| 2kn4_A | 158 | Immunoglobulin G-binding protein G, splicing FACT | 89.18 | |
| 3pgw_A | 282 | U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c | 89.1 | |
| 1rk8_A | 165 | CG8781-PA, CG8781-PA protein; mRNA processing, RRM | 89.07 | |
| 1x5u_A | 105 | Splicing factor 3B subunit 4 (spliceosome associat | 88.96 | |
| 1wi8_A | 104 | EIF-4B, eukaryotic translation initiation factor 4 | 88.69 | |
| 2dnh_A | 105 | Bruno-like 5, RNA binding protein; RRM domain, RBD | 88.46 | |
| 2div_A | 99 | TRNA selenocysteine associated protein; structural | 88.36 | |
| 2lea_A | 135 | Serine/arginine-rich splicing factor 2; SR protein | 88.01 | |
| 3zzy_A | 130 | Polypyrimidine tract-binding protein 1; protein bi | 87.91 | |
| 2a3j_A | 127 | U1 small nuclear ribonucleoprotein A; computationa | 87.85 | |
| 4f02_A | 213 | Polyadenylate-binding protein 1; mRNA, eukaryotic | 87.82 | |
| 2i2y_A | 150 | Fusion protein consists of immunoglobin G- binding | 87.77 | |
| 2kxn_B | 129 | Transformer-2 protein homolog beta; SR protein, RR | 87.16 | |
| 2yh0_A | 198 | Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli | 87.08 | |
| 2qfj_A | 216 | FBP-interacting repressor; protein-DNA complex; HE | 87.07 | |
| 2nlw_A | 105 | Eukaryotic translation initiation factor 3 subunit | 87.03 | |
| 3ns6_A | 100 | Eukaryotic translation initiation factor 3 subuni; | 87.01 | |
| 1fj7_A | 101 | Nucleolin RBD1, protein C23; RNP, RRM, RNA binding | 86.96 | |
| 2dng_A | 103 | Eukaryotic translation initiation factor 4H; RRM d | 86.79 | |
| 2e5i_A | 124 | Heterogeneous nuclear ribonucleoprotein L-like; RR | 86.75 | |
| 2dnn_A | 109 | RNA-binding protein 12; RRM domain, RBD, structura | 86.63 | |
| 2ghp_A | 292 | U4/U6 snRNA-associated splicing factor PRP24; RNA | 86.62 | |
| 1x4h_A | 111 | RNA-binding protein 28; structural genomics, RRM d | 86.56 | |
| 2ek1_A | 95 | RNA-binding protein 12; RNA recognition motif, dim | 86.52 | |
| 1h2v_Z | 156 | 20 kDa nuclear CAP binding protein; CAP-binding-co | 86.49 | |
| 2cq4_A | 114 | RNA binding motif protein 23; RRM domain, structur | 86.42 | |
| 2dgp_A | 106 | Bruno-like 4, RNA binding protein; RRM domain, str | 86.22 | |
| 3n9u_C | 156 | Cleavage and polyadenylation specificity factor S; | 86.17 | |
| 2lkz_A | 95 | RNA-binding protein 5; RRM; NMR {Homo sapiens} | 85.9 | |
| 1qm9_A | 198 | Polypyrimidine tract-binding protein; ribonucleopr | 85.79 | |
| 2jwn_A | 124 | Embryonic polyadenylate-binding protein 2-B; epabp | 85.58 | |
| 2j76_E | 100 | EIF-4B, EIF4B, eukaryotic translation initiation f | 85.34 | |
| 3ucg_A | 89 | Polyadenylate-binding protein 2; ferredoxin-like, | 85.27 | |
| 2dhg_A | 104 | TRNA selenocysteine associated protein (SECP43); R | 85.23 | |
| 3tyt_A | 205 | Heterogeneous nuclear ribonucleoprotein L; ferredo | 85.13 | |
| 1b7f_A | 168 | Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP | 85.1 | |
| 2lxi_A | 91 | RNA-binding protein 10; NMR {Homo sapiens} | 85.09 | |
| 2g4b_A | 172 | Splicing factor U2AF 65 kDa subunit; protein-RNA c | 84.97 | |
| 2dis_A | 109 | Unnamed protein product; structural genomics, RRM | 84.85 | |
| 3lqv_A | 115 | PRE-mRNA branch site protein P14; cysless mutant, | 84.58 | |
| 2wbr_A | 89 | GW182, gawky, LD47780P; DNA-binding protein, RRM, | 84.41 | |
| 2adc_A | 229 | Polypyrimidine tract-binding protein 1; RBD, RRM, | 84.29 | |
| 2dgs_A | 99 | DAZ-associated protein 1; RRM domain, structural g | 83.93 | |
| 2ku7_A | 140 | MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio | 83.93 | |
| 2dit_A | 112 | HIV TAT specific factor 1 variant; structural geno | 83.6 | |
| 1fxl_A | 167 | Paraneoplastic encephalomyelitis antigen HUD; prot | 83.51 | |
| 2diu_A | 96 | KIAA0430 protein; structural genomics, RRM domain, | 83.43 | |
| 2pe8_A | 105 | Splicing factor 45; RRM, protein binding; 2.00A {H | 83.39 | |
| 3q2s_C | 229 | Cleavage and polyadenylation specificity factor S; | 83.21 | |
| 3smz_A | 284 | Protein raver-1, ribonucleoprotein PTB-binding 1; | 82.48 | |
| 1x4d_A | 102 | Matrin 3; structural genomics, RRM domain, NPPSFA, | 81.52 | |
| 3pgw_S | 437 | U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM | 81.39 | |
| 1sjr_A | 164 | Polypyrimidine tract-binding protein 1; extended b | 80.89 | |
| 3pgw_A | 282 | U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c | 80.62 | |
| 1fxl_A | 167 | Paraneoplastic encephalomyelitis antigen HUD; prot | 80.35 |
| >3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
Probab=95.58 E-value=0.011 Score=35.43 Aligned_cols=28 Identities=14% Similarity=0.323 Sum_probs=22.8
Q ss_pred HHHHHHHHhcCceeeeeEEEeeeecccc
Q psy15193 20 KYQKLKRKVNGTHVQGVKLKVSLARRQL 47 (106)
Q Consensus 20 ~~qklk~emnGt~V~gIqLKVSiARRQP 47 (106)
.-++|++.|||..+.|-.|+|++|+.+|
T Consensus 60 ~A~~A~~~l~g~~~~g~~l~v~~a~~kp 87 (87)
T 3bs9_A 60 DAENAIQQMGGQWLGGRQIRTNWATRKP 87 (87)
T ss_dssp HHHHHHHHHTTCEETTEECEEEEEC---
T ss_pred HHHHHHHHcCCCEECCeEEEEEecCCCC
Confidence 3467899999999999999999999987
|
| >3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 | Back alignment and structure |
|---|
| >2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* | Back alignment and structure |
|---|
| >2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B | Back alignment and structure |
|---|
| >1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A | Back alignment and structure |
|---|
| >2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... | Back alignment and structure |
|---|
| >1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* | Back alignment and structure |
|---|
| >2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A | Back alignment and structure |
|---|
| >2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A | Back alignment and structure |
|---|
| >2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A | Back alignment and structure |
|---|
| >2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A | Back alignment and structure |
|---|
| >1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A | Back alignment and structure |
|---|
| >1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A | Back alignment and structure |
|---|
| >2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A | Back alignment and structure |
|---|
| >2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C | Back alignment and structure |
|---|
| >1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A | Back alignment and structure |
|---|
| >1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A | Back alignment and structure |
|---|
| >2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A | Back alignment and structure |
|---|
| >3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* | Back alignment and structure |
|---|
| >2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A | Back alignment and structure |
|---|
| >3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} | Back alignment and structure |
|---|
| >3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A | Back alignment and structure |
|---|
| >1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A | Back alignment and structure |
|---|
| >1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A | Back alignment and structure |
|---|
| >2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A | Back alignment and structure |
|---|
| >3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A | Back alignment and structure |
|---|
| >2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* | Back alignment and structure |
|---|
| >2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A | Back alignment and structure |
|---|
| >2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A | Back alignment and structure |
|---|
| >2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A | Back alignment and structure |
|---|
| >2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A | Back alignment and structure |
|---|
| >2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A | Back alignment and structure |
|---|
| >1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A | Back alignment and structure |
|---|
| >1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A | Back alignment and structure |
|---|
| >1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X | Back alignment and structure |
|---|
| >2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A | Back alignment and structure |
|---|
| >3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 | Back alignment and structure |
|---|
| >2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} | Back alignment and structure |
|---|
| >2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A | Back alignment and structure |
|---|
| >2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A | Back alignment and structure |
|---|
| >1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A | Back alignment and structure |
|---|
| >2lxi_A RNA-binding protein 10; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A | Back alignment and structure |
|---|
| >2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B | Back alignment and structure |
|---|
| >2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A | Back alignment and structure |
|---|
| >2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A | Back alignment and structure |
|---|
| >2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A | Back alignment and structure |
|---|
| >3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C | Back alignment and structure |
|---|
| >3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E | Back alignment and structure |
|---|
| >1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* | Back alignment and structure |
|---|
| >1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A | Back alignment and structure |
|---|
| >3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A | Back alignment and structure |
|---|
| >1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 106 | |||
| d2bz2a1 | 79 | Negative elongation factor E, NELF-E {Human (Homo | 97.4 | |
| d1x4ga1 | 96 | Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 | 95.91 | |
| d1wi6a1 | 75 | Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M | 95.89 | |
| d2cpea1 | 101 | RNA-binding protein EWS {Human (Homo sapiens) [Tax | 95.27 | |
| d1wg1a_ | 88 | Probable RNA-binding protein KIAA1579 {Human (Homo | 94.7 | |
| d2ghpa1 | 81 | U4/U6 snRNA-associated-splicing factor PRP24 {Bake | 94.09 | |
| d2cqpa1 | 86 | RNA-binding protein 12 {Mouse (Mus musculus) [TaxI | 93.96 | |
| d1weya_ | 104 | Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 | 93.95 | |
| d1x4aa1 | 95 | Splicing factor, arginine/serine-rich 1, SFRS1 {Hu | 93.42 | |
| d2cpfa1 | 85 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 93.38 | |
| d2ghpa3 | 86 | U4/U6 snRNA-associated-splicing factor PRP24 {Bake | 93.25 | |
| d1b7fa1 | 82 | Sex-lethal protein {Drosophila melanogaster [TaxId | 93.07 | |
| d1wf2a_ | 98 | Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu | 92.83 | |
| d2cpda1 | 86 | APOBEC1 stimulating protein {Human (Homo sapiens) | 92.78 | |
| d1fxla1 | 82 | Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 | 92.72 | |
| d2cpza1 | 102 | CUG triplet repeat RNA-binding protein 1 {Human (H | 92.68 | |
| d2cq3a1 | 93 | RNA-binding protein 9 {Human (Homo sapiens) [TaxId | 92.54 | |
| d1no8a_ | 78 | Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 | 92.31 | |
| d1whya_ | 97 | Putative RNA-binding protein 15B, Rbm15b {Mouse (M | 92.18 | |
| d2cpja1 | 86 | Non-POU domain-containing octamer-binding protein, | 92.08 | |
| d1wg4a_ | 98 | Splicing factor, arginine/serine-rich 9 (SFRS9) {M | 92.05 | |
| d2cqia1 | 90 | Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 | 91.92 | |
| d1cvja2 | 89 | Poly(A)-binding protein {Human (Homo sapiens) [Tax | 91.56 | |
| d1nu4a_ | 91 | Splicesomal U1A protein {Human (Homo sapiens) [Tax | 90.78 | |
| d1whwa_ | 99 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 90.73 | |
| d2cq0a1 | 90 | Eukaryotic translation initiation factor 3 subunit | 90.71 | |
| d2adca2 | 88 | Polypyrimidine tract-binding protein {Human (Homo | 90.28 | |
| d2adca1 | 109 | Polypyrimidine tract-binding protein {Human (Homo | 90.2 | |
| d2cpxa1 | 102 | RNA-binding protein 41, RBM41 {Human (Homo sapiens | 90.15 | |
| d3begb1 | 87 | Splicing factor, arginine/serine-rich 1, SFRS1 {Hu | 90.0 | |
| d1cvja1 | 80 | Poly(A)-binding protein {Human (Homo sapiens) [Tax | 89.75 | |
| d1whxa_ | 111 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 89.58 | |
| d1x5ta1 | 83 | Splicing factor 3B subunit 4 {Human (Homo sapiens) | 89.23 | |
| d1h2vz_ | 93 | CBP20, 20KDa nuclear cap-binding protein {Human (H | 88.97 | |
| d1p1ta_ | 104 | Cleavage stimulation factor, 64 kda subunit {Human | 88.64 | |
| d1x5sa1 | 90 | Cold-inducible RNA-binding protein {Human (Homo sa | 88.57 | |
| d2cqba1 | 89 | Peptidyl-prolyl cis-trans isomerase E, N-terminal | 88.08 | |
| d1x5ua1 | 93 | Splicing factor 3B subunit 4 {Human (Homo sapiens) | 87.95 | |
| d1fjca_ | 96 | Nucleolin {Golden hamster (Mesocricetus auratus) [ | 87.9 | |
| d1rk8a_ | 88 | RNA-binding protein 8 {Fruit fly (Drosophila melan | 87.78 | |
| d2b0ga1 | 83 | Splicesomal U1A protein {Drosophila melanogaster [ | 87.45 | |
| d2cqha1 | 80 | IGF-II mRNA-binding protein 2 isoform A {Human (Ho | 86.41 | |
| d2cpha1 | 94 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 85.93 | |
| d1fjeb1 | 91 | Nucleolin {Golden hamster (Mesocricetus auratus) [ | 85.74 | |
| d1fxla2 | 85 | Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 | 85.45 | |
| d1u6fa1 | 139 | RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId | 85.28 | |
| d2adba1 | 108 | Polypyrimidine tract-binding protein {Human (Homo | 84.13 | |
| d2u2fa_ | 85 | Splicing factor U2AF 65 KDa subunit {Human (Homo s | 83.93 | |
| d2f9da1 | 114 | Pre-mRNA branch site protein p14 {Human (Homo sapi | 83.51 | |
| d2cpia1 | 89 | E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc | 83.43 |
| >d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: RNA-binding domain, RBD family: Canonical RBD domain: Negative elongation factor E, NELF-E species: Human (Homo sapiens) [TaxId: 9606]
Probab=97.40 E-value=4.5e-05 Score=46.14 Aligned_cols=28 Identities=39% Similarity=0.564 Sum_probs=26.2
Q ss_pred HHHHHHHhcCceeeeeEEEeeeeccccc
Q psy15193 21 YQKLKRKVNGTHVQGVKLKVSLARRQLK 48 (106)
Q Consensus 21 ~qklk~emnGt~V~gIqLKVSiARRQP~ 48 (106)
-++|+++|||..+.|-.|+|++||++|+
T Consensus 52 A~~Ai~~lng~~~~g~~l~V~~a~~~P~ 79 (79)
T d2bz2a1 52 ADQAVAELNGTQVESVQLKVNIARKQPM 79 (79)
T ss_dssp HHHHHHHHTTCBCSSCBCEEEECCSSCC
T ss_pred HHHHHHHhCCCEECCEEEEEEEecCCCC
Confidence 4688999999999999999999999996
|
| >d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} | Back information, alignment and structure |
|---|
| >d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} | Back information, alignment and structure |
|---|
| >d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|