Psyllid ID: psy15268


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250------
MLDDTAPENVLEVTARAMTYYLDVSAECTRRIVAIDGAMKAICSRLSLGAGIASRTSKDLAEQCIKVLELICTREAGSVFEAGGLASVLLFIKQHGHSVHKDTLHSAMAVVSRLCSKMEPQDPQLPEAVEALSLLLRHEDTHISDAALRCFASLSDRFTRRGVDPAPLAQHGLASELLIRLSNAAGSNPLNTSLGGANVSTASASGTLATEAKASSGSVSTIVSLLSALCRGSPSITSDLLHSDLPDAIGCPRIYA
cccccccHHHHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccHHHHHcccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccHHHHHHcHHHHHHHHHHcccccccccccccccccccccccccccHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHcccccccccccccc
cccccccHHHHHHHHHHHHHHHHHcHHHcHHEEccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccHHHHHccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHcccHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHcccccEcc
MLDDTAPENVLEVTARAMTYYLDVSAECTRRIVAIDGAMKAICSRLSlgagiasrtSKDLAEQCIKVLELICTReagsvfeaGGLASVLLFIKQHGHSVHKDTLHSAMAVVSRLcskmepqdpqlPEAVEALSLLLRHEDTHISDAALRCFASLSdrftrrgvdpaplaqhgLASELLIRLSnaagsnplntslgganvstasasgtlateakassgsVSTIVSLLSALcrgspsitsdllhsdlpdaigcpriya
MLDDTAPENVLEVTARAMTYYLDVSAECTRRIVAIDGAMKAICSRLSLGAGIASRTSKDLAEQCIKVLELICTREAGSVFEAGGLASVLLFIKQHGHSVHKDTLHSAMAVVSRLCSKMEPQDPQLPEAVEALSLLLRHEDTHISDAALRCFASLSDRFTRRGVDPAPLAQHGLASELLIRLSNAAGSNPLNTSLGGANVSTASASGTLAteakassgsVSTIVSLLSALCRGSpsitsdllhsdlpdaigcpriya
MLDDTAPENVLEVTARAMTYYLDVSAECTRRIVAIDGAMKAICSRLSLGAGIASRTSKDLAEQCIKVLELICTREAGSVFEAGGLASVLLFIKQHGHSVHKDTLHSAMAVVSRLCSKMEPQDPQLPEAVEALSLLLRHEDTHISDAALRCFASLSDRFTRRGVDPAPLAQHGLASELLIRLSNAAGSNPLNTSLGGANVSTASASGTLATEAKASSGSVSTIVSLLSALCRGSPSITSDLLHSDLPDAIGCPRIYA
*********VLEVTARAMTYYLDVSAECTRRIVAIDGAMKAICSRLSLGAGIASRTSKDLAEQCIKVLELICTREAGSVFEAGGLASVLLFIKQHGHSVHKDTLHSAMAVVSRLC*************VEALSLLLRHEDTHISDAALRCFASLSDRFTRRGVDPAPLAQHGLASELLIRL***************************************TIVSLLSALCRGSPSITSDLLHS*L**AIGC*****
M****APENVLEVTARAMTYYLDVSAECTRRIVAIDGAMKAICSRLSLGAGIASRTSKDLAEQCIKVLELICTREAGSVFEAGGLASVLLFIKQHGHSVHKDTLHSAMAVVSRLCSKMEPQDPQLPEAVEALSLLLRHEDTHISDAALRCFASLSDRFTRRGVDPAPLAQHGLASELLIRLSN******************A***GTLATEAKASSGSVSTIVSLLSALCRGSPSITSDLLHSDLPDAIGCPRI**
MLDDTAPENVLEVTARAMTYYLDVSAECTRRIVAIDGAMKAICSRLSLGAGIASRTSKDLAEQCIKVLELICTREAGSVFEAGGLASVLLFIKQHGHSVHKDTLHSAMAVVSRLCSKMEPQDPQLPEAVEALSLLLRHEDTHISDAALRCFASLSDRFTRRGVDPAPLAQHGLASELLIRLSNAAGSNPLNTSLGGANVS********************TIVSLLSALCRGSPSITSDLLHSDLPDAIGCPRIYA
***DTAPENVLEVTARAMTYYLDVSAECTRRIVAIDGAMKAICSRLSLGAGIASRTSKDLAEQCIKVLELICTREAGSVFEAGGLASVLLFIKQHGHSVHKDTLHSAMAVVSRLCSKMEPQDPQLPEAVEALSLLLRHEDTHISDAALRCFASLSDRFTRRGVDPAPLAQHGLASELLIRLSNAAG****************************SSGSVSTIVSLLSALCRGSPSITSDLLHSDLPDAIGCPRIYA
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLDDTAPENVLEVTARAMTYYLDVSAECTRRIVAIDGAMKAICSRLSLGAGIASRTSKDLAEQCIKVLELICTREAGSVFEAGGLASVLLFIKQHGHSVHKDTLHSAMAVVSRLCSKMEPQDPQLPEAVEALSLLLRHEDTHISDAALRCFASLSDRFTRRGVDPAPLAQHGLASELLIRLSNAAGSNPLNTSLGGANVSTASASGTLATEAKASSGSVSTIVSLLSALCRGSPSITSDLLHSDLPDAIGCPRIYA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query256 2.2.26 [Sep-21-2011]
Q9ULT8 2610 E3 ubiquitin-protein liga yes N/A 0.960 0.094 0.670 1e-87
Q69ZR2 2618 E3 ubiquitin-protein liga yes N/A 0.953 0.093 0.661 4e-87
Q9LYZ7 1502 E3 ubiquitin-protein liga yes N/A 0.613 0.104 0.272 3e-08
F1RCR6 2026 E3 ubiquitin-protein liga no N/A 0.535 0.067 0.245 3e-06
G5E870 2025 E3 ubiquitin-protein liga no N/A 0.789 0.099 0.210 6e-06
E1B7Q7 1992 E3 ubiquitin-protein liga no N/A 0.789 0.101 0.210 7e-06
B4F6W9 2056 E3 ubiquitin-protein liga no N/A 0.535 0.066 0.245 7e-06
F1LP64 2025 E3 ubiquitin-protein liga no N/A 0.789 0.099 0.210 7e-06
Q14669 1992 E3 ubiquitin-protein liga no N/A 0.789 0.101 0.210 7e-06
Q6WWW4 1888 E3 ubiquitin-protein liga no N/A 0.777 0.105 0.247 1e-05
>sp|Q9ULT8|HECD1_HUMAN E3 ubiquitin-protein ligase HECTD1 OS=Homo sapiens GN=HECTD1 PE=1 SV=3 Back     alignment and function desciption
 Score =  322 bits (826), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 167/249 (67%), Positives = 198/249 (79%), Gaps = 3/249 (1%)

Query: 1   MLDDTAPENVLEVTARAMTYYLDVSAECTRRIVAIDGAMKAICSRLSLGAGIASRTSKDL 60
            LD++AP+NVLEVTARA+TYYLDVSAECTRRIV +DGA+KA+C+RL +   + +RTS+DL
Sbjct: 61  FLDESAPDNVLEVTARAITYYLDVSAECTRRIVGVDGAIKALCNRLVV-VELNNRTSRDL 119

Query: 61  AEQCIKVLELICTREAGSVFEAGGLASVLLFIKQHGHSVHKDTLHSAMAVVSRLCSKMEP 120
           AEQC+KVLELICTRE+G+VFEAGGL  VL FI+  GH VHKDTLHSAMAVVSRLC KMEP
Sbjct: 120 AEQCVKVLELICTRESGAVFEAGGLNCVLTFIRDSGHLVHKDTLHSAMAVVSRLCGKMEP 179

Query: 121 QDPQLPEAVEALSLLLRHEDTHISDAALRCFASLSDRFTRRGVDPAPLAQHGLASELLIR 180
           QD  L   VE+LS LL+HED  +SD ALRCFASL+DRFTRRGVDPAPLA+HGL  ELL R
Sbjct: 180 QDSSLEICVESLSSLLKHEDHQVSDGALRCFASLADRFTRRGVDPAPLAKHGLTEELLSR 239

Query: 181 LSNAAGSNPLNTSLGGANVSTASASGTLATEAKASSGSVSTIVSLLSALCRGSPSITSDL 240
           ++ A G+    +S      ST  A  T A ++K S+  VSTIVSLLS LCRGSP +T DL
Sbjct: 240 MAAAGGTVSGPSSACKPGRSTTGAPSTTA-DSKLSN-QVSTIVSLLSTLCRGSPVVTHDL 297

Query: 241 LHSDLPDAI 249
           L S+LPD+I
Sbjct: 298 LRSELPDSI 306




Probable E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. May be required for development of the head mesenchyme and neural tube closure.
Homo sapiens (taxid: 9606)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q69ZR2|HECD1_MOUSE E3 ubiquitin-protein ligase HECTD1 OS=Mus musculus GN=Hectd1 PE=1 SV=2 Back     alignment and function description
>sp|Q9LYZ7|UPL4_ARATH E3 ubiquitin-protein ligase UPL4 OS=Arabidopsis thaliana GN=UPL4 PE=1 SV=1 Back     alignment and function description
>sp|F1RCR6|TRIPC_DANRE E3 ubiquitin-protein ligase TRIP12 OS=Danio rerio GN=trip12 PE=2 SV=1 Back     alignment and function description
>sp|G5E870|TRIPC_MOUSE E3 ubiquitin-protein ligase TRIP12 OS=Mus musculus GN=Trip12 PE=1 SV=1 Back     alignment and function description
>sp|E1B7Q7|TRIPC_BOVIN E3 ubiquitin-protein ligase TRIP12 OS=Bos taurus GN=TRIP12 PE=2 SV=2 Back     alignment and function description
>sp|B4F6W9|TRIPC_XENTR E3 ubiquitin-protein ligase TRIP12 OS=Xenopus tropicalis GN=trip12 PE=2 SV=1 Back     alignment and function description
>sp|F1LP64|TRIPC_RAT E3 ubiquitin-protein ligase TRIP12 OS=Rattus norvegicus GN=Trip12 PE=2 SV=1 Back     alignment and function description
>sp|Q14669|TRIPC_HUMAN E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens GN=TRIP12 PE=1 SV=1 Back     alignment and function description
>sp|Q6WWW4|UPL3_ARATH E3 ubiquitin-protein ligase UPL3 OS=Arabidopsis thaliana GN=UPL3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query256
189236840 2609 PREDICTED: similar to hect E3 ubiquitin 0.957 0.093 0.711 2e-96
270005044 2552 hypothetical protein TcasGA2_TC007046 [T 0.957 0.096 0.711 2e-96
242008012 2686 hect E3 ubiquitin ligase, putative [Pedi 0.937 0.089 0.723 3e-94
242026118266 conserved hypothetical protein [Pediculu 0.937 0.902 0.723 2e-93
307166390 2551 E3 ubiquitin-protein ligase HECTD1 [Camp 0.960 0.096 0.691 4e-91
307197829 2600 E3 ubiquitin-protein ligase HECTD1 [Harp 0.960 0.094 0.691 4e-90
345495040 2621 PREDICTED: E3 ubiquitin-protein ligase H 0.964 0.094 0.691 8e-90
345495044 2608 PREDICTED: E3 ubiquitin-protein ligase H 0.964 0.094 0.691 8e-90
345495042 2506 PREDICTED: E3 ubiquitin-protein ligase H 0.964 0.098 0.691 8e-90
350419570 2495 PREDICTED: E3 ubiquitin-protein ligase H 0.968 0.099 0.669 4e-89
>gi|189236840|ref|XP_001813187.1| PREDICTED: similar to hect E3 ubiquitin ligase [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  358 bits (918), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 180/253 (71%), Positives = 216/253 (85%), Gaps = 8/253 (3%)

Query: 1   MLDDTAPENVLEVTARAMTYYLDVSAECTRRIVAIDGAMKAICSRLSLGAGIASRTSKDL 60
            LD+ APENVLEVTARA+TYYLDVSAECTRRIVAI+GA++AIC+RL + A ++SRTSKDL
Sbjct: 64  FLDEQAPENVLEVTARAITYYLDVSAECTRRIVAIEGAVRAICNRLVV-AELSSRTSKDL 122

Query: 61  AEQCIKVLELICTREAGSVFEAGGLASVLLFIKQHGHSVHKDTLHSAMAVVSRLCSKMEP 120
           AEQC+KVLELICTREAG+VF+AGGL+++L FI+ +G+ VHKDTLHSAMAVVSRLC+KMEP
Sbjct: 123 AEQCVKVLELICTREAGAVFDAGGLSAILPFIRDNGNRVHKDTLHSAMAVVSRLCTKMEP 182

Query: 121 QDPQLPEAVEALSLLLRHEDTHISDAALRCFASLSDRFTRRGVDPAPLAQHGLASELLIR 180
            D QLP  V+ALS LLRHED+H++D ALRCFAS++DRFTRRGVDPAPLAQHGL +ELL R
Sbjct: 183 ADVQLPTCVQALSTLLRHEDSHVADGALRCFASVADRFTRRGVDPAPLAQHGLVNELLSR 242

Query: 181 LSNAAGSNPLNTSLGGANVSTASASGTLAT----EAKASSGSVSTIVSLLSALCRGSPSI 236
           LSNAAG    + + G  N S  ++S T AT    +AKA++ SVSTI+SLLS LCRGSP+I
Sbjct: 243 LSNAAGP---SVATGTQNTSGKASSTTNATAAVPDAKATAASVSTIISLLSTLCRGSPAI 299

Query: 237 TSDLLHSDLPDAI 249
           T DLL S+LPDAI
Sbjct: 300 THDLLRSELPDAI 312




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270005044|gb|EFA01492.1| hypothetical protein TcasGA2_TC007046 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242008012|ref|XP_002424807.1| hect E3 ubiquitin ligase, putative [Pediculus humanus corporis] gi|212508345|gb|EEB12069.1| hect E3 ubiquitin ligase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|242026118|ref|XP_002433268.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212518890|gb|EEB20530.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|307166390|gb|EFN60527.1| E3 ubiquitin-protein ligase HECTD1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307197829|gb|EFN78940.1| E3 ubiquitin-protein ligase HECTD1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|345495040|ref|XP_003427422.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|345495044|ref|XP_001605880.2| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|345495042|ref|XP_003427423.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|350419570|ref|XP_003492229.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query256
UNIPROTKB|G3V4V5 926 HECTD1 "E3 ubiquitin-protein l 0.949 0.262 0.676 4.1e-81
ZFIN|ZDB-GENE-030616-153 2576 hectd1 "HECT domain containing 0.949 0.094 0.676 4.1e-80
UNIPROTKB|F1SHF6 2607 HECTD1 "Uncharacterized protei 0.949 0.093 0.676 1.4e-79
UNIPROTKB|E1BLD1 2610 HECTD1 "Uncharacterized protei 0.957 0.093 0.673 1.8e-79
UNIPROTKB|Q9ULT8 2610 HECTD1 "E3 ubiquitin-protein l 0.949 0.093 0.676 1.8e-79
UNIPROTKB|E1C1E6 2576 HECTD1 "Uncharacterized protei 0.949 0.094 0.664 3.8e-79
UNIPROTKB|E1C040 2610 HECTD1 "Uncharacterized protei 0.949 0.093 0.664 3.8e-79
RGD|1561653 2610 Hectd1 "HECT domain containing 0.949 0.093 0.664 4.9e-79
MGI|MGI:2384768 2618 Hectd1 "HECT domain containing 0.949 0.092 0.664 4.9e-79
UNIPROTKB|E2RGH9 2609 HECTD1 "Uncharacterized protei 0.945 0.092 0.664 4e-77
UNIPROTKB|G3V4V5 HECTD1 "E3 ubiquitin-protein ligase HECTD1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 814 (291.6 bits), Expect = 4.1e-81, P = 4.1e-81
 Identities = 169/250 (67%), Positives = 199/250 (79%)

Query:     2 LDDTAPENVLEVTARAMTYYLDVSAECTRRIVAIDGAMKAICSRLSLGAGIASRTSKDLA 61
             LD++AP+NVLEVTARA+TYYLDVSAECTRRIV +DGA+KA+C+RL +   + +RTS+DLA
Sbjct:    62 LDESAPDNVLEVTARAITYYLDVSAECTRRIVGVDGAIKALCNRLVV-VELNNRTSRDLA 120

Query:    62 EQCIKVLELICTREAGSVFEAGGLASVLLFIKQHGHSVHKDTLHSAMAVVSRLCSKMEPQ 121
             EQC+KVLELICTRE+G+VFEAGGL  VL FI+  GH VHKDTLHSAMAVVSRLC KMEPQ
Sbjct:   121 EQCVKVLELICTRESGAVFEAGGLNCVLTFIRDSGHLVHKDTLHSAMAVVSRLCGKMEPQ 180

Query:   122 DPQLPEAVEALSLLLRHEDTHISDAALRCFASLSDRFTRRGVDPAPLAQHGLASELLIRL 181
             D  L   VE+LS LL+HED  +SD ALRCFASL+DRFTRRGVDPAPLA+HGL  ELL R+
Sbjct:   181 DSSLEICVESLSSLLKHEDHQVSDGALRCFASLADRFTRRGVDPAPLAKHGLTEELLSRM 240

Query:   182 SNAAG--SNPLNTSLGGANVSTASASGTLATEAKASSGSVSTIVSLLSALCRGSPSITSD 239
             + A G  S P +    G   ST  A  T A ++K S+  VSTIVSLLS LCRGSP +T D
Sbjct:   241 AAAGGTVSGPSSACKPGR--STTGAPSTTA-DSKLSN-QVSTIVSLLSTLCRGSPVVTHD 296

Query:   240 LLHSDLPDAI 249
             LL S+LPD+I
Sbjct:   297 LLRSELPDSI 306




GO:0001843 "neural tube closure" evidence=IEA
ZFIN|ZDB-GENE-030616-153 hectd1 "HECT domain containing 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1SHF6 HECTD1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1BLD1 HECTD1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9ULT8 HECTD1 "E3 ubiquitin-protein ligase HECTD1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1C1E6 HECTD1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1C040 HECTD1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1561653 Hectd1 "HECT domain containing E3 ubiquitin protein ligase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:2384768 Hectd1 "HECT domain containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2RGH9 HECTD1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9ULT8HECD1_HUMAN6, ., 3, ., 2, ., -0.67060.96090.0942yesN/A
Q69ZR2HECD1_MOUSE6, ., 3, ., 2, ., -0.66130.95310.0932yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 256
KOG0168|consensus 1051 100.0
COG5064 526 SRP1 Karyopherin (importin) alpha [Intracellular t 100.0
KOG0166|consensus 514 100.0
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 99.79
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 99.75
KOG0166|consensus514 99.55
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 99.39
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 99.2
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 99.14
KOG4224|consensus 550 98.63
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 98.53
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 98.5
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 98.43
PF05804 708 KAP: Kinesin-associated protein (KAP) 98.35
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 98.13
PF05804 708 KAP: Kinesin-associated protein (KAP) 98.11
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 98.1
KOG4224|consensus550 98.04
KOG1048|consensus717 97.91
KOG4199|consensus461 97.68
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 97.14
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 97.11
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 97.07
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 96.94
KOG4500|consensus 604 96.62
PRK09687280 putative lyase; Provisional 96.5
KOG1048|consensus 717 96.48
PRK09687280 putative lyase; Provisional 96.43
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 96.4
KOG4199|consensus461 96.23
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 96.02
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 95.84
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 95.82
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 95.59
KOG2023|consensus 885 95.45
KOG2160|consensus342 95.21
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 95.02
PF13764 802 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 94.79
KOG2160|consensus342 94.71
PTZ00429 746 beta-adaptin; Provisional 94.7
KOG0168|consensus 1051 94.37
KOG2171|consensus 1075 94.09
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 93.81
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 93.68
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 93.54
KOG1241|consensus 859 93.28
KOG1293|consensus 678 92.47
PF05536 543 Neurochondrin: Neurochondrin 92.39
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 92.26
KOG2122|consensus 2195 91.41
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 91.39
KOG2023|consensus 885 89.16
PF05004309 IFRD: Interferon-related developmental regulator ( 88.98
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 88.97
KOG2274|consensus 1005 88.75
PF10165 446 Ric8: Guanine nucleotide exchange factor synembryn 88.74
KOG2171|consensus 1075 88.11
PTZ00429 746 beta-adaptin; Provisional 87.86
PF06025 379 DUF913: Domain of Unknown Function (DUF913); Inter 87.36
PF05536 543 Neurochondrin: Neurochondrin 87.3
KOG0946|consensus 970 86.92
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 86.7
PF1036392 DUF2435: Protein of unknown function (DUF2435) 86.17
KOG2274|consensus 1005 84.15
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 83.92
KOG1242|consensus569 83.85
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 83.73
PF10165 446 Ric8: Guanine nucleotide exchange factor synembryn 82.87
KOG2122|consensus 2195 82.75
KOG1060|consensus 968 82.06
KOG1059|consensus 877 81.09
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 81.08
KOG1062|consensus 866 80.43
>KOG0168|consensus Back     alignment and domain information
Probab=100.00  E-value=3.7e-51  Score=406.81  Aligned_cols=215  Identities=24%  Similarity=0.366  Sum_probs=206.4

Q ss_pred             CCCCchhHHHHHHHHHHHHhccCchhhhHHHHhCCcHHHHHHHhhcccCCCCCCcHHHHHHHHHHHHHHhccccchhhhc
Q psy15268          3 DDTAPENVLEVTARAMTYYLDVSAECTRRIVAIDGAMKAICSRLSLGAGIASRTSKDLAEQCIKVLELICTREAGSVFEA   82 (256)
Q Consensus         3 ~~~~p~~~l~~AaraLTni~~~~p~~t~~ivv~~gAVp~L~~~L~~~i~~~~~~~~DlaEQal~aLe~Is~d~~~~Vl~~   82 (256)
                      .|||+|+|+ .|||||||++|+.|++. .+||++||||+|++||. +|+     |+|||||+++|||+||++||.+||++
T Consensus       222 ~E~n~DIMl-~AcRaltyl~evlP~S~-a~vV~~~aIPvl~~kL~-~Ie-----yiDvAEQ~LqALE~iSR~H~~AiL~A  293 (1051)
T KOG0168|consen  222 HEHNFDIML-LACRALTYLCEVLPRSS-AIVVDEHAIPVLLEKLL-TIE-----YIDVAEQSLQALEKISRRHPKAILQA  293 (1051)
T ss_pred             ccccHHHHH-HHHHHHHHHHhhccchh-heeecccchHHHHHhhh-hhh-----hhHHHHHHHHHHHHHHhhccHHHHhc
Confidence            489999999 99999999999999999 56889999999999999 888     99999999999999999999999999


Q ss_pred             CcHHHHHHhhcccCcccchhhhhHHHHHHHHhcCCCCCCCC-ChHHHHHHHHHhhcCCCHHHHHHHHHHHHHhhhhccCC
Q psy15268         83 GGLASVLLFIKQHGHSVHKDTLHSAMAVVSRLCSKMEPQDP-QLPEAVEALSLLLRHEDTHISDAALRCFASLSDRFTRR  161 (256)
Q Consensus        83 G~l~alL~~ldff~~~~qr~~l~~a~~~vsNlCr~~~~~~~-~v~~~lP~L~~lL~~~D~~vv~~ac~als~L~d~~~~~  161 (256)
                      |++++||+|+|||++++||    +|+.|++|||.++++.+| +|.+++|.|+++|+|+|++++|.+|.||.|++|+|.+.
T Consensus       294 G~l~a~LsylDFFSi~aQR----~AlaiaaN~Cksi~sd~f~~v~ealPlL~~lLs~~D~k~ies~~ic~~ri~d~f~h~  369 (1051)
T KOG0168|consen  294 GALSAVLSYLDFFSIHAQR----VALAIAANCCKSIRSDEFHFVMEALPLLTPLLSYQDKKPIESVCICLTRIADGFQHG  369 (1051)
T ss_pred             ccHHHHHHHHHHHHHHHHH----HHHHHHHHHHhcCCCccchHHHHHHHHHHHHHhhccchhHHHHHHHHHHHHHhcccC
Confidence            9999999999999999999    999999999999999888 99999999999999999999999999999999999999


Q ss_pred             CCCccchhccccHHHHHHHhcccCCCCCCcCCCCCCCccccccCCccccccccCcchHHHHHHHHHHHhcCCHHHHHHHH
Q psy15268        162 GVDPAPLAQHGLASELLIRLSNAAGSNPLNTSLGGANVSTASASGTLATEAKASSGSVSTIVSLLSALCRGSPSITSDLL  241 (256)
Q Consensus       162 ~~~i~~l~~~glv~~Lv~LL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~l~~Ls~l~~~S~~it~~Ll  241 (256)
                      ++++|.|+.+|++++.++||...                          |+.++..+++.+||||+.||++||...+.|+
T Consensus       370 ~~kLdql~s~dLi~~~~qLlsvt--------------------------~t~Ls~~~~~~vIrmls~msS~~pl~~~tl~  423 (1051)
T KOG0168|consen  370 PDKLDQLCSHDLITNIQQLLSVT--------------------------PTILSNGTYTGVIRMLSLMSSGSPLLFRTLL  423 (1051)
T ss_pred             hHHHHHHhchhHHHHHHHHHhcC--------------------------cccccccchhHHHHHHHHHccCChHHHHHHH
Confidence            99999999999999999999742                          2568889999999999999999999999999


Q ss_pred             hcChHHHHhhhhcc
Q psy15268        242 HSDLPDAIGCPRIY  255 (256)
Q Consensus       242 ~~~l~~~l~~~~~~  255 (256)
                      +.+|.+++.++|.+
T Consensus       424 k~~I~~~L~~il~g  437 (1051)
T KOG0168|consen  424 KLDIADTLKRILQG  437 (1051)
T ss_pred             HhhHHHHHHHHHhc
Confidence            99999999999864



>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0166|consensus Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>KOG0166|consensus Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG4224|consensus Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>KOG4224|consensus Back     alignment and domain information
>KOG1048|consensus Back     alignment and domain information
>KOG4199|consensus Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG4500|consensus Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG1048|consensus Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4199|consensus Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG2023|consensus Back     alignment and domain information
>KOG2160|consensus Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PF13764 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 Back     alignment and domain information
>KOG2160|consensus Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>KOG0168|consensus Back     alignment and domain information
>KOG2171|consensus Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>KOG1241|consensus Back     alignment and domain information
>KOG1293|consensus Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>KOG2122|consensus Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>KOG2023|consensus Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>KOG2274|consensus Back     alignment and domain information
>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [] Back     alignment and domain information
>KOG2171|consensus Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>PF06025 DUF913: Domain of Unknown Function (DUF913); InterPro: IPR010314 This is a domain of unknown function found towards the N terminus of a family of E3 ubiquitin protein ligases, including yeast TOM1, many of which appear to play a role in mRNA transcription and processing Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>KOG0946|consensus Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PF10363 DUF2435: Protein of unknown function (DUF2435) Back     alignment and domain information
>KOG2274|consensus Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>KOG1242|consensus Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [] Back     alignment and domain information
>KOG2122|consensus Back     alignment and domain information
>KOG1060|consensus Back     alignment and domain information
>KOG1059|consensus Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>KOG1062|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query256
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 1e-06
3oqs_A 510 Importin subunit alpha-2; importin alpha, karyophe 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 3e-04
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
 Score = 47.7 bits (113), Expect = 1e-06
 Identities = 43/233 (18%), Positives = 76/233 (32%), Gaps = 25/233 (10%)

Query: 1   MLDDTAPENVLEVTARAMTYYLDVSAECTRRIVAIDGAMKAICSRLSLGAGIASRTSKDL 60
            + +  PE +    A A+T     ++  T+ +V    A+      L          S ++
Sbjct: 138 FMRENQPEMLQLEAAWALTNIASGTSAQTKVVVD-ADAVPLFIQLLY-------TGSVEV 189

Query: 61  AEQCIKVLELICTREAG---SVFEAGGLASVLLFIKQHGHSVHKDTLHSAMAVVSRLCSK 117
            EQ I  L  +          V +   +  +L        S     + +A   +S LC  
Sbjct: 190 KEQAIWALGNVAGDSTDYRDYVLQCNAMEPILGLFN----SNKPSLIRTATWTLSNLCRG 245

Query: 118 MEPQDP--QLPEAVEALSLLLRHEDTHISDAALRCFASLSDRFTRRGVDPAPLAQHGLAS 175
            +PQ     + +A+  L+ L+   DT     A    + LSD        P    Q  +  
Sbjct: 246 KKPQPDWSVVSQALPTLAKLIYSMDTETLVDACWAISYLSD-------GPQEAIQAVIDV 298

Query: 176 ELLIRLSNAAGSNPLNTSLGGANVSTASASGT-LATEAKASSGSVSTIVSLLS 227
            +  RL                       +G  L T+   ++G +  +  LLS
Sbjct: 299 RIPKRLVELLSHESTLVQTPALRAVGNIVTGNDLQTQVVINAGVLPALRLLLS 351


>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Length = 265 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query256
3ul1_B 510 Importin subunit alpha-2; arm repeat, armadillo re 99.96
3tpo_A 529 Importin subunit alpha-2; nuclear import, protein 99.96
4b8j_A 528 Importin subunit alpha-1A; transport protein, nucl 99.9
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 99.88
3nmz_A 458 APC variant protein; protein-protein complex, arma 99.85
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 99.85
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.84
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.84
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.83
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.8
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.78
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 99.77
3now_A 810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 99.77
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.75
3nmz_A458 APC variant protein; protein-protein complex, arma 99.74
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 99.73
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.71
4b8j_A 528 Importin subunit alpha-1A; transport protein, nucl 99.7
3now_A 810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 99.69
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 99.69
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 99.69
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.67
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 99.67
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 99.67
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 99.66
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 99.66
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.65
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.64
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 99.64
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.62
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.61
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.58
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 99.53
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.35
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.35
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.13
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 98.97
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 98.92
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 98.6
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 98.57
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 98.38
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 98.33
1qgr_A 876 Protein (importin beta subunit); transport recepto 98.32
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 98.31
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 98.3
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 98.25
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 98.22
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 98.11
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 98.05
1qgr_A 876 Protein (importin beta subunit); transport recepto 98.02
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 98.01
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 98.0
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 97.93
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 97.92
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 97.88
3grl_A 651 General vesicular transport factor P115; vesicle t 97.75
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 97.73
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 97.67
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 97.62
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 97.6
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 97.57
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 97.52
3grl_A 651 General vesicular transport factor P115; vesicle t 97.52
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 97.48
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 97.28
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 97.08
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 96.97
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 96.96
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 96.55
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 96.07
4hat_C 1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 95.83
2x19_B 963 Importin-13; nuclear transport, protein transport; 95.75
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 95.73
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 95.11
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 94.89
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 94.82
2vgl_A621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 94.74
2x1g_F 971 Cadmus; transport protein, developmental protein, 94.55
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 94.35
2x19_B 963 Importin-13; nuclear transport, protein transport; 94.22
2x1g_F 971 Cadmus; transport protein, developmental protein, 94.05
4hat_C 1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 93.99
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 93.62
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 92.74
3ibv_A 980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 90.81
3gjx_A 1073 Exportin-1; transport, cytoplasm, nucleus, RNA-bin 90.66
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 88.59
2db0_A253 253AA long hypothetical protein; heat repeats, hel 88.42
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 87.86
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 87.54
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 86.95
3ibv_A 980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 86.59
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
Probab=99.96  E-value=1.4e-28  Score=236.41  Aligned_cols=210  Identities=19%  Similarity=0.247  Sum_probs=178.4

Q ss_pred             CCC-CCCchhHHHHHHHHHHHHhccCchhhhHHHHhCCcHHHHHHHhhcccCCCCCCcHHHHHHHHHHHHHHhcccc---
Q psy15268          1 MLD-DTAPENVLEVTARAMTYYLDVSAECTRRIVAIDGAMKAICSRLSLGAGIASRTSKDLAEQCIKVLELICTREA---   76 (256)
Q Consensus         1 ~L~-~~~p~~~l~~AaraLTni~~~~p~~t~~ivv~~gAVp~L~~~L~~~i~~~~~~~~DlaEQal~aLe~Is~d~~---   76 (256)
                      ||+ .++|++|+ +|||||+||+++++++++. +++.|+||.|+++|.       +++.++.|||+|+|+||+++.+   
T Consensus       108 lL~~~~~~~lq~-~Aa~aL~nias~~~e~~~~-vv~~GaIp~Lv~lL~-------s~~~~v~e~A~~aL~nLa~d~~~~r  178 (510)
T 3ul1_B          108 FLGKTDCSPIQF-ESAWALTNIASGTSEQTKA-VVDGGAIPAFISLLA-------SPHAHISEQAVWALGNIAGDGSAFR  178 (510)
T ss_dssp             HTTCTTCHHHHH-HHHHHHHHHHTSCHHHHHH-HHHTTHHHHHHHHTT-------CSCHHHHHHHHHHHHHHHTTCHHHH
T ss_pred             HHCCCCCHHHHH-HHHHHHHHHhcCCHHHHHH-HHHCCCHHHHHHHHc-------CCCHHHHHHHHHHHHHHHhCCHHHH
Confidence            465 45678888 9999999999999999976 679999999999776       4589999999999999999865   


Q ss_pred             chhhhcCcHHHHHHhhcccCccc-chhhhhHHHHHHHHhcCCCCCCCC--ChHHHHHHHHHhhcCCCHHHHHHHHHHHHH
Q psy15268         77 GSVFEAGGLASVLLFIKQHGHSV-HKDTLHSAMAVVSRLCSKMEPQDP--QLPEAVEALSLLLRHEDTHISDAALRCFAS  153 (256)
Q Consensus        77 ~~Vl~~G~l~alL~~ldff~~~~-qr~~l~~a~~~vsNlCr~~~~~~~--~v~~~lP~L~~lL~~~D~~vv~~ac~als~  153 (256)
                      +.++++|++.+++.++....... ....+++++|+++|+|+++.+...  .+..++|.|.++|+++|+++..+||||+++
T Consensus       179 ~~v~~~G~i~~Ll~lL~~~~~~~~~~~~~~~a~~~L~nl~~~~~~~~~~~~~~~~lp~L~~LL~~~~~~v~~~A~~aL~~  258 (510)
T 3ul1_B          179 DLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADSCWAISY  258 (510)
T ss_dssp             HHHHHTTCHHHHHHHTCSSCGGGSCHHHHHHHHHHHHHHHCCCSSCCCHHHHHHHHHHHHHHTTCSCHHHHHHHHHHHHH
T ss_pred             HHHHHcCChHHHHHHHHhccchhhhHHHHHHHHHHHHHHhhcccchhHHHHHHhHHHHHHHHHhcCCHHHHHHHHHHHHH
Confidence            57999999999999998654332 224556999999999999866664  689999999999999999999999999999


Q ss_pred             hhhhccCCCCCccchhccccHHHHHHHhcccCCCCCCcCCCCCCCccccccCCccccccccCcchHHHHHHHHHHHhcCC
Q psy15268        154 LSDRFTRRGVDPAPLAQHGLASELLIRLSNAAGSNPLNTSLGGANVSTASASGTLATEAKASSGSVSTIVSLLSALCRGS  233 (256)
Q Consensus       154 L~d~~~~~~~~i~~l~~~glv~~Lv~LL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~l~~Ls~l~~~S  233 (256)
                      |+++   .+++.+.+++.|+++.|+++|.+.                              +.......++.|..++.++
T Consensus       259 L~~~---~~~~~~~i~~~g~i~~Lv~lL~~~------------------------------~~~v~~~al~aL~nl~~~~  305 (510)
T 3ul1_B          259 LTDG---PNERIEMVVKKGVVPQLVKLLGAT------------------------------ELPIVTPALRAIGNIVTGT  305 (510)
T ss_dssp             HTSS---CHHHHHHHHTTTCHHHHHHHHTCS------------------------------CHHHHHHHHHHHHHHTTSC
T ss_pred             Hhhc---hhhhHHHHHhcccchhhhhhhcCC------------------------------ChhhhhHHHHHHHHhhcCC
Confidence            9987   457889999999999999999632                              2356778999999999999


Q ss_pred             HHHHHHHHhcChHHHHhhh
Q psy15268        234 PSITSDLLHSDLPDAIGCP  252 (256)
Q Consensus       234 ~~it~~Ll~~~l~~~l~~~  252 (256)
                      +..+..+++.+....+.++
T Consensus       306 ~~~~~~i~~~g~l~~L~~L  324 (510)
T 3ul1_B          306 DEQTQKVIDAGALAVFPSL  324 (510)
T ss_dssp             HHHHHHHHHTTGGGGCC-C
T ss_pred             HHHHHHHhhccchHHHHHH
Confidence            9999999998855555443



>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Back     alignment and structure
>3gjx_A Exportin-1; transport, cytoplasm, nucleus, RNA-binding, acetylation, GTP-binding, HOST-virus interaction, nucleotide-binding, phosphoprotein; HET: GTP; 2.50A {Mus musculus} PDB: 3nby_A* 3nbz_A* 3nc0_A* 3nc1_A* 3gb8_A Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query256
d1wa5b_ 503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.91
d1q1sc_ 434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.86
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.6
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.56
d1xm9a1 457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.55
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.51
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.47
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.44
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.44
d1xm9a1 457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 98.95
d1qbkb_ 888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 97.76
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 97.76
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 97.6
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 97.47
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 97.43
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 97.16
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 97.1
d1b3ua_588 Constant regulatory domain of protein phosphatase 97.01
d1b3ua_ 588 Constant regulatory domain of protein phosphatase 96.94
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 96.73
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 96.62
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 96.58
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 96.48
d2bpta1861 Importin beta {Baker's yeast (Saccharomyces cerevi 96.32
d2vgla_584 Adaptin alpha C subunit N-terminal fragment {Mouse 96.23
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 95.87
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 95.64
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 95.2
d2vgla_ 584 Adaptin alpha C subunit N-terminal fragment {Mouse 94.45
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 92.71
d1wa5c_ 959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 89.32
d1wa5c_ 959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 88.39
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Armadillo repeat
domain: Karyopherin alpha
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.91  E-value=1.9e-23  Score=193.50  Aligned_cols=206  Identities=18%  Similarity=0.175  Sum_probs=176.7

Q ss_pred             CCC-CCchhHHHHHHHHHHHHhccCchhhhHHHHhCCcHHHHHHHhhcccCCCCCCcHHHHHHHHHHHHHHhcccc---c
Q psy15268          2 LDD-TAPENVLEVTARAMTYYLDVSAECTRRIVAIDGAMKAICSRLSLGAGIASRTSKDLAEQCIKVLELICTREA---G   77 (256)
Q Consensus         2 L~~-~~p~~~l~~AaraLTni~~~~p~~t~~ivv~~gAVp~L~~~L~~~i~~~~~~~~DlaEQal~aLe~Is~d~~---~   77 (256)
                      |+. .+++.+. +|+|+|+|++.+.++.+.. +++.|++|.|++.|.       +++.++.|+|+|+|+||+++++   .
T Consensus       128 l~~~~~~~iq~-~a~~~L~ni~~~~~~~~~~-~~~~g~i~~l~~lL~-------s~~~~i~~~a~~~L~nia~~~~~~r~  198 (503)
T d1wa5b_         128 MRENQPEMLQL-EAAWALTNIASGTSAQTKV-VVDADAVPLFIQLLY-------TGSVEVKEQAIWALGNVAGDSTDYRD  198 (503)
T ss_dssp             TSTTSCHHHHH-HHHHHHHHHTTSCHHHHHH-HHHTTCHHHHHHHHH-------HCCHHHHHHHHHHHHHHHTTCHHHHH
T ss_pred             HcCCCCHHHHH-HHHHHHHHHHcCCHHHHHH-HHhCCChHHHHHHhc-------CCChhHHHHHHHHHHHHhhhhHHHHH
Confidence            443 4566777 9999999999999999965 679999999999887       3478999999999999999866   4


Q ss_pred             hhhhcCcHHHHHHhhcccCcccchhhhhHHHHHHHHhcCCCCCCCC--ChHHHHHHHHHhhcCCCHHHHHHHHHHHHHhh
Q psy15268         78 SVFEAGGLASVLLFIKQHGHSVHKDTLHSAMAVVSRLCSKMEPQDP--QLPEAVEALSLLLRHEDTHISDAALRCFASLS  155 (256)
Q Consensus        78 ~Vl~~G~l~alL~~ldff~~~~qr~~l~~a~~~vsNlCr~~~~~~~--~v~~~lP~L~~lL~~~D~~vv~~ac~als~L~  155 (256)
                      .+++.|++.+++.+++.....+++    +++|+++|+|++.++...  .+.+++|.|..++.++|++++.++||++++++
T Consensus       199 ~l~~~~~~~~L~~ll~~~~~~~~~----~~~~~l~nl~~~~~~~~~~~~~~~~l~~l~~~l~~~d~~~~~~~~~~l~~l~  274 (503)
T d1wa5b_         199 YVLQCNAMEPILGLFNSNKPSLIR----TATWTLSNLCRGKKPQPDWSVVSQALPTLAKLIYSMDTETLVDACWAISYLS  274 (503)
T ss_dssp             HHHHTTCHHHHHHGGGSCCHHHHH----HHHHHHHHHHCCSSSCCCHHHHGGGHHHHHHHTTCCCHHHHHHHHHHHHHHH
T ss_pred             HHHhhcccccchhhcccCCHHHHH----HHHHHHHHHhcCCccchHHHHHHHHHHHHHHHhccccHHHHHHHHHHHHhhc
Confidence            688999999999999877666777    999999999998765553  68899999999999999999999999999999


Q ss_pred             hhccCCCCCccchhccccHHHHHHHhcccCCCCCCcCCCCCCCccccccCCccccccccCcchHHHHHHHHHHHhcCCHH
Q psy15268        156 DRFTRRGVDPAPLAQHGLASELLIRLSNAAGSNPLNTSLGGANVSTASASGTLATEAKASSGSVSTIVSLLSALCRGSPS  235 (256)
Q Consensus       156 d~~~~~~~~i~~l~~~glv~~Lv~LL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~l~~Ls~l~~~S~~  235 (256)
                      ++   .++.++.+++.|+++.+++++.+.                              ++......++.|..++.+++.
T Consensus       275 ~~---~~~~~~~~~~~~~~~~l~~ll~~~------------------------------~~~v~~~al~~l~nl~~~~~~  321 (503)
T d1wa5b_         275 DG---PQEAIQAVIDVRIPKRLVELLSHE------------------------------STLVQTPALRAVGNIVTGNDL  321 (503)
T ss_dssp             SS---CHHHHHHHHHTTCHHHHHHGGGCS------------------------------CHHHHHHHHHHHHHHTTSCHH
T ss_pred             cC---CchhhhhhhhhhhhhhhhhcccCC------------------------------chhhhhhHHHHHHHHHHHHHH
Confidence            87   456789999999999999999631                              235566789999999999999


Q ss_pred             HHHHHHhcChHHHHhhhh
Q psy15268        236 ITSDLLHSDLPDAIGCPR  253 (256)
Q Consensus       236 it~~Ll~~~l~~~l~~~~  253 (256)
                      .+..+++.++-+.+...+
T Consensus       322 ~~~~~~~~~~l~~l~~ll  339 (503)
T d1wa5b_         322 QTQVVINAGVLPALRLLL  339 (503)
T ss_dssp             HHHHHHHTTHHHHHHHHT
T ss_pred             HHHhhhccchHHHHHHHh
Confidence            999999998766666544



>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure