Psyllid ID: psy15335

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550--
PNRKALKDTCVIAPIQGGLDLSLRRYCAELYATRDVHGFLIDGLCADEGATEDLGCDVVNAVLENTVPYLPNDKLRIIQGPWSPMNIVQFVQRGIDMFDSGLPLVLADRGCAFTFQYTRHIPLCNSSNGVSINGDKNGTSNGVPSSINGKNGVSNEDSSSTNGENGLSNADSSSINGKNELSNTSDIYSSMESDIHQSTHQEALIINTDDVASKSSEKDTLYTKSSEISDSLYKPRQYEMWLQHPSINGKNGVSNEDSSSTNGENGLSNADSSSINGKNELSNTSDIYSSMESDIHQSTHQEALIINTDDVASKSSEKDTLYTKSSEISDSLYKPRQYEMWLQHPRYVTDFTPILAECECLTCQHHTRAYIHHLLNTKEMLAPVLLSICNSSNGVSINGDKNGTSNGVPSSINGKNGVSNEDSSSTNGENGLSNADSSSINGKNKLSNTSDIYSSMESDIHQSTHQEALIINTDDVASKSSEKDTLYTKSSEISDSLYKPRQYEMWLQHPRYVADFTPILAECECLTCQHHTRAYIHHLLNTKEMLAPVLLS
cccccccccEEEEEEEccccHHHHHHHHHHHHccccccEEcccccccccccccccHHHHHHHHHHHccccccccccEEcccccHHHHHHHHHccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHccccHHHHHHHccccccccccccccccccccccHHHHHHHHHHccccccccEEccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccccccEEccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccHHccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccHHHHHHHHHHcccccHHHccc
ccHHccccccEEEEEEcccHHHHHHHHHHHHHHcccccEEEcccccccccccHccHHHHHHHHHHHHHHccccccEEEcccccHHHHHHHHcccccEEEccHHHHHHHHcEEcccccEEEEEcccccccEcccccccccccccccEEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccHHccccHcHEEEEcccccccccccccccEEcccEEccccccccccEEEEEccHHHHcccccccccccHcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccHHccccHcHEEEEcccccccccccccccEEcccEEccccccccccEEEEEcHHHHHHccccccccccEcHHHHHHHHHHHHHcHHHHHHHHHcc
pnrkalkdtcviapiqggldLSLRRYCAELYATRDVHGFLidglcadegatedlgCDVVNAVLentvpylpndklriiqgpwspmnIVQFVQRGIdmfdsglplvladrgcaftfqytrhiplcnssngvsingdkngtsngvpssingkngvsnedssstngenglsnadsssingknelsntsdiyssmesdihqsthQEALIINtddvaskssekdtlytksseisdslykprqyemwlqhpsingkngvsnedssstngenglsnadsssingknelsntsdiyssmesdihqsthQEALIINtddvaskssekdtlytksseisdslykprqyemwlqhpryvtdftpilaececltcqHHTRAYIHHLLNTKEMLAPVLLSICnssngvsingdkngtsngvpssingkngvsnedssstngenglsnadsssingknklsntsdiyssmesdihqsthQEALIINtddvaskssekdtlytksseisdslykprqyemwlqhpryvadftpilAECECLTCQHHTRAYIHHLLNTKEMLAPVLLS
pnrkalkdtcviapiqggldlsLRRYCAELYATRDVHGFLIDGLCADEGATEDLGCDVVNAVLEntvpylpndKLRIIQGPWSPMNIVQFVQRGIDMFDSGLPLVLADRGCAFTFQYTRHIPLCNSSNGVSINGDKNGTSNGVPSSINGKNGVSNEDSSSTNGENGlsnadsssingkNELSNTSDIYSSMESDIHQSTHQEALIIntddvaskssekdtlytksseisdslykPRQYEMWLQHPSINGKNGVSNEDSSSTNGENGlsnadsssingkNELSNTSDIYSSMESDIHQSTHQEALIIntddvaskssekdtlytksseisdslykPRQYEMWLQHPRYVTDFTPILAECECLTCQHHTRAYIHHLLNTKEMLAPVLLSICNSSNGVSINGDKNGTSNGVPSSINGKNGVSNEDSSSTNGENGlsnadsssingknKLSNTSDIYSSMESDIHQSTHQEALIIntddvaskssekdtlytksseisdslykPRQYEMWLQHPRYVADFTPILAECECLTCQHHTRAYIHHLLNTKEMLAPVLLS
PNRKALKDTCVIAPIQGGLDLSLRRYCAELYATRDVHGFLIDGLCADEGATEDLGCDVVNAVLENTVPYLPNDKLRIIQGPWSPMNIVQFVQRGIDMFDSGLPLVLADRGCAFTFQYTRHIPLCNSSNGVSINGDKNGTSNGVPSSINGKNGVSNEDSSSTNGENGLSNADSSSINGKNELSNTSDIYSSMESDIHQSTHQEALIINTDDVASKSSEKDTLYTKSSEISDSLYKPRQYEMWLQHPSINGKNGVSNEDSSSTNGENGLSNADSSSINGKNELSNTSDIYSSMESDIHQSTHQEALIINTDDVASKSSEKDTLYTKSSEISDSLYKPRQYEMWLQHPRYVTDFTPILAECECLTCQHHTRAYIHHLLNTKEMLAPVLLSICNSSNGVSINGDKNGTSNGVPSSINGKNGVSNEDSSSTNGENGLSNADSSSINGKNKLSNTSDIYSSMESDIHQSTHQEALIINTDDVASKSSEKDTLYTKSSEISDSLYKPRQYEMWLQHPRYVADFTPILAECECLTCQHHTRAYIHHLLNTKEMLAPVLLS
******KDTCVIAPIQGGLDLSLRRYCAELYATRDVHGFLIDGLCADEGATEDLGCDVVNAVLENTVPYLPNDKLRIIQGPWSPMNIVQFVQRGIDMFDSGLPLVLADRGCAFTFQYTRHIPLCNS******************************************************************************************************************W******************************************************************************************LYKPRQYEMWLQHPRYVTDFTPILAECECLTCQHHTRAYIHHLLNTKEMLAPVLLSICNS*********************************************************************************************************LYKPRQYEMWLQHPRYVADFTPILAECECLTCQHHTRAYIHHLLNTKEMLAP****
******K***VIAPIQGGLDLSLRRYCAELYATRDVHGFLIDGLCADEGATEDLGCDVVNAVLENTVPYLPNDKLRIIQGPWSPMNIVQFVQRGIDMFDSGLPLVLADRGCAFTFQYTRHIP*******************GVPSSINGKNGVSNEDSSSTNGENGLSNADSSSINGKNELSNTSDIYSSMESDIHQSTHQEALIINTDDVASKSSEKDTLYTKSSEISDSLYKPRQYEMWLQHPSINGKNGVSNEDSSSTNGENGLSNADSSSINGKNELSNTSDIYSSMESDIHQSTHQEALIINTDDVASKSSEKDTLYTKSSEISDSLYKPRQYEMWLQHPRYVTDFTPILAECECLTCQHHTRAYIHHLLNTKEMLAPVLLSICNSSNGVSINGDKNGTSNGVPSSINGKNGVSNEDSSSTNGENGLSNADSSSINGKNKLSNTSDIYSSMESDIHQSTHQEALIINTDDVASKSSEKDTLYTKSSEISDSLYKPRQYEMWLQHPRYVADFTPILAECECLTCQHHTRAYIHHLLNTKEMLAPVLLS
PNRKALKDTCVIAPIQGGLDLSLRRYCAELYATRDVHGFLIDGLCADEGATEDLGCDVVNAVLENTVPYLPNDKLRIIQGPWSPMNIVQFVQRGIDMFDSGLPLVLADRGCAFTFQYTRHIPLCNSSNGVSINGDKNGTSNGVPSSINGKN***********************INGKNELSNTSDIYSSMESDIHQSTHQEALIINTDD**************SSEISDSLYKPRQYEMWLQHPSINGKN***********************INGKNELSNTSDIYSSMESDIHQSTHQEALIINTDD**************SSEISDSLYKPRQYEMWLQHPRYVTDFTPILAECECLTCQHHTRAYIHHLLNTKEMLAPVLLSICNSSNGVSINGDKNGTSNGVPSSINGKN***********************INGKNKLSNTSDIYSSMESDIHQSTHQEALIINTDD**************SSEISDSLYKPRQYEMWLQHPRYVADFTPILAECECLTCQHHTRAYIHHLLNTKEMLAPVLLS
*****LKDTCVIAPIQGGLDLSLRRYCAELYATRDVHGFLIDGLCADEGATEDLGCDVVNAVLENTVPYLPNDKLRIIQGPWSPMNIVQFVQRGIDMFDSGLPLVLADRGCAFTFQYTRHIPLCNSSNGVSI***KNGTSNGVPSSINGKNGVSNEDSSSTNGENGLSNADSSSINGKNELSNTSDIYSSMESDIHQSTHQEALIINTDDVASKSSEKDTLYTKSSEISDSLYKPRQYEMWLQ*************************************************SDIHQSTHQEALIINTDDVASKSSE*DTLYTKSSEISDSLYKPRQYEMWLQHPRYVTDFTPILAECECLTCQHHTRAYIHHLLNTKEMLAPVLLSICNSSNGVSINGDK********************************************************S*IHQSTHQEALIINTDDVASKSSE*DTLYTKSSEISDSLYKPRQYEMWLQHPRYVADFTPILAECECLTCQHHTRAYIHHLLNTKEMLAPVLLS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PNRKALKDTCVIAPIQGGLDLSLRRYCAELYATRDVHGFLIDGLCADEGATEDLGCDVVNAVLENTVPYLPNDKLRIIQGPWSPMNIVQFVQRGIDMFDSGLPLVLADRGCAFTFQYTRHIPLCNSSNGVSINGDKNGTSNGVPSSINGKNGVSNEDSSSTNGENGLSNADSSSINGKNELSNTSDIYSSMESDIHQSTHQEALIINTDDVASKSSEKDTLYTKSSEISDSLYKPRQYEMWLQHPSINGKNGVSNEDSSSTNGENGLSNADSSSINGKNELSNTSDIYSSMESDIHQSTHQEALIINTDDVASKSSEKDTLYTKSSEISDSLYKPRQYEMWLQHPRYVTDFTPILAECECLTCQHHTRAYIHHLLNTKEMLAPVLLSICNSSNGVSINGDKNGTSNGVPSSINGKNGVSNEDSSSTNGENGLSNADSSSINGKNKLSNTSDIYSSMESDIHQSTHQEALIINTDDVASKSSEKDTLYTKSSEISDSLYKPRQYEMWLQHPRYVADFTPILAECECLTCQHHTRAYIHHLLNTKEMLAPVLLS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query552 2.2.26 [Sep-21-2011]
B7Q5K1394 Queuine tRNA-ribosyltrans N/A N/A 0.179 0.251 0.345 4e-12
Q6DF96415 Queuine tRNA-ribosyltrans N/A N/A 0.193 0.257 0.375 8e-12
B8ZXI1415 Queuine tRNA-ribosyltrans no N/A 0.197 0.262 0.342 1e-11
Q28DX0413 Queuine tRNA-ribosyltrans yes N/A 0.190 0.254 0.366 1e-11
A9AW42392 Queuine tRNA-ribosyltrans yes N/A 0.188 0.265 0.372 2e-11
Q8RAM9375 Queuine tRNA-ribosyltrans yes N/A 0.193 0.285 0.362 2e-11
B9L8E1378 Queuine tRNA-ribosyltrans yes N/A 0.186 0.272 0.365 4e-11
Q9H974415 Queuine tRNA-ribosyltrans yes N/A 0.197 0.262 0.324 8e-11
Q5R998415 Queuine tRNA-ribosyltrans yes N/A 0.197 0.262 0.324 9e-11
B3MA91417 Queuine tRNA-ribosyltrans N/A N/A 0.161 0.213 0.382 9e-11
>sp|B7Q5K1|QTRD1_IXOSC Queuine tRNA-ribosyltransferase subunit QTRTD1 homolog OS=Ixodes scapularis GN=ISCW021855 PE=3 SV=1 Back     alignment and function desciption
 Score = 73.6 bits (179), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 38/110 (34%), Positives = 58/110 (52%)

Query: 6   LKDTCVIAPIQGGLDLSLRRYCAELYATRDVHGFLIDGLCADEGATEDLGCDVVNAVLEN 65
           L+ + ++  +QGG +   R   A+  A RDV GF+I+G   +   T+ L  + V  +LE 
Sbjct: 186 LQHSAILGSVQGGYNRDFREISAKETAKRDVDGFVIEGFHVNGPQTKSLKFEEVAEILEE 245

Query: 66  TVPYLPNDKLRIIQGPWSPMNIVQFVQRGIDMFDSGLPLVLADRGCAFTF 115
            +  LP DK R + G   P  I++ V  GID+FD+ L     + GCA  F
Sbjct: 246 VIALLPQDKPRFLHGVLRPEFILKAVLYGIDIFDASLAHAATEAGCALVF 295
Interacts with a second catalytic subunit to form an active queuine tRNA-ribosyltransferase. This enzyme exchanges queuine for the guanine at the wobble position of tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr), thereby forming the hypermodified nucleoside queuosine (Q) (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).
Ixodes scapularis (taxid: 6945)
EC: 2EC: .EC: 4EC: .EC: 2EC: .EC: 2EC: 9
>sp|Q6DF96|QTRD1_XENLA Queuine tRNA-ribosyltransferase subunit qtrtd1 OS=Xenopus laevis GN=qtrtd1 PE=2 SV=1 Back     alignment and function description
>sp|B8ZXI1|QTRD1_MOUSE Queuine tRNA-ribosyltransferase subunit QTRTD1 OS=Mus musculus GN=Qtrtd1 PE=1 SV=2 Back     alignment and function description
>sp|Q28DX0|QTRD1_XENTR Queuine tRNA-ribosyltransferase subunit qtrtd1 OS=Xenopus tropicalis GN=qtrtd1 PE=2 SV=1 Back     alignment and function description
>sp|A9AW42|TGT_HERA2 Queuine tRNA-ribosyltransferase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=tgt PE=3 SV=1 Back     alignment and function description
>sp|Q8RAM9|TGT_THETN Queuine tRNA-ribosyltransferase OS=Thermoanaerobacter tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=tgt PE=3 SV=1 Back     alignment and function description
>sp|B9L8E1|TGT_NAUPA Queuine tRNA-ribosyltransferase OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=tgt PE=3 SV=1 Back     alignment and function description
>sp|Q9H974|QTRD1_HUMAN Queuine tRNA-ribosyltransferase subunit QTRTD1 OS=Homo sapiens GN=QTRTD1 PE=1 SV=1 Back     alignment and function description
>sp|Q5R998|QTRD1_PONAB Queuine tRNA-ribosyltransferase subunit QTRTD1 OS=Pongo abelii GN=QTRTD1 PE=2 SV=1 Back     alignment and function description
>sp|B3MA91|QTRD1_DROAN Queuine tRNA-ribosyltransferase subunit QTRTD1 homolog OS=Drosophila ananassae GN=GF24662 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query552
332375580409 unknown [Dendroctonus ponderosae] 0.199 0.268 0.428 5e-16
328704841399 PREDICTED: queuine tRNA-ribosyltransfera 0.206 0.285 0.379 5e-16
91078284395 PREDICTED: similar to queuine tRNA-ribos 0.202 0.283 0.412 1e-15
338176542369 queuine tRNA-ribosyltransferase [Parachl 0.172 0.257 0.415 6e-12
282892423335 hypothetical protein pah_c253o050 [Parac 0.172 0.283 0.415 9e-12
443688497424 hypothetical protein CAPTEDRAFT_225931 [ 0.110 0.143 0.508 9e-12
322799605405 hypothetical protein SINV_00155 [Solenop 0.190 0.259 0.290 1e-11
307169543354 Queuine tRNA-ribosyltransferase domain-c 0.190 0.296 0.290 2e-11
332017768312 Queuine tRNA-ribosyltransferase subunit 0.199 0.352 0.309 3e-11
242023148422 queuine tRNA-ribosyltransferase, putativ 0.221 0.289 0.312 5e-11
>gi|332375580|gb|AEE62931.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
 Score = 92.4 bits (228), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 48/112 (42%), Positives = 65/112 (58%), Gaps = 2/112 (1%)

Query: 6   LKDTCVIAPIQGGLDLSLRRYCAELYATR--DVHGFLIDGLCADEGATEDLGCDVVNAVL 63
           LKD  VIAPI GG  +  R+ C EL +    DV G+LIDGL  +    E +    V  ++
Sbjct: 183 LKDAFVIAPIAGGYCVKSRKQCLELLSPNEPDVQGYLIDGLHNNGPEVELISFSEVKPIV 242

Query: 64  ENTVPYLPNDKLRIIQGPWSPMNIVQFVQRGIDMFDSGLPLVLADRGCAFTF 115
           +  +  LP  KLR IQG WSP+NI++ V  GID+FD+    +L +R  A TF
Sbjct: 243 DYVISKLPPGKLRAIQGCWSPLNIIKLVNSGIDIFDTSYCRILTERSAALTF 294

Source: Dendroctonus ponderosae

Species: Dendroctonus ponderosae

Genus: Dendroctonus

Family: Curculionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328704841|ref|XP_001945531.2| PREDICTED: queuine tRNA-ribosyltransferase subunit QTRTD1 homolog [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|91078284|ref|XP_971899.1| PREDICTED: similar to queuine tRNA-ribosyltransferase [Tribolium castaneum] gi|270003911|gb|EFA00359.1| hypothetical protein TcasGA2_TC003201 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|338176542|ref|YP_004653352.1| queuine tRNA-ribosyltransferase [Parachlamydia acanthamoebae UV-7] gi|336480900|emb|CCB87498.1| queuine tRNA-ribosyltransferase [Parachlamydia acanthamoebae UV-7] Back     alignment and taxonomy information
>gi|282892423|ref|ZP_06300773.1| hypothetical protein pah_c253o050 [Parachlamydia acanthamoebae str. Hall's coccus] gi|281497825|gb|EFB40186.1| hypothetical protein pah_c253o050 [Parachlamydia acanthamoebae str. Hall's coccus] Back     alignment and taxonomy information
>gi|443688497|gb|ELT91169.1| hypothetical protein CAPTEDRAFT_225931 [Capitella teleta] Back     alignment and taxonomy information
>gi|322799605|gb|EFZ20877.1| hypothetical protein SINV_00155 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307169543|gb|EFN62185.1| Queuine tRNA-ribosyltransferase domain-containing protein 1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332017768|gb|EGI58436.1| Queuine tRNA-ribosyltransferase subunit QTRTD1-like protein [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|242023148|ref|XP_002431998.1| queuine tRNA-ribosyltransferase, putative [Pediculus humanus corporis] gi|212517349|gb|EEB19260.1| queuine tRNA-ribosyltransferase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query552
UNIPROTKB|B7Q5K1394 ISCW021855 "Queuine tRNA-ribos 0.199 0.279 0.345 6e-22
UNIPROTKB|F1NK12425 QTRTD1 "Queuine tRNA-ribosyltr 0.168 0.218 0.373 7.4e-21
UNIPROTKB|Q6DF96415 qtrtd1 "Queuine tRNA-ribosyltr 0.201 0.267 0.376 4e-20
MGI|MGI:1922194415 Qtrtd1 "queuine tRNA-ribosyltr 0.197 0.262 0.342 7.3e-20
UNIPROTKB|Q5ZM96425 QTRTD1 "Queuine tRNA-ribosyltr 0.139 0.181 0.407 1.2e-19
UNIPROTKB|F1SP98415 LOC100514190 "Uncharacterized 0.197 0.262 0.333 2.1e-19
RGD|1310054345 Qtrtd1 "queuine tRNA-ribosyltr 0.195 0.313 0.347 2.4e-19
UNIPROTKB|Q9H974415 QTRTD1 "Queuine tRNA-ribosyltr 0.197 0.262 0.333 2.6e-19
UNIPROTKB|J3KR78427 QTRTD1 "Queuine tRNA-ribosyltr 0.197 0.255 0.333 3e-19
UNIPROTKB|Q5R998415 QTRTD1 "Queuine tRNA-ribosyltr 0.197 0.262 0.333 3.4e-19
UNIPROTKB|B7Q5K1 ISCW021855 "Queuine tRNA-ribosyltransferase subunit QTRTD1 homolog" [Ixodes scapularis (taxid:6945)] Back     alignment and assigned GO terms
 Score = 173 (66.0 bits), Expect = 6.0e-22, Sum P(2) = 6.0e-22
 Identities = 38/110 (34%), Positives = 58/110 (52%)

Query:     6 LKDTCVIAPIQGGLDLSLRRYCAELYATRDVHGFLIDGLCADEGATEDLGCDVVNAVLEN 65
             L+ + ++  +QGG +   R   A+  A RDV GF+I+G   +   T+ L  + V  +LE 
Sbjct:   186 LQHSAILGSVQGGYNRDFREISAKETAKRDVDGFVIEGFHVNGPQTKSLKFEEVAEILEE 245

Query:    66 TVPYLPNDKLRIIQGPWSPMNIVQFVQRGIDMFDSGLPLVLADRGCAFTF 115
              +  LP DK R + G   P  I++ V  GID+FD+ L     + GCA  F
Sbjct:   246 VIALLPQDKPRFLHGVLRPEFILKAVLYGIDIFDASLAHAATEAGCALVF 295
GO:0008616 "queuosine biosynthetic process" evidence=ISS
GO:0008479 "queuine tRNA-ribosyltransferase activity" evidence=ISS
UNIPROTKB|F1NK12 QTRTD1 "Queuine tRNA-ribosyltransferase subunit QTRTD1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q6DF96 qtrtd1 "Queuine tRNA-ribosyltransferase subunit qtrtd1" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
MGI|MGI:1922194 Qtrtd1 "queuine tRNA-ribosyltransferase domain containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZM96 QTRTD1 "Queuine tRNA-ribosyltransferase subunit QTRTD1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1SP98 LOC100514190 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1310054 Qtrtd1 "queuine tRNA-ribosyltransferase domain containing 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H974 QTRTD1 "Queuine tRNA-ribosyltransferase subunit QTRTD1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J3KR78 QTRTD1 "Queuine tRNA-ribosyltransferase subunit QTRTD1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R998 QTRTD1 "Queuine tRNA-ribosyltransferase subunit QTRTD1" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.4.2LOW CONFIDENCE prediction!
4th Layer2.4.2.29LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query552
pfam01702237 pfam01702, TGT, Queuine tRNA-ribosyltransferase 5e-23
pfam01702237 pfam01702, TGT, Queuine tRNA-ribosyltransferase 4e-17
pfam01702237 pfam01702, TGT, Queuine tRNA-ribosyltransferase 8e-16
PRK00112366 PRK00112, tgt, queuine tRNA-ribosyltransferase; Pr 1e-14
PRK00112366 PRK00112, tgt, queuine tRNA-ribosyltransferase; Pr 1e-14
TIGR00449367 TIGR00449, tgt_general, tRNA-guanine family transg 7e-14
COG0343372 COG0343, Tgt, Queuine/archaeosine tRNA-ribosyltran 2e-13
PRK00112366 PRK00112, tgt, queuine tRNA-ribosyltransferase; Pr 3e-13
TIGR00430368 TIGR00430, Q_tRNA_tgt, tRNA-guanine transglycosyla 2e-11
COG0343372 COG0343, Tgt, Queuine/archaeosine tRNA-ribosyltran 8e-10
TIGR00430368 TIGR00430, Q_tRNA_tgt, tRNA-guanine transglycosyla 4e-09
COG0343372 COG0343, Tgt, Queuine/archaeosine tRNA-ribosyltran 3e-08
TIGR00430368 TIGR00430, Q_tRNA_tgt, tRNA-guanine transglycosyla 3e-08
TIGR00449367 TIGR00449, tgt_general, tRNA-guanine family transg 4e-08
TIGR00449367 TIGR00449, tgt_general, tRNA-guanine family transg 2e-07
PRK01008372 PRK01008, PRK01008, queuine tRNA-ribosyltransferas 4e-06
PRK01008372 PRK01008, PRK01008, queuine tRNA-ribosyltransferas 1e-04
PRK13534639 PRK13534, PRK13534, 7-cyano-7-deazaguanine tRNA-ri 0.004
>gnl|CDD|216654 pfam01702, TGT, Queuine tRNA-ribosyltransferase Back     alignment and domain information 
 Score = 97.8 bits (244), Expect = 5e-23
 Identities = 39/115 (33%), Positives = 53/115 (46%), Gaps = 6/115 (5%)

Query: 7   KDTCVIAPIQGGLDLSLRRYCAELYATRDVHGFLIDGLCADEGATEDLGCDVVNAVLENT 66
           K   +   +QGGL   LR   AE  A     G+ I GL   E   E L       +++  
Sbjct: 52  KGQALFGIVQGGLYEDLREESAEELAEDGFDGYAIGGLSVGEEKEEML------ELVDAV 105

Query: 67  VPYLPNDKLRIIQGPWSPMNIVQFVQRGIDMFDSGLPLVLADRGCAFTFQYTRHI 121
            P LP DK R + G  +P +I++ V  G+DMFD   P   A  G A TF  T ++
Sbjct: 106 TPLLPEDKPRYLMGVGTPEDILEAVALGVDMFDCVSPTRYARNGRALTFDGTINL 160

This is a family of queuine tRNA-ribosyltransferases EC:2.4.2.29, also known as tRNA-guanine transglycosylase and guanine insertion enzyme. Queuine tRNA-ribosyltransferase modifies tRNAs for asparagine, aspartic acid, histidine and tyrosine with queuine. It catalyzes the exchange of guanine-34 at the wobble position with 7-aminomethyl-7-deazaguanine, and the addition of a cyclopentenediol moiety to 7-aminomethyl-7-deazaguanine-34 tRNA; giving a hypermodified base queuine in the wobble position. The aligned region contains a zinc binding motif C-x-C-x2-C-x29-H, and important tRNA and 7-aminomethyl-7deazaguanine binding residues. Length = 237
>gnl|CDD|216654 pfam01702, TGT, Queuine tRNA-ribosyltransferase Back     alignment and domain information
>gnl|CDD|216654 pfam01702, TGT, Queuine tRNA-ribosyltransferase Back     alignment and domain information
>gnl|CDD|234642 PRK00112, tgt, queuine tRNA-ribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|234642 PRK00112, tgt, queuine tRNA-ribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|129541 TIGR00449, tgt_general, tRNA-guanine family transglycosylase Back     alignment and domain information
>gnl|CDD|223420 COG0343, Tgt, Queuine/archaeosine tRNA-ribosyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|234642 PRK00112, tgt, queuine tRNA-ribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|129522 TIGR00430, Q_tRNA_tgt, tRNA-guanine transglycosylase, queuosine-34-forming Back     alignment and domain information
>gnl|CDD|223420 COG0343, Tgt, Queuine/archaeosine tRNA-ribosyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|129522 TIGR00430, Q_tRNA_tgt, tRNA-guanine transglycosylase, queuosine-34-forming Back     alignment and domain information
>gnl|CDD|223420 COG0343, Tgt, Queuine/archaeosine tRNA-ribosyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|129522 TIGR00430, Q_tRNA_tgt, tRNA-guanine transglycosylase, queuosine-34-forming Back     alignment and domain information
>gnl|CDD|129541 TIGR00449, tgt_general, tRNA-guanine family transglycosylase Back     alignment and domain information
>gnl|CDD|129541 TIGR00449, tgt_general, tRNA-guanine family transglycosylase Back     alignment and domain information
>gnl|CDD|134464 PRK01008, PRK01008, queuine tRNA-ribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|134464 PRK01008, PRK01008, queuine tRNA-ribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|237418 PRK13534, PRK13534, 7-cyano-7-deazaguanine tRNA-ribosyltransferase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 552
PRK01008372 queuine tRNA-ribosyltransferase; Provisional 100.0
COG0343372 Tgt Queuine/archaeosine tRNA-ribosyltransferase [T 100.0
TIGR00430368 Q_tRNA_tgt tRNA-guanine transglycosylase, queuosin 100.0
PRK00112366 tgt queuine tRNA-ribosyltransferase; Provisional 100.0
TIGR00449367 tgt_general tRNA-guanine transglycosylases, variou 100.0
PF01702238 TGT: Queuine tRNA-ribosyltransferase; InterPro: IP 100.0
KOG3908|consensus396 100.0
TIGR00432 540 arcsn_tRNA_tgt tRNA-guanine transglycosylase, arch 100.0
PRK13533487 7-cyano-7-deazaguanine tRNA-ribosyltransferase; Pr 100.0
PRK13534 639 7-cyano-7-deazaguanine tRNA-ribosyltransferase; Pr 100.0
PF01702238 TGT: Queuine tRNA-ribosyltransferase; InterPro: IP 100.0
COG0343372 Tgt Queuine/archaeosine tRNA-ribosyltransferase [T 99.97
PRK01008372 queuine tRNA-ribosyltransferase; Provisional 99.97
KOG3909|consensus414 99.96
PRK00112366 tgt queuine tRNA-ribosyltransferase; Provisional 99.96
TIGR00430368 Q_tRNA_tgt tRNA-guanine transglycosylase, queuosin 99.96
TIGR00449367 tgt_general tRNA-guanine transglycosylases, variou 99.95
PRK13533487 7-cyano-7-deazaguanine tRNA-ribosyltransferase; Pr 99.95
TIGR00432540 arcsn_tRNA_tgt tRNA-guanine transglycosylase, arch 99.95
KOG3908|consensus396 99.94
PRK13534639 7-cyano-7-deazaguanine tRNA-ribosyltransferase; Pr 99.94
KOG3909|consensus414 99.86
COG1549519 Queuine tRNA-ribosyltransferases, contain PUA doma 95.55
PHA01745306 hypothetical protein 93.37
PRK12330499 oxaloacetate decarboxylase; Provisional 91.71
cd07944266 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase- 89.24
PRK04147293 N-acetylneuraminate lyase; Provisional 88.83
PLN02417280 dihydrodipicolinate synthase 88.65
COG5016472 Pyruvate/oxaloacetate carboxyltransferase [Energy 88.32
PRK14042596 pyruvate carboxylase subunit B; Provisional 87.82
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 87.18
cd00954288 NAL N-Acetylneuraminic acid aldolase, also called 86.7
PRK12331448 oxaloacetate decarboxylase; Provisional 86.37
cd07938274 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, 86.37
PRK14041467 oxaloacetate decarboxylase; Provisional 85.95
PF00701289 DHDPS: Dihydrodipicolinate synthetase family; Inte 85.88
PRK05692287 hydroxymethylglutaryl-CoA lyase; Provisional 85.84
cd07943263 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-te 85.76
cd00950284 DHDPS Dihydrodipicolinate synthase (DHDPS) is a ke 85.66
PF00682237 HMGL-like: HMGL-like of this family is not conserv 85.45
cd00952309 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate 85.38
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 84.92
cd07940268 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N- 84.77
cd07937275 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar 83.49
cd00408281 DHDPS-like Dihydrodipicolinate synthase family. A 83.34
cd07939259 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and 83.3
PRK08195337 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac 83.21
TIGR02313294 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic ac 82.92
PRK03170292 dihydrodipicolinate synthase; Provisional 82.73
PRK12581468 oxaloacetate decarboxylase; Provisional 82.67
PRK09282592 pyruvate carboxylase subunit B; Validated 81.93
cd07945280 DRE_TIM_CMS Leptospira interrogans citramalate syn 81.59
PLN02746347 hydroxymethylglutaryl-CoA lyase 81.29
TIGR03249296 KdgD 5-dehydro-4-deoxyglucarate dehydratase. 5-deh 81.27
TIGR00674285 dapA dihydrodipicolinate synthase. Dihydrodipicoli 81.18
TIGR01108582 oadA oxaloacetate decarboxylase alpha subunit. Thi 80.32
>PRK01008 queuine tRNA-ribosyltransferase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=2.5e-48  Score=404.75  Aligned_cols=200  Identities=18%  Similarity=0.223  Sum_probs=175.2

Q ss_pred             cccccccceeeeccccccccccccccccc---------hhhhhhcccCcccccceeeecccCCCCCccccccccccccCC
Q psy15335        196 HQSTHQEALIINTDDVASKSSEKDTLYTK---------SSEISDSLYKPRQYEMWLQHPSINGKNGVSNEDSSSTNGENG  266 (552)
Q Consensus       196 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~r---------~~e~~~~~~~~r~~~~~~v~piqgG~~~~l~~~sa~~~~~~~  266 (552)
                      -|..-.-|+++.+|+|+|.++..  .+.+         +++..+.-+ .+.+...+.++||||.|.|+++.||+.+.++ 
T Consensus       148 ~Q~~iGsDI~m~LDe~~~~~~~~--~~~~~sv~rT~rW~~r~~~~~~-~~~~~q~lfgiVQGG~~~dLR~~Sa~~l~~~-  223 (372)
T PRK01008        148 AQKDLGADIIIPLDELLPFHADP--TYFLQSCQRTYVWEKRSLDYHL-KNPRHQSMYGVIHGGIDPDQRKIGCKFVEDL-  223 (372)
T ss_pred             HHHHHCCCEEEEccccCCCCCCH--HHHHHHHHHHHHHHHHHHHHHH-hCCccceEEEEecCCCCHHHHHHHHHHHHhC-
Confidence            56677789999999999986332  2222         222222211 1122345669999999999999999998874 


Q ss_pred             CCCCcccccCCCc--ccccHHHHHHHHHhhccccCccccccC-Cccchh-hccCCCCceecccc---ccCCceeccCCce
Q psy15335        267 LSNADSSSINGKN--ELSNTSDIYSSMESDIHQSTHQEALII-NTDDVA-SKSSEKDTLYTKSS---EISDSLYKPRQYE  339 (552)
Q Consensus       267 ~~~Fdg~AIGG~l--ek~~~~~Iv~~~~~~LP~~kPrHL~Gi-~P~dIf-aValGvDtFDcv~p---Ar~Gr~lt~~G~~  339 (552)
                        +|+||||||++  ++++|+++|.++++.||++|||||||+ +|++|+ ||++|||||||++|   ||+|++||++| +
T Consensus       224 --~~~GyaIGG~vge~~~~~~~il~~~~~~LP~~kPRyLmGvG~P~di~~~V~~GvD~FDcv~Ptr~AR~G~~lt~~G-~  300 (372)
T PRK01008        224 --PFDGSAIGGSLGKNLQEMVEVVGVTTSNLSKERPVHLLGIGDLPSIWATVGFGIDSFDSSYPTKAARHGLILTKQG-P  300 (372)
T ss_pred             --CCCEEEECCCCCCCHHHHHHHHHHHHhhCCCCCCeEEecCCCHHHHHHHHHhCCCeeeeccchhhhcCCEEEcCCC-c
Confidence              69999999976  668999999999999999999999999 999998 99999999999999   99999999999 9


Q ss_pred             EEecCCccccCCCCccCCCCCccCCC-CCHHHHhhhhccCccchhhHHHhhhhhHHHhhhccCC
Q psy15335        340 MWLQHPRYVTDFTPILAECECLTCQH-HTRAYIHHLLNTKEMLAPVLLSICNSSNGVSINGDKN  402 (552)
Q Consensus       340 l~L~~~~y~~Df~PIde~C~C~tC~~-yTRAYLhhL~ka~E~l~~rLLa~HNL~~~~~L~~~~r  402 (552)
                      ++|++.+|+.||+||+++|+||||++ |||||||||++++|+++.+||++|||+++.+||+.||
T Consensus       301 i~i~~~~~~~d~~Pid~~C~C~~C~~~ytraYLhHL~~~~E~l~~~LltiHNl~~~~~l~~~iR  364 (372)
T PRK01008        301 LKINNQRYSSDLNPIEPGCSCLACSSGISRAYLRHLFKVHEPNAGIWASIHNLHHMQQVMKEIR  364 (372)
T ss_pred             eecCchhhccCCCCCCCCCCCcCcCCCCCHHHHHHHhcCChHHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999 9999999999999999999999999999999999999

>COG0343 Tgt Queuine/archaeosine tRNA-ribosyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00430 Q_tRNA_tgt tRNA-guanine transglycosylase, queuosine-34-forming Back     alignment and domain information
>PRK00112 tgt queuine tRNA-ribosyltransferase; Provisional Back     alignment and domain information
>TIGR00449 tgt_general tRNA-guanine transglycosylases, various specificities Back     alignment and domain information
>PF01702 TGT: Queuine tRNA-ribosyltransferase; InterPro: IPR002616 This is a family of queuine, archaeosine and general tRNA-ribosyltransferases 2 Back     alignment and domain information
>KOG3908|consensus Back     alignment and domain information
>TIGR00432 arcsn_tRNA_tgt tRNA-guanine transglycosylase, archaeosine-15-forming Back     alignment and domain information
>PRK13533 7-cyano-7-deazaguanine tRNA-ribosyltransferase; Provisional Back     alignment and domain information
>PRK13534 7-cyano-7-deazaguanine tRNA-ribosyltransferase; Provisional Back     alignment and domain information
>PF01702 TGT: Queuine tRNA-ribosyltransferase; InterPro: IPR002616 This is a family of queuine, archaeosine and general tRNA-ribosyltransferases 2 Back     alignment and domain information
>COG0343 Tgt Queuine/archaeosine tRNA-ribosyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK01008 queuine tRNA-ribosyltransferase; Provisional Back     alignment and domain information
>KOG3909|consensus Back     alignment and domain information
>PRK00112 tgt queuine tRNA-ribosyltransferase; Provisional Back     alignment and domain information
>TIGR00430 Q_tRNA_tgt tRNA-guanine transglycosylase, queuosine-34-forming Back     alignment and domain information
>TIGR00449 tgt_general tRNA-guanine transglycosylases, various specificities Back     alignment and domain information
>PRK13533 7-cyano-7-deazaguanine tRNA-ribosyltransferase; Provisional Back     alignment and domain information
>TIGR00432 arcsn_tRNA_tgt tRNA-guanine transglycosylase, archaeosine-15-forming Back     alignment and domain information
>KOG3908|consensus Back     alignment and domain information
>PRK13534 7-cyano-7-deazaguanine tRNA-ribosyltransferase; Provisional Back     alignment and domain information
>KOG3909|consensus Back     alignment and domain information
>COG1549 Queuine tRNA-ribosyltransferases, contain PUA domain [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PHA01745 hypothetical protein Back     alignment and domain information
>PRK12330 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>cd07944 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-like, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK04147 N-acetylneuraminate lyase; Provisional Back     alignment and domain information
>PLN02417 dihydrodipicolinate synthase Back     alignment and domain information
>COG5016 Pyruvate/oxaloacetate carboxyltransferase [Energy production and conversion] Back     alignment and domain information
>PRK14042 pyruvate carboxylase subunit B; Provisional Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid) Back     alignment and domain information
>PRK12331 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>cd07938 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, catalytic TIM barrel domain Back     alignment and domain information
>PRK14041 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PF00701 DHDPS: Dihydrodipicolinate synthetase family; InterPro: IPR002220 Dihydropicolinate synthase (DHDPS) is the key enzyme in lysine biosynthesis via the diaminopimelate pathway of prokaryotes, some phycomycetes and higher plants Back     alignment and domain information
>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional Back     alignment and domain information
>cd07943 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>cd00950 DHDPS Dihydrodipicolinate synthase (DHDPS) is a key enzyme in lysine biosynthesis Back     alignment and domain information
>PF00682 HMGL-like: HMGL-like of this family is not conserved in other members Back     alignment and domain information
>cd00952 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate hydratase-aldolase (HBPHA) and trans-2'-carboxybenzalpyruvate hydratase-aldolase (CBPHA) Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>cd07940 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N-terminal catalytic TIM barrel domain Back     alignment and domain information
>cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain Back     alignment and domain information
>cd00408 DHDPS-like Dihydrodipicolinate synthase family Back     alignment and domain information
>cd07939 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated Back     alignment and domain information
>TIGR02313 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information
>PRK03170 dihydrodipicolinate synthase; Provisional Back     alignment and domain information
>PRK12581 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>cd07945 DRE_TIM_CMS Leptospira interrogans citramalate synthase (CMS) and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PLN02746 hydroxymethylglutaryl-CoA lyase Back     alignment and domain information
>TIGR03249 KdgD 5-dehydro-4-deoxyglucarate dehydratase Back     alignment and domain information
>TIGR00674 dapA dihydrodipicolinate synthase Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query552
3uvi_A388 Trna-Guanine Transglycosylase C158s C281s W326e E33 7e-10
3uvi_A388 Trna-Guanine Transglycosylase C158s C281s W326e E33 2e-06
3uvi_A388 Trna-Guanine Transglycosylase C158s C281s W326e E33 2e-06
2ash_A381 Crystal Structure Of Queuine Trna-Ribosyltransferas 1e-09
2ash_A381 Crystal Structure Of Queuine Trna-Ribosyltransferas 2e-05
2ash_A381 Crystal Structure Of Queuine Trna-Ribosyltransferas 2e-04
4hqv_A385 Trna-Guanine Transglycosylase Y106f, C158v, V233g M 4e-09
4hqv_A385 Trna-Guanine Transglycosylase Y106f, C158v, V233g M 1e-06
4hqv_A385 Trna-Guanine Transglycosylase Y106f, C158v, V233g M 2e-06
4gcx_A386 Trna-Guanine Transglycosylase Y106f, C158v, V233g M 4e-09
4gcx_A386 Trna-Guanine Transglycosylase Y106f, C158v, V233g M 1e-06
4gcx_A386 Trna-Guanine Transglycosylase Y106f, C158v, V233g M 2e-06
3unt_A388 Trna-Guanine Transglycosylase E339q Mutant Length = 4e-09
3unt_A388 Trna-Guanine Transglycosylase E339q Mutant Length = 4e-06
3unt_A388 Trna-Guanine Transglycosylase E339q Mutant Length = 4e-06
4hsh_A385 Trna-Guanine Transglycosylase Y106f, V233g Mutant I 4e-09
4hsh_A385 Trna-Guanine Transglycosylase Y106f, V233g Mutant I 2e-06
4hsh_A385 Trna-Guanine Transglycosylase Y106f, V233g Mutant I 2e-06
1y5v_A385 Trna-guanine Transglycosylase (tgt) In Complex With 4e-09
1y5v_A385 Trna-guanine Transglycosylase (tgt) In Complex With 2e-06
1y5v_A385 Trna-guanine Transglycosylase (tgt) In Complex With 2e-06
3bl3_A386 Trna Guanine Transglycosylase V233g Mutant Apo Stru 4e-09
3bl3_A386 Trna Guanine Transglycosylase V233g Mutant Apo Stru 1e-06
3bl3_A386 Trna Guanine Transglycosylase V233g Mutant Apo Stru 2e-06
4gd0_A386 Trna-Guanine Transglycosylase Y106f, C158v Mutant L 4e-09
4gd0_A386 Trna-Guanine Transglycosylase Y106f, C158v Mutant L 2e-06
4gd0_A386 Trna-Guanine Transglycosylase Y106f, C158v Mutant L 2e-06
1enu_A386 A New Target For Shigellosis: Rational Design And C 4e-09
1enu_A386 A New Target For Shigellosis: Rational Design And C 2e-06
1enu_A386 A New Target For Shigellosis: Rational Design And C 2e-06
1wkd_A386 Trna-Guanine Transglycosylase Length = 386 4e-09
1wkd_A386 Trna-Guanine Transglycosylase Length = 386 2e-06
1wkd_A386 Trna-Guanine Transglycosylase Length = 386 2e-06
1wke_A386 Trna-Guanine Transglycosylase Length = 386 4e-09
1wke_A386 Trna-Guanine Transglycosylase Length = 386 2e-06
1wke_A386 Trna-Guanine Transglycosylase Length = 386 2e-06
1efz_A386 Mutagenesis And Crystallographic Studies Of Zymomon 4e-09
1efz_A386 Mutagenesis And Crystallographic Studies Of Zymomon 2e-06
1efz_A386 Mutagenesis And Crystallographic Studies Of Zymomon 2e-06
1wkf_A386 Trna-Guanine Transglycosylase Length = 386 4e-09
1wkf_A386 Trna-Guanine Transglycosylase Length = 386 2e-06
1wkf_A386 Trna-Guanine Transglycosylase Length = 386 2e-06
1ozm_A386 Y106f Mutant Of Z. Mobilis Tgt Length = 386 4e-09
1ozm_A386 Y106f Mutant Of Z. Mobilis Tgt Length = 386 2e-06
1ozm_A386 Y106f Mutant Of Z. Mobilis Tgt Length = 386 2e-06
3hfy_A386 Mutant Of Trna-Guanine Transglycosylase (K52m) Leng 4e-09
3hfy_A386 Mutant Of Trna-Guanine Transglycosylase (K52m) Leng 2e-06
3hfy_A386 Mutant Of Trna-Guanine Transglycosylase (K52m) Leng 2e-06
2nqz_A385 Trna-Guanine Transglycosylase (Tgt) Mutant In Compl 5e-09
2nqz_A385 Trna-Guanine Transglycosylase (Tgt) Mutant In Compl 1e-06
2nqz_A385 Trna-Guanine Transglycosylase (Tgt) Mutant In Compl 2e-06
2nso_A386 Trna-Gunanine-Transglycosylase (Tgt) Mutant Y106f, 5e-09
2nso_A386 Trna-Gunanine-Transglycosylase (Tgt) Mutant Y106f, 1e-06
2nso_A386 Trna-Gunanine-Transglycosylase (Tgt) Mutant Y106f, 2e-06
2oko_A385 Z. Mobilis Trna Guanine Transglycosylase E235q Muta 9e-09
2oko_A385 Z. Mobilis Trna Guanine Transglycosylase E235q Muta 2e-06
2oko_A385 Z. Mobilis Trna Guanine Transglycosylase E235q Muta 2e-06
2pot_A386 Trna Guanine Transglycosylase (Tgt) E235q Mutant In 1e-08
2pot_A386 Trna Guanine Transglycosylase (Tgt) E235q Mutant In 2e-06
2pot_A386 Trna Guanine Transglycosylase (Tgt) E235q Mutant In 2e-06
1pxg_A382 Crystal Structure Of The Mutated Trna-Guanine Trans 1e-08
1pxg_A382 Crystal Structure Of The Mutated Trna-Guanine Trans 2e-06
1pxg_A382 Crystal Structure Of The Mutated Trna-Guanine Trans 2e-06
>pdb|3UVI|A Chain A, Trna-Guanine Transglycosylase C158s C281s W326e E339q Mutant Length = 388 Back     alignment and structure 
Iteration: 1

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 53/100 (53%), Gaps = 6/100 (6%)
Query: 16  QGGLDLSLRRYCAELYATRDVHGFLIDGLCADEGATEDLGCDVVNAVLENTVPYLPNDKL 75
           QG +  +LR+  A+  A     G+ + GL   EG  E      +  VL+ +VP LP+DK 
Sbjct: 205 QGSVFENLRQQSADALAEIGFDGYAVGGLAVGEGQDE------MFRVLDFSVPMLPDDKP 258
Query: 76  RIIQGPWSPMNIVQFVQRGIDMFDSGLPLVLADRGCAFTF 115
             + G   P +IV  V+RGIDMFDS LP      G AFT+
Sbjct: 259 HYLMGVGKPDDIVGAVERGIDMFDSVLPTRSGRNGQAFTW 298
>pdb|3UVI|A Chain A, Trna-Guanine Transglycosylase C158s C281s W326e E339q Mutant Length = 388 Back     alignment and structure
>pdb|3UVI|A Chain A, Trna-Guanine Transglycosylase C158s C281s W326e E339q Mutant Length = 388 Back     alignment and structure
>pdb|2ASH|A Chain A, Crystal Structure Of Queuine Trna-Ribosyltransferase (Ec 2.4.2.29) (Trna-Guanine (Tm1561) From Thermotoga Maritima At 1.90 A Resolution Length = 381 Back     alignment and structure
>pdb|2ASH|A Chain A, Crystal Structure Of Queuine Trna-Ribosyltransferase (Ec 2.4.2.29) (Trna-Guanine (Tm1561) From Thermotoga Maritima At 1.90 A Resolution Length = 381 Back     alignment and structure
>pdb|2ASH|A Chain A, Crystal Structure Of Queuine Trna-Ribosyltransferase (Ec 2.4.2.29) (Trna-Guanine (Tm1561) From Thermotoga Maritima At 1.90 A Resolution Length = 381 Back     alignment and structure
>pdb|4HQV|A Chain A, Trna-Guanine Transglycosylase Y106f, C158v, V233g Mutant In Complex With Queuine Length = 385 Back     alignment and structure
>pdb|4HQV|A Chain A, Trna-Guanine Transglycosylase Y106f, C158v, V233g Mutant In Complex With Queuine Length = 385 Back     alignment and structure
>pdb|4HQV|A Chain A, Trna-Guanine Transglycosylase Y106f, C158v, V233g Mutant In Complex With Queuine Length = 385 Back     alignment and structure
>pdb|4GCX|A Chain A, Trna-Guanine Transglycosylase Y106f, C158v, V233g Mutant In Complex With Preq1 Length = 386 Back     alignment and structure
>pdb|4GCX|A Chain A, Trna-Guanine Transglycosylase Y106f, C158v, V233g Mutant In Complex With Preq1 Length = 386 Back     alignment and structure
>pdb|4GCX|A Chain A, Trna-Guanine Transglycosylase Y106f, C158v, V233g Mutant In Complex With Preq1 Length = 386 Back     alignment and structure
>pdb|3UNT|A Chain A, Trna-Guanine Transglycosylase E339q Mutant Length = 388 Back     alignment and structure
>pdb|3UNT|A Chain A, Trna-Guanine Transglycosylase E339q Mutant Length = 388 Back     alignment and structure
>pdb|3UNT|A Chain A, Trna-Guanine Transglycosylase E339q Mutant Length = 388 Back     alignment and structure
>pdb|4HSH|A Chain A, Trna-Guanine Transglycosylase Y106f, V233g Mutant In Complex With Queuine Length = 385 Back     alignment and structure
>pdb|4HSH|A Chain A, Trna-Guanine Transglycosylase Y106f, V233g Mutant In Complex With Queuine Length = 385 Back     alignment and structure
>pdb|4HSH|A Chain A, Trna-Guanine Transglycosylase Y106f, V233g Mutant In Complex With Queuine Length = 385 Back     alignment and structure
>pdb|1Y5V|A Chain A, Trna-guanine Transglycosylase (tgt) In Complex With 6-amino-4-(2- Phenylethyl)-1,7-dihydro-8h-imidazo[4, 5-g]quinazolin-8-one Length = 385 Back     alignment and structure
>pdb|1Y5V|A Chain A, Trna-guanine Transglycosylase (tgt) In Complex With 6-amino-4-(2- Phenylethyl)-1,7-dihydro-8h-imidazo[4, 5-g]quinazolin-8-one Length = 385 Back     alignment and structure
>pdb|1Y5V|A Chain A, Trna-guanine Transglycosylase (tgt) In Complex With 6-amino-4-(2- Phenylethyl)-1,7-dihydro-8h-imidazo[4, 5-g]quinazolin-8-one Length = 385 Back     alignment and structure
>pdb|3BL3|A Chain A, Trna Guanine Transglycosylase V233g Mutant Apo Structure Length = 386 Back     alignment and structure
>pdb|3BL3|A Chain A, Trna Guanine Transglycosylase V233g Mutant Apo Structure Length = 386 Back     alignment and structure
>pdb|3BL3|A Chain A, Trna Guanine Transglycosylase V233g Mutant Apo Structure Length = 386 Back     alignment and structure
>pdb|4GD0|A Chain A, Trna-Guanine Transglycosylase Y106f, C158v Mutant Length = 386 Back     alignment and structure
>pdb|4GD0|A Chain A, Trna-Guanine Transglycosylase Y106f, C158v Mutant Length = 386 Back     alignment and structure
>pdb|4GD0|A Chain A, Trna-Guanine Transglycosylase Y106f, C158v Mutant Length = 386 Back     alignment and structure
>pdb|1ENU|A Chain A, A New Target For Shigellosis: Rational Design And Crystallographic Studies Of Inhibitors Of Trna-Guanine Transglycosylase Length = 386 Back     alignment and structure
>pdb|1ENU|A Chain A, A New Target For Shigellosis: Rational Design And Crystallographic Studies Of Inhibitors Of Trna-Guanine Transglycosylase Length = 386 Back     alignment and structure
>pdb|1ENU|A Chain A, A New Target For Shigellosis: Rational Design And Crystallographic Studies Of Inhibitors Of Trna-Guanine Transglycosylase Length = 386 Back     alignment and structure
>pdb|1WKD|A Chain A, Trna-Guanine Transglycosylase Length = 386 Back     alignment and structure
>pdb|1WKD|A Chain A, Trna-Guanine Transglycosylase Length = 386 Back     alignment and structure
>pdb|1WKD|A Chain A, Trna-Guanine Transglycosylase Length = 386 Back     alignment and structure
>pdb|1WKE|A Chain A, Trna-Guanine Transglycosylase Length = 386 Back     alignment and structure
>pdb|1WKE|A Chain A, Trna-Guanine Transglycosylase Length = 386 Back     alignment and structure
>pdb|1WKE|A Chain A, Trna-Guanine Transglycosylase Length = 386 Back     alignment and structure
>pdb|1EFZ|A Chain A, Mutagenesis And Crystallographic Studies Of Zymomonas Mobilis Trna- Guanine Transglycosylase To Elucidate The Role Of Serine 103 For Enzymatic Activity Length = 386 Back     alignment and structure
>pdb|1EFZ|A Chain A, Mutagenesis And Crystallographic Studies Of Zymomonas Mobilis Trna- Guanine Transglycosylase To Elucidate The Role Of Serine 103 For Enzymatic Activity Length = 386 Back     alignment and structure
>pdb|1EFZ|A Chain A, Mutagenesis And Crystallographic Studies Of Zymomonas Mobilis Trna- Guanine Transglycosylase To Elucidate The Role Of Serine 103 For Enzymatic Activity Length = 386 Back     alignment and structure
>pdb|1WKF|A Chain A, Trna-Guanine Transglycosylase Length = 386 Back     alignment and structure
>pdb|1WKF|A Chain A, Trna-Guanine Transglycosylase Length = 386 Back     alignment and structure
>pdb|1WKF|A Chain A, Trna-Guanine Transglycosylase Length = 386 Back     alignment and structure
>pdb|1OZM|A Chain A, Y106f Mutant Of Z. Mobilis Tgt Length = 386 Back     alignment and structure
>pdb|1OZM|A Chain A, Y106f Mutant Of Z. Mobilis Tgt Length = 386 Back     alignment and structure
>pdb|1OZM|A Chain A, Y106f Mutant Of Z. Mobilis Tgt Length = 386 Back     alignment and structure
>pdb|3HFY|A Chain A, Mutant Of Trna-Guanine Transglycosylase (K52m) Length = 386 Back     alignment and structure
>pdb|3HFY|A Chain A, Mutant Of Trna-Guanine Transglycosylase (K52m) Length = 386 Back     alignment and structure
>pdb|3HFY|A Chain A, Mutant Of Trna-Guanine Transglycosylase (K52m) Length = 386 Back     alignment and structure
>pdb|2NQZ|A Chain A, Trna-Guanine Transglycosylase (Tgt) Mutant In Complex With 7-Deaza-7- Aminomethyl-Guanine Length = 385 Back     alignment and structure
>pdb|2NQZ|A Chain A, Trna-Guanine Transglycosylase (Tgt) Mutant In Complex With 7-Deaza-7- Aminomethyl-Guanine Length = 385 Back     alignment and structure
>pdb|2NQZ|A Chain A, Trna-Guanine Transglycosylase (Tgt) Mutant In Complex With 7-Deaza-7- Aminomethyl-Guanine Length = 385 Back     alignment and structure
>pdb|2NSO|A Chain A, Trna-Gunanine-Transglycosylase (Tgt) Mutant Y106f, C158v, A232s, V233g- Apo-Structure Length = 386 Back     alignment and structure
>pdb|2NSO|A Chain A, Trna-Gunanine-Transglycosylase (Tgt) Mutant Y106f, C158v, A232s, V233g- Apo-Structure Length = 386 Back     alignment and structure
>pdb|2NSO|A Chain A, Trna-Gunanine-Transglycosylase (Tgt) Mutant Y106f, C158v, A232s, V233g- Apo-Structure Length = 386 Back     alignment and structure
>pdb|2OKO|A Chain A, Z. Mobilis Trna Guanine Transglycosylase E235q Mutant Apo-Structure At Ph 5.5 Length = 385 Back     alignment and structure
>pdb|2OKO|A Chain A, Z. Mobilis Trna Guanine Transglycosylase E235q Mutant Apo-Structure At Ph 5.5 Length = 385 Back     alignment and structure
>pdb|2OKO|A Chain A, Z. Mobilis Trna Guanine Transglycosylase E235q Mutant Apo-Structure At Ph 5.5 Length = 385 Back     alignment and structure
>pdb|2POT|A Chain A, Trna Guanine Transglycosylase (Tgt) E235q Mutant In Complex With Guanine Length = 386 Back     alignment and structure
>pdb|2POT|A Chain A, Trna Guanine Transglycosylase (Tgt) E235q Mutant In Complex With Guanine Length = 386 Back     alignment and structure
>pdb|2POT|A Chain A, Trna Guanine Transglycosylase (Tgt) E235q Mutant In Complex With Guanine Length = 386 Back     alignment and structure
>pdb|1PXG|A Chain A, Crystal Structure Of The Mutated Trna-Guanine Transglycosylase (Tgt) D280e Complexed With Preq1 Length = 382 Back     alignment and structure
>pdb|1PXG|A Chain A, Crystal Structure Of The Mutated Trna-Guanine Transglycosylase (Tgt) D280e Complexed With Preq1 Length = 382 Back     alignment and structure
>pdb|1PXG|A Chain A, Crystal Structure Of The Mutated Trna-Guanine Transglycosylase (Tgt) D280e Complexed With Preq1 Length = 382 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query552
2ash_A381 Queuine tRNA-ribosyltransferase; TM1561, tRNA-guan 2e-15
2ash_A381 Queuine tRNA-ribosyltransferase; TM1561, tRNA-guan 1e-14
2ash_A381 Queuine tRNA-ribosyltransferase; TM1561, tRNA-guan 8e-14
3bld_A386 Queuine tRNA-ribosyltransferase; TGT, PREQ1, glyco 2e-15
3bld_A386 Queuine tRNA-ribosyltransferase; TGT, PREQ1, glyco 4e-14
3bld_A386 Queuine tRNA-ribosyltransferase; TGT, PREQ1, glyco 9e-14
1iq8_A582 Archaeosine tRNA-guanine transglycosylase; (alpha/ 2e-14
1iq8_A 582 Archaeosine tRNA-guanine transglycosylase; (alpha/ 7e-08
1iq8_A 582 Archaeosine tRNA-guanine transglycosylase; (alpha/ 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-05
>2ash_A Queuine tRNA-ribosyltransferase; TM1561, tRNA-guanine, struc genomics, joint center for structural genomics, JCSG; 1.90A {Thermotoga maritima} Length = 381 Back     alignment and structure
 Score = 77.2 bits (191), Expect = 2e-15
 Identities = 18/45 (40%), Positives = 26/45 (57%)

Query: 346 RYVTDFTPILAECECLTCQHHTRAYIHHLLNTKEMLAPVLLSICN 390
                  P+   C C TC++ TR+YIHHL +  E+L  +LL+I N
Sbjct: 299 YNKRSLEPVDERCGCYTCKNFTRSYIHHLFDRGEVLGQILLTIHN 343
>2ash_A Queuine tRNA-ribosyltransferase; TM1561, tRNA-guanine, struc genomics, joint center for structural genomics, JCSG; 1.90A {Thermotoga maritima} Length = 381 Back     alignment and structure
>2ash_A Queuine tRNA-ribosyltransferase; TM1561, tRNA-guanine, struc genomics, joint center for structural genomics, JCSG; 1.90A {Thermotoga maritima} Length = 381 Back     alignment and structure
>3bld_A Queuine tRNA-ribosyltransferase; TGT, PREQ1, glycosyltransferase, metal-binding, queuosine biosynthesis, tRNA processing; HET: PRF; 1.19A {Zymomonas mobilis} PDB: 3bl3_A* 1ozq_A* 1ozm_A* 1r5y_A* 1enu_A* 1f3e_A* 1k4h_A* 1n2v_A* 1p0b_A* 1p0d_A 1p0e_A* 1pud_A 1q2r_A* 1q2s_A* 1q4w_A* 1q63_A* 1q65_A* 1q66_A* 1k4g_A* 1s38_A* ... Length = 386 Back     alignment and structure
>3bld_A Queuine tRNA-ribosyltransferase; TGT, PREQ1, glycosyltransferase, metal-binding, queuosine biosynthesis, tRNA processing; HET: PRF; 1.19A {Zymomonas mobilis} PDB: 3bl3_A* 1ozq_A* 1ozm_A* 1r5y_A* 1enu_A* 1f3e_A* 1k4h_A* 1n2v_A* 1p0b_A* 1p0d_A 1p0e_A* 1pud_A 1q2r_A* 1q2s_A* 1q4w_A* 1q63_A* 1q65_A* 1q66_A* 1k4g_A* 1s38_A* ... Length = 386 Back     alignment and structure
>3bld_A Queuine tRNA-ribosyltransferase; TGT, PREQ1, glycosyltransferase, metal-binding, queuosine biosynthesis, tRNA processing; HET: PRF; 1.19A {Zymomonas mobilis} PDB: 3bl3_A* 1ozq_A* 1ozm_A* 1r5y_A* 1enu_A* 1f3e_A* 1k4h_A* 1n2v_A* 1p0b_A* 1p0d_A 1p0e_A* 1pud_A 1q2r_A* 1q2s_A* 1q4w_A* 1q63_A* 1q65_A* 1q66_A* 1k4g_A* 1s38_A* ... Length = 386 Back     alignment and structure
>1iq8_A Archaeosine tRNA-guanine transglycosylase; (alpha/beta)8 barrel, riken structural genomics/proteomics initiative, RSGI; 2.20A {Pyrococcus horikoshii} SCOP: b.122.1.1 c.1.20.1 d.17.6.1 PDB: 1it7_A* 1it8_A* 1j2b_A Length = 582 Back     alignment and structure
>1iq8_A Archaeosine tRNA-guanine transglycosylase; (alpha/beta)8 barrel, riken structural genomics/proteomics initiative, RSGI; 2.20A {Pyrococcus horikoshii} SCOP: b.122.1.1 c.1.20.1 d.17.6.1 PDB: 1it7_A* 1it8_A* 1j2b_A Length = 582 Back     alignment and structure
>1iq8_A Archaeosine tRNA-guanine transglycosylase; (alpha/beta)8 barrel, riken structural genomics/proteomics initiative, RSGI; 2.20A {Pyrococcus horikoshii} SCOP: b.122.1.1 c.1.20.1 d.17.6.1 PDB: 1it7_A* 1it8_A* 1j2b_A Length = 582 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query552
2ash_A381 Queuine tRNA-ribosyltransferase; TM1561, tRNA-guan 100.0
3bld_A386 Queuine tRNA-ribosyltransferase; TGT, PREQ1, glyco 100.0
1iq8_A 582 Archaeosine tRNA-guanine transglycosylase; (alpha/ 100.0
2ash_A381 Queuine tRNA-ribosyltransferase; TM1561, tRNA-guan 99.97
3bld_A386 Queuine tRNA-ribosyltransferase; TGT, PREQ1, glyco 99.96
1iq8_A582 Archaeosine tRNA-guanine transglycosylase; (alpha/ 99.93
1nvm_A345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 91.8
1nvm_A345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 88.49
2ftp_A302 Hydroxymethylglutaryl-COA lyase; structural genomi 88.17
1ydo_A307 HMG-COA lyase; TIM-barrel protein, structural geno 87.61
3ble_A337 Citramalate synthase from leptospira interrogans; 87.39
3s5o_A307 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; 86.4
1xky_A301 Dihydrodipicolinate synthase; TIM barrel, , lysine 83.71
3b4u_A294 Dihydrodipicolinate synthase; structural genomics, 83.24
3cpr_A304 Dihydrodipicolinate synthetase; (beta/alpha)8-barr 83.03
2nuw_A288 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho a 82.93
2wkj_A303 N-acetylneuraminate lyase; directed evolution, sia 82.78
1f6k_A293 N-acetylneuraminate lyase; beta barrel; 1.60A {Hae 82.11
3a5f_A291 Dihydrodipicolinate synthase; TIM barrel, enzyme, 81.89
3ewb_X293 2-isopropylmalate synthase; LEUA, structural genom 81.8
2ehh_A294 DHDPS, dihydrodipicolinate synthase; structural ge 81.33
1rqb_A539 Transcarboxylase 5S subunit; TIM-barrel, carbamyla 81.13
2cw6_A298 Hydroxymethylglutaryl-COA lyase, mitochondrial; HM 81.05
2yxg_A289 DHDPS, dihydrodipicolinate synthase; MJ0244, TIM b 80.57
1w3i_A293 EDA, 2-keto-3-deoxy gluconate aldolase; archaeal m 80.26
>2ash_A Queuine tRNA-ribosyltransferase; TM1561, tRNA-guanine, struc genomics, joint center for structural genomics, JCSG; 1.90A {Thermotoga maritima} Back     alignment and structure
Probab=100.00  E-value=9.4e-48  Score=400.05  Aligned_cols=198  Identities=17%  Similarity=0.161  Sum_probs=171.4

Q ss_pred             cccccccceeeeccccccccccccccccchh---------hhhhcccCcccccceeeecccCCCCCccccccccccccCC
Q psy15335        196 HQSTHQEALIINTDDVASKSSEKDTLYTKSS---------EISDSLYKPRQYEMWLQHPSINGKNGVSNEDSSSTNGENG  266 (552)
Q Consensus       196 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~---------e~~~~~~~~r~~~~~~v~piqgG~~~~l~~~sa~~~~~~~  266 (552)
                      -|..-.-|+++.+|+|+|....  ..|.+.+         +..+...  +. ...+.+|+|||.|.|+++.||+.+.++ 
T Consensus       141 iQ~~lgsDI~m~lDe~~~~~~~--~~~~~~sv~rT~rWa~r~~~~~~--~~-~~~lfgiVQGg~~~dLR~~sa~~l~~~-  214 (381)
T 2ash_A          141 VQIALGSDICMVFDHCPVPDAD--YEEVKEATERTYRWALRSKKAFK--TE-NQALFGIVQGGIYPDLRRESALQLTSI-  214 (381)
T ss_dssp             HHHHHTCSEEECCCCCCC--CC--HHHHHHHHHHHHHHHHHHHHHCC--CS-SCEEEEEECCTTCHHHHHHHHHHHHTT-
T ss_pred             HHHHhCCCEEEECCcCCCCCCC--HHHHHHHHHHHHHHHHHHHHHhh--CC-CCcEEEEEcCCCCHHHHHHHHHHHHhc-
Confidence            3555567889999999998733  3332222         1222111  11 344568999999999999999998875 


Q ss_pred             CCCCcccccCCCc---ccccHHHHHHHHHhhccccCccccccC-Cccchh-hccCCCCceecccc---ccCCceeccCCc
Q psy15335        267 LSNADSSSINGKN---ELSNTSDIYSSMESDIHQSTHQEALII-NTDDVA-SKSSEKDTLYTKSS---EISDSLYKPRQY  338 (552)
Q Consensus       267 ~~~Fdg~AIGG~l---ek~~~~~Iv~~~~~~LP~~kPrHL~Gi-~P~dIf-aValGvDtFDcv~p---Ar~Gr~lt~~G~  338 (552)
                        +|+||||||+.   ++++|+++|.++++.||++|||||||+ +|++|+ +|++|||||||++|   ||+|++||++| 
T Consensus       215 --~~~GyaIGGlsvGe~~~~~~~~l~~~~~~LP~~kPRyLmGvG~P~~il~~V~~GvDmFDcv~Ptr~Ar~G~~lt~~G-  291 (381)
T 2ash_A          215 --GFDGYAIGGLSIGEERSLTLEMTEVTVEFLPEDKPRYFMGGGSPELILELVDRGVDMFDSVFPTRIARHGTALTWNG-  291 (381)
T ss_dssp             --CCSEEEECSCSSSSCHHHHHHHHHHHHTTSCTTSCEEECSCCCHHHHHHHHTTTCCEEEESHHHHHHHTTEEEETTE-
T ss_pred             --CCceEEecCcccCCCHHHHHHHHHHHHhhCCCCCcEEEcCCCCHHHHHHHHHcCCCEEeCChhhhhhcCceEeccCC-
Confidence              69999999963   778999999999999999999999999 999998 99999999999999   99999999999 


Q ss_pred             eEEecCCccccCCCCccCCCCCccCCCCCHHHHhhhhccCccchhhHHHhhhhhHHHhhhccCC
Q psy15335        339 EMWLQHPRYVTDFTPILAECECLTCQHHTRAYIHHLLNTKEMLAPVLLSICNSSNGVSINGDKN  402 (552)
Q Consensus       339 ~l~L~~~~y~~Df~PIde~C~C~tC~~yTRAYLhhL~ka~E~l~~rLLa~HNL~~~~~L~~~~r  402 (552)
                      +++|++++|+.||+|||++|+||||++|||||||||++++|+|+.+||++|||+++.+||+.||
T Consensus       292 ~i~l~~~~y~~D~~Pld~~C~C~tC~~ysRAYLhHL~~~~E~l~~~LltiHNl~~~~~l~~~iR  355 (381)
T 2ash_A          292 KLNLKASYNKRSLEPVDERCGCYTCKNFTRSYIHHLFDRGEVLGQILLTIHNINFMISLMKEVR  355 (381)
T ss_dssp             EEETTSGGGTTCCSCSCTTCCSHHHHHCCHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             ceEecchhhccCCCCCCCCCCCccCcccCHHHHHhhhccchhHHHHHHHHHHHHHHHHHHHHHH
Confidence            9999999999999999999999999999999999999999999999999999999999999998
>3bld_A Queuine tRNA-ribosyltransferase; TGT, PREQ1, glycosyltransferase, metal-binding, queuosine biosynthesis, tRNA processing; HET: PRF; 1.19A {Zymomonas mobilis} PDB: 3bl3_A* 1ozq_A* 1ozm_A* 1r5y_A* 1enu_A* 1f3e_A* 1k4h_A* 1n2v_A* 1p0b_A* 1p0d_A 1p0e_A* 1pud_A 1q2r_A* 1q2s_A* 1q4w_A* 1q63_A* 1q65_A* 1q66_A* 1k4g_A* 1s38_A* ... Back     alignment and structure
>1iq8_A Archaeosine tRNA-guanine transglycosylase; (alpha/beta)8 barrel, riken structural genomics/proteomics initiative, RSGI; 2.20A {Pyrococcus horikoshii} SCOP: b.122.1.1 c.1.20.1 d.17.6.1 PDB: 1it7_A* 1it8_A* 1j2b_A Back     alignment and structure
>2ash_A Queuine tRNA-ribosyltransferase; TM1561, tRNA-guanine, struc genomics, joint center for structural genomics, JCSG; 1.90A {Thermotoga maritima} Back     alignment and structure
>3bld_A Queuine tRNA-ribosyltransferase; TGT, PREQ1, glycosyltransferase, metal-binding, queuosine biosynthesis, tRNA processing; HET: PRF; 1.19A {Zymomonas mobilis} PDB: 3bl3_A* 1ozq_A* 1ozm_A* 1r5y_A* 1enu_A* 1f3e_A* 1k4h_A* 1n2v_A* 1p0b_A* 1p0d_A 1p0e_A* 1pud_A 1q2r_A* 1q2s_A* 1q4w_A* 1q63_A* 1q65_A* 1q66_A* 1k4g_A* 1s38_A* ... Back     alignment and structure
>1iq8_A Archaeosine tRNA-guanine transglycosylase; (alpha/beta)8 barrel, riken structural genomics/proteomics initiative, RSGI; 2.20A {Pyrococcus horikoshii} SCOP: b.122.1.1 c.1.20.1 d.17.6.1 PDB: 1it7_A* 1it8_A* 1j2b_A Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Back     alignment and structure
>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>1ydo_A HMG-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG,; 2.71A {Bacillus subtilis subsp} Back     alignment and structure
>3ble_A Citramalate synthase from leptospira interrogans; TIM barrel, licmsn, substrate specificity, acyltransferase, amino-acid biosynthesis; 2.00A {Leptospira interrogans} PDB: 3blf_A 3bli_A* Back     alignment and structure
>3s5o_A 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; beta barrel, schiff base, hydroxyproline metabolis; HET: KPI; 1.97A {Homo sapiens} SCOP: c.1.10.0 PDB: 3s5n_A Back     alignment and structure
>1xky_A Dihydrodipicolinate synthase; TIM barrel, , lysine biosynthesis;spine, lyase; 1.94A {Bacillus anthracis} SCOP: c.1.10.1 PDB: 1xl9_A 3hij_A* Back     alignment and structure
>3b4u_A Dihydrodipicolinate synthase; structural genomics, PSI-2, MC protein structure initiative, midwest center for structural genomics; 1.20A {Agrobacterium tumefaciens str} Back     alignment and structure
>3cpr_A Dihydrodipicolinate synthetase; (beta/alpha)8-barrel fold with A C-terminal alpha-helical segment, amino-acid biosynthesis, cytoplasm; HET: MCL; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>2nuw_A 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho aldolase; TIM barrel, lyase; 1.80A {Sulfolobus acidocaldarius dsm 639} PDB: 2nux_A 2nuy_A Back     alignment and structure
>2wkj_A N-acetylneuraminate lyase; directed evolution, sialic acid mimetics, aldolase, S base, carbohydrate metabolism, N-acetylneuraminic acid LYAS; HET: KPI PYR; 1.45A {Escherichia coli} PDB: 2wnq_A 2xfw_A* 2wpb_A* 2wnz_A* 2ygy_A* 2wo5_A* 2wnn_A* 3lbm_A 3lbc_A 3lcf_A 3lcl_A 3lcg_A 3lch_A 3lci_A 1hl2_A 1fdy_A 1fdz_A 1nal_1 3lcx_A 3lcw_A Back     alignment and structure
>1f6k_A N-acetylneuraminate lyase; beta barrel; 1.60A {Haemophilus influenzae} SCOP: c.1.10.1 PDB: 1f5z_A 1f6p_A 1f73_A* 1f74_A* 1f7b_A* Back     alignment and structure
>3a5f_A Dihydrodipicolinate synthase; TIM barrel, enzyme, amino-acid biosynthesis, cytoplasm, diaminopimelate biosynthesis, lyase; HET: KPI; 1.19A {Clostridium botulinum A} PDB: 3bi8_A* 3ird_A* Back     alignment and structure
>3ewb_X 2-isopropylmalate synthase; LEUA, structural genomics, unknown function, amino-acid biosynthesis; 2.10A {Listeria monocytogenes str} Back     alignment and structure
>2ehh_A DHDPS, dihydrodipicolinate synthase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1rqb_A Transcarboxylase 5S subunit; TIM-barrel, carbamylated lysine, transfera; HET: KCX; 1.90A {Propionibacterium freudenreichii subspshermanii} SCOP: a.5.7.2 c.1.10.5 PDB: 1rqe_A 1rqh_A* 1rr2_A* 1u5j_A* 1s3h_A* Back     alignment and structure
>2cw6_A Hydroxymethylglutaryl-COA lyase, mitochondrial; HMG-COA lyase, ketogenic enzyme; HET: 3HG; 2.10A {Homo sapiens} PDB: 3mp3_A* 3mp4_A 3mp5_A* Back     alignment and structure
>2yxg_A DHDPS, dihydrodipicolinate synthase; MJ0244, TIM beta/alpha-barrel fold, structural genomics, NPPSFA; 2.20A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>1w3i_A EDA, 2-keto-3-deoxy gluconate aldolase; archaeal metabolism, pyruvate; 1.7A {Sulfolobus solfataricus} SCOP: c.1.10.1 PDB: 1w37_A 1w3n_A* 1w3t_A* 2yda_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 552
d1r5ya_372 c.1.20.1 (A:) Queosine tRNA-guanine transglycosyla 6e-15
d1r5ya_372 c.1.20.1 (A:) Queosine tRNA-guanine transglycosyla 2e-13
d1iq8a1355 c.1.20.1 (A:6-360) Archaeosine tRNA-guanine transg 4e-06
d1iq8a1355 c.1.20.1 (A:6-360) Archaeosine tRNA-guanine transg 3e-04
d1iq8a1355 c.1.20.1 (A:6-360) Archaeosine tRNA-guanine transg 0.003
>d1r5ya_ c.1.20.1 (A:) Queosine tRNA-guanine transglycosylase {Zymomonas mobilis [TaxId: 542]} Length = 372 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: tRNA-guanine transglycosylase
family: tRNA-guanine transglycosylase
domain: Queosine tRNA-guanine transglycosylase
species: Zymomonas mobilis [TaxId: 542]

 Score = 74.1 bits (181), Expect = 6e-15
 Identities = 19/49 (38%), Positives = 31/49 (63%)

Query: 342 LQHPRYVTDFTPILAECECLTCQHHTRAYIHHLLNTKEMLAPVLLSICN 390
           +++ R+  D  P+ +EC C  CQ  +RAYIHHL+   E+L  +L++  N
Sbjct: 292 IRNARFSEDLKPLDSECHCAVCQKWSRAYIHHLIRAGEILGAMLMTEHN 340
>d1r5ya_ c.1.20.1 (A:) Queosine tRNA-guanine transglycosylase {Zymomonas mobilis [TaxId: 542]} Length = 372 Back     information, alignment and structure
>d1iq8a1 c.1.20.1 (A:6-360) Archaeosine tRNA-guanine transglycosylase, N-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 355 Back     information, alignment and structure
>d1iq8a1 c.1.20.1 (A:6-360) Archaeosine tRNA-guanine transglycosylase, N-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 355 Back     information, alignment and structure
>d1iq8a1 c.1.20.1 (A:6-360) Archaeosine tRNA-guanine transglycosylase, N-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 355 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query552
d1r5ya_372 Queosine tRNA-guanine transglycosylase {Zymomonas 100.0
d1iq8a1355 Archaeosine tRNA-guanine transglycosylase, N-termi 100.0
d1r5ya_372 Queosine tRNA-guanine transglycosylase {Zymomonas 99.95
d1iq8a1355 Archaeosine tRNA-guanine transglycosylase, N-termi 99.94
d1nvma2289 4-hydroxy-2-oxovalerate aldolase DmpG, catalytic d 91.76
d1xkya1292 Dihydrodipicolinate synthase {Bacillus anthracis [ 90.08
d1rqba2303 Transcarboxylase 5S subunit, N-terminal domain {Pr 89.28
d1hl2a_295 N-acetylneuraminate lyase {Escherichia coli [TaxId 83.41
d1xxxa1296 Dihydrodipicolinate synthase {Mycobacterium tuberc 82.6
d1o5ka_295 Dihydrodipicolinate synthase {Thermotoga maritima 80.48
d1f74a_293 N-acetylneuraminate lyase {Haemophilus influenzae 80.38
>d1r5ya_ c.1.20.1 (A:) Queosine tRNA-guanine transglycosylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: tRNA-guanine transglycosylase
family: tRNA-guanine transglycosylase
domain: Queosine tRNA-guanine transglycosylase
species: Zymomonas mobilis [TaxId: 542]

Probab=100.00  E-value=1.8e-46  Score=386.14  Aligned_cols=204  Identities=15%  Similarity=0.194  Sum_probs=177.6

Q ss_pred             cccccccceeeecccccccccccccc-------ccchhhhhhcccCc--ccccceeeecccCCCCCccccccccccccCC
Q psy15335        196 HQSTHQEALIINTDDVASKSSEKDTL-------YTKSSEISDSLYKP--RQYEMWLQHPSINGKNGVSNEDSSSTNGENG  266 (552)
Q Consensus       196 ~~~~~~~~~~~~~~~~~~~~~~~~~~-------~~r~~e~~~~~~~~--r~~~~~~v~piqgG~~~~l~~~sa~~~~~~~  266 (552)
                      -|..-+-|+++.+|+|++....+++.       .+++++..+...+.  ..+..++.+++|||.+.++++.|++...+. 
T Consensus       133 ~q~~ig~DI~~~Ldd~~~~~~~~~~~~~~~~rt~~w~~~~~~~~~~~~~~~~~~~lfgivqGg~~~dlR~~s~~~l~~~-  211 (372)
T d1r5ya_         133 IQHLLGSDIVMAFDECTPYPATPSRAASSMERSMRWAKRSRDAFDSRKEQAENAALFGIQQGSVFENLRQQSADALAEI-  211 (372)
T ss_dssp             HHHHHTCSEEECCCCCCCSSCCHHHHHHHHHHHHHHHHHHHHHHHTSHHHHHHCEEEEEECCTTCHHHHHHHHHHHHHH-
T ss_pred             HHHhhCCceEeeccccccccchhHHHHHHHHHHHHHHHHHHHHHhcccccCcccceecccccchhhhHHHHHHHHHHhh-
Confidence            46666789999999999887655432       22223332221111  123357779999999999999999998874 


Q ss_pred             CCCCcccccCCCc---ccccHHHHHHHHHhhccccCccccccC-Cccchh-hccCCCCceecccc---ccCCceeccCCc
Q psy15335        267 LSNADSSSINGKN---ELSNTSDIYSSMESDIHQSTHQEALII-NTDDVA-SKSSEKDTLYTKSS---EISDSLYKPRQY  338 (552)
Q Consensus       267 ~~~Fdg~AIGG~l---ek~~~~~Iv~~~~~~LP~~kPrHL~Gi-~P~dIf-aValGvDtFDcv~p---Ar~Gr~lt~~G~  338 (552)
                        +|+||||||+.   +++++.++|.++++.||++|||||||+ +|++|+ +|++|||+|||++|   ||+|++||.+| 
T Consensus       212 --~~~G~aiGgl~~~~~~~~~~~~v~~~~~~Lp~~kPr~l~Gvg~P~~il~~V~~GvD~FD~~~p~r~Ar~G~alt~~g-  288 (372)
T d1r5ya_         212 --GFDGYAVGGLAVGEGQDEMFRVLDFSVPMLPDDKPHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTWDG-  288 (372)
T ss_dssp             --CCSEEEECSCSSSSCHHHHHHHHHHHGGGSCTTSCEEETTCCSHHHHHHHHTTTCCEEECSHHHHHHHTTEECCTTC-
T ss_pred             --ccCceeccccccCcchHHHHHHHHhcccccccccceeecCCCCHHHHHHhhccCCCcccccccchhhhccceEecCC-
Confidence              69999999984   778999999999999999999999999 999998 99999999999999   99999999999 


Q ss_pred             eEEecCCccccCCCCccCCCCCccCCCCCHHHHhhhhccCccchhhHHHhhhhhHHHhhhccCCC
Q psy15335        339 EMWLQHPRYVTDFTPILAECECLTCQHHTRAYIHHLLNTKEMLAPVLLSICNSSNGVSINGDKNG  403 (552)
Q Consensus       339 ~l~L~~~~y~~Df~PIde~C~C~tC~~yTRAYLhhL~ka~E~l~~rLLa~HNL~~~~~L~~~~r~  403 (552)
                      +++|++.+|+.||+||+++|.||||++|||||||||++++|+++.+||++|||+++.+||+.||.
T Consensus       289 ~~~l~~~~~~~d~~Pl~~~C~C~~C~~~sraYl~HL~~~~E~l~~~Ll~iHNl~~~~~~~~~iR~  353 (372)
T d1r5ya_         289 PINIRNARFSEDLKPLDSECHCAVCQKWSRAYIHHLIRAGEILGAMLMTEHNIAFYQQLMQKIRD  353 (372)
T ss_dssp             CEETTSGGGTTCCSCSSSSCCSHHHHHCCHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             ceeeccccccccCCCcCCCCCChhhcccCHHHHHHHhhCCchHHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999993
>d1iq8a1 c.1.20.1 (A:6-360) Archaeosine tRNA-guanine transglycosylase, N-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1r5ya_ c.1.20.1 (A:) Queosine tRNA-guanine transglycosylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1iq8a1 c.1.20.1 (A:6-360) Archaeosine tRNA-guanine transglycosylase, N-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nvma2 c.1.10.5 (A:2-290) 4-hydroxy-2-oxovalerate aldolase DmpG, catalytic domain {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1rqba2 c.1.10.5 (A:4-306) Transcarboxylase 5S subunit, N-terminal domain {Propionibacterium freudenreichii shermanii [TaxId: 1752]} Back     information, alignment and structure
>d1hl2a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xxxa1 c.1.10.1 (A:5-300) Dihydrodipicolinate synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1o5ka_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1f74a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure