Psyllid ID: psy1534


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------
MTSPVTETELVEQIAHQDFPMFQRIETGAPLEVPVVMDLIQGDASLYQISHLSTVGDVTYVEILNDDTGKPRGSAIVEFQSPDLVRKAVNKMHRFETKGRKLVIKEAVEDKGGRRNMGGGGGVDRDLSALLQNNSSKFGNTYGLSPQFLESLGINCPLINKVFVANLDYKVDEKKLREVFRLAGKVENVEIALDKDGKSRGFGTVEFDHPVEAVQSISMLNNQNLFERRITVRMDRVADRLDGPVRLPEGLKSIGMGLGANGAPLQDVANWLLQEKVQKLSLIISNRNTKEVLERWDFKLQYDKSSDENDAASVNTASKTDSTNAEKDKIGNLPNMNTNPTPTASVSTPAALAAAVTALTQAQQPPPPQPSLGNLGLNLGLGGAANDLTSNLTSTLTSLAAANQNTAYPLNQLSSQSGLGQSNILSGMAAYSQGMQSQTSSLSSGNNVYSNQSAPSTDYSRNASNMYGNSRYGSGGNEMDYGGGSGQASIQSGGYGNPRAGLDSNRSMNQSSNIERDTVVVKNLPPTITWQELRDKFRNCGDIKFAEIKGKGDIGLVRFDSEWTAKRAIDMMDRTRIDGKIIDVTFF
ccccccccHHHHHHHHcccccccccccccccccEEEEccccccccHHHHHHccccccEEEEEEEEccccccccEEEEEEccHHHHHHHHHHHccccccccEEEEEEccccccccccccccccccccHHHHHccccccccccccccccHHcccccccccccEEEEEcccccccHHHHHHHHHccccEEEEEEEEccccccEEEEEEEEccHHHHHHHHHHHcccccccEEEEEEccccccccccccccccccccccccccccccccccHHHHHHHHHHHccHHHccccHHHHHHHHccccccccccccccccccccccccccccHHHHHHccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccEEEEEEEccccEEEEEEccHHHHHHHHHHHcccccccEEEEEEEc
ccccccccccEEEEcccccccccccccccccEEEEEEcccccHHHHHHHHHHcccccEEEEEEEEccccccccEEEEEcccHHHHHHHHHHHccccccccEEEEEcccccHHHHHHHHHHcccccccccccccccccccccccccHHHHHHccccccccEEEEEEcccccccHHHHHHHHcccccEEEEEEEEccccccccEEEEEcccHHHHHHHHHHHcccccccccEEEEEcccccHHHHHHHHHHHHHHHHHccccccEEEEcccccccHHHHHHHHHHccccccccccccccccEEcccccccccccccccccccccccccHHHHccccccccccccccccccHHHHHHccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccHHHHHHHHHHcccEEEEEEEcccccEEEEEccHHHHHHHHHHHccccEccEEEEEEEc
MTSPVTETELVEQIahqdfpmfqrietgaplevpVVMDLIQGDASLYQISHLSTVGDVTYVEIlnddtgkprgsaivefqspdlVRKAVNKMHRFETKGRKLVIKEAVedkggrrnmgggggvdrDLSALLQnnsskfgntyglspqfleslgincplinKVFVANLDYKVDEKKLREVFRLAGKVENVEialdkdgksrgfgtvefdhpveAVQSISMLNNQNLFERRITVRMDRvadrldgpvrlpeglksigmglgangaplQDVANWLLQEKVQKLSLIISNRNTKEVLERWDFKlqydkssdendaasvntasktdstnaekdkignlpnmntnptptasvstPAALAAAVTALtqaqqppppqpslgnlglnlglggaandLTSNLTSTLTSLAAAnqntayplnqlssqsglgqsnILSGMAAYsqgmqsqtsslssgnnvysnqsapstdysrnasnmygnsrygsggnemdygggsgqasiqsggygnpragldsnrsmnqssnierdtvvvknlpptitWQELRDKFRncgdikfaeikgkgdiglvrfdseWTAKRAIDMMdrtridgkiidvtff
MTSPVTETELVEQIAHQDFPMFQRIETGAPLEVPVVMDLIQGDASLYQISHLSTVGDVTYVEILNddtgkprgsaivefqspdlvrkAVNKMhrfetkgrklvikeavedkggrrnmgggggvdRDLSALLQNNSSKFGNTYGLSPQFLESLGINCPLINKVFVANLDYKVDEKKLREVFrlagkvenveialdkdgksrgFGTVEFDHPVEavqsismlnnqnlferRITVRMdrvadrldgpvrlPEGLKSIGMGLGANGAPLQDVANWLLQEKVQKLsliisnrntkevlERWDFKLQydkssdendaasvntasktdstnaekdkignlpnmntnPTPTASVSTPAALAAAVTALTQAQQPPPPQPSLGNLGLNLGLGGAANDLTSNLTSTLTSLAAANQNTAYPLNQLSSQSGLGQSNILSGMAAYSQGMQSQTSSLSSGNNVYSNQSAPSTDYSRNASNMYGNSRYGSGGNEMDYGGGSGQASIQSGGYGNPRAGLDSNRSMNQssnierdtvvvknlpptitwqelrDKFRNCGDIKfaeikgkgdiglvrfdsewTAKRAidmmdrtridgkiidvtff
MTSPVTETELVEQIAHQDFPMFQRIETGAPLEVPVVMDLIQGDASLYQISHLSTVGDVTYVEILNDDTGKPRGSAIVEFQSPDLVRKAVNKMHRFETKGRKLVIKEAVEDKggrrnmgggggVDRDLSALLQNNSSKFGNTYGLSPQFLESLGINCPLINKVFVANLDYKVDEKKLREVFRLAGKVENVEIALDKDGKSRGFGTVEFDHPVEAVQSISMLNNQNLFERRITVRMDRVADRLDGPVRLPEGLKSIGMGLGANGAPLQDVANWLLQEKVQKLSLIISNRNTKEVLERWDFKLQYDKSSDENDAASVNTASKTDSTNAEKDKIGNLpnmntnptptasvstpaalaaavtaltqaqqppppqpslgnlglnlglggaandltsnltstltslaaanQNTAYPlnqlssqsglgqsnilsgMAAYSQGMQSQTSSLSSGNNVYSNQSAPSTDYSRNASNMYGNSRYGSGGNEMDygggsgqasiqsggygNPRAGLDSNRSMNQSSNIERDTVVVKNLPPTITWQELRDKFRNCGDIKFAEIKGKGDIGLVRFDSEWTAKRAIDMMDRTRIDGKIIDVTFF
**********VEQIAHQDFPMFQRIETGAPLEVPVVMDLIQGDASLYQISHLSTVGDVTYVEILNDDTG****SAIVEFQSPDLVRKAVNK**********************************************FGNTYGLSPQFLESLGINCPLINKVFVANLDYKVDEKKLREVFRLAGKVENVEIALDKDGKSRGFGTVEFDHPVEAVQSISMLNNQNLFERRITVRMDRVADRLDGPVRLPEGLKSIGMGLGANGAPLQDVANWLLQEKVQKLSLIISNRNTKEVLERWDFKLQY****************************************************************************LGL****************************************************************************************************************************************TVVVKNLPPTITWQELRDKFRNCGDIKFAEIKGKGDIGLVRFDSEWTAKRAIDMMDRTRIDGKIIDVTF*
**********************************VVMDLIQGDASLYQISHLSTVGDVTYVEILNDDTGKPRGSAIVEFQSPDLVRKAVNKMHRFETKGRKLVIK***************************************************PLINKVFVANLDYKVDEKKLREVFRLAGKVENVEIALDKDGKSRGFGTVEFDHPVEAVQSISMLNNQNLFERRITVR***************************************************************DF*********************************************************************************************************QNTAYPLNQLSSQSGLGQSNILSGMAAYSQGMQSQTSSLSSGNNVYSN***********************GGNEMDYG****************************SSNIERDTVVVKNLPPTITWQELRDKFRNCGDIKFAEIKGKGDIGLVRFDSEWTAKRAIDMMDRTRIDGKIIDVTFF
*********LVEQIAHQDFPMFQRIETGAPLEVPVVMDLIQGDASLYQISHLSTVGDVTYVEILNDDTGKPRGSAIVEFQSPDLVRKAVNKMHRFETKGRKLVIKEAVEDKGGRRNMGGGGGVDRDLSALLQNNSSKFGNTYGLSPQFLESLGINCPLINKVFVANLDYKVDEKKLREVFRLAGKVENVEIALDKDGKSRGFGTVEFDHPVEAVQSISMLNNQNLFERRITVRMDRVADRLDGPVRLPEGLKSIGMGLGANGAPLQDVANWLLQEKVQKLSLIISNRNTKEVLERWDFKLQYDK**********************KDKIGNLPNMNTNPTPTASVSTPAALAAAVTALTQAQQPPPPQPSLGNLGLNLGLGGAANDLTSNLTSTLTSLAAANQNTAYPLNQLSSQSGLGQSNILSGMAAY**************************DYSRNASNMYGNSRYGSGGNEMDYGGGSGQASIQSGGYGNPRAGLDSNRSMNQSSNIERDTVVVKNLPPTITWQELRDKFRNCGDIKFAEIKGKGDIGLVRFDSEWTAKRAIDMMDRTRIDGKIIDVTFF
********ELVEQIA***FP*F*R**TGAPLEVPVVMDLIQGDASLYQISHLSTVGDVTYVEILNDDTGKPRGSAIVEFQSPDLVRKAVNKMHRFETKGRKLVIKEAVED*G*RRN************************TYGLSPQFLESLGINCPLINKVFVANLDYKVDEKKLREVFRLAGKVENVEIALDKDGKSRGFGTVEFDHPVEAVQSISMLNNQNLFERRITVRMDRVADRLDGPVRLPEGLKSIGMGLGANGAPLQDVANWLLQEKVQKLSLIISNRNTKEVLERWDFKLQYD******DAAS****SKTDSTNAEKDKIGNLPNMNTNPTPTASVSTPAALAAAVTALTQAQQPPPPQPSLGNLGLNLGLGGAANDLTSNLTSTLTSLAAANQNTAYPLNQLSSQSGLGQSNILSGMAAYSQGMQSQTSSLSSGNNVYSNQSAPSTDYSRNASN*************************************************ERDTVVVKNLPPTITWQELRDKFRNCGDIKFAEIKGKGDIGLVRFDSEWTAKRAIDMMDRTRIDGKIIDVTFF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSPVTETELVEQIAHQDFPMFQRIETGAPLEVPVVMDLIQGDASLYQISHLSTVGDVTYVEILNDDTGKPRGSAIVEFQSPDLVRKAVNKMHRFETKGRKLVIKEAVEDKGGRRNMGGGGGVDRDLSALLQNNSSKFGNTYGLSPQFLESLGINCPLINKVFVANLDYKVDEKKLREVFRLAGKVENVEIALDKDGKSRGFGTVEFDHPVEAVQSISMLNNQNLFERRITVRMDRVADRLDGPVRLPEGLKSIGMGLGANGAPLQDVANWLLQEKVQKLSLIISNRNTKEVLERWDFKLQYDKSSDENDAASVNTASKTDSTNAEKDKIGNLPNMNTNPTPTASVSTPAALAAAVTALTQAQQPPPPQPSLGNLGLNLGLGGAANDLTSNLTSTLTSLAAANQNTAYPLNQLSSQSGLGQSNILSGMAAYSQGMQSQTSSLSSGNNVYSNQSAPSTDYSRNASNMYGNSRYGSGGNEMDYGGGSGQASIQSGGYGNPRAGLDSNRSMNQSSNIERDTVVVKNLPPTITWQELRDKFRNCGDIKFAEIKGKGDIGLVRFDSEWTAKRAIDMMDRTRIDGKIIDVTFF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query587 2.2.26 [Sep-21-2011]
Q9P2K5600 Myelin expression factor yes N/A 0.306 0.3 0.446 7e-34
Q8C854591 Myelin expression factor yes N/A 0.306 0.304 0.430 3e-32
Q62826690 Heterogeneous nuclear rib no N/A 0.253 0.215 0.418 7e-29
P52272730 Heterogeneous nuclear rib no N/A 0.301 0.242 0.415 2e-28
Q9D0E1729 Heterogeneous nuclear rib no N/A 0.304 0.245 0.404 9e-28
Q9P3U1464 Uncharacterized RNA-bindi yes N/A 0.284 0.359 0.290 5e-14
Q6BI95627 Polyadenylate-binding pro yes N/A 0.270 0.253 0.255 6e-11
Q08937291 29 kDa ribonucleoprotein N/A N/A 0.284 0.573 0.311 2e-10
A3LXL0632 Polyadenylate-binding pro yes N/A 0.277 0.257 0.255 3e-10
P31209653 Polyadenylate-binding pro no N/A 0.262 0.235 0.262 3e-10
>sp|Q9P2K5|MYEF2_HUMAN Myelin expression factor 2 OS=Homo sapiens GN=MYEF2 PE=1 SV=3 Back     alignment and function desciption
 Score =  145 bits (367), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 83/186 (44%), Positives = 116/186 (62%), Gaps = 6/186 (3%)

Query: 55  VGDVTYVEILNDDTGKPRGSAIVEFQSPDLVRKAVNKMHRFETKGRKLVIKEAVEDKGGR 114
           VG+VTYVE+  D  GK RG  +VEF+  + V+KA+  M++++  GR L IKE  + +  R
Sbjct: 124 VGEVTYVELFKDAEGKSRGCGVVEFKDEEFVKKALETMNKYDLSGRPLNIKEDPDGENAR 183

Query: 115 RNM---GGG--GGVDRDLSALLQNNSSKFGNTYGLSPQFLESLGINCPLINKVFVANLDY 169
           R +   GG   GG   D+ + L N      N   + P+ + +L     L + +FVANLD+
Sbjct: 184 RALQRTGGSFPGGHVPDMGSGLMNLPPSILNNPNIPPEVISNLQAGR-LGSTIFVANLDF 242

Query: 170 KVDEKKLREVFRLAGKVENVEIALDKDGKSRGFGTVEFDHPVEAVQSISMLNNQNLFERR 229
           KV  KKL+EVF +AG V+  +I  DKDGKSRG GTV F+  +EAVQ+ISM N Q LF+R 
Sbjct: 243 KVGWKKLKEVFSIAGTVKRADIKEDKDGKSRGMGTVTFEQAIEAVQAISMFNGQFLFDRP 302

Query: 230 ITVRMD 235
           + V+MD
Sbjct: 303 MHVKMD 308




Transcriptional repressor of the myelin basic protein gene (MBP). Binds to the proximal MB1 element 5'-TTGTCC-3' of the MBP promoter. Its binding to MB1 and function are inhibited by PURA.
Homo sapiens (taxid: 9606)
>sp|Q8C854|MYEF2_MOUSE Myelin expression factor 2 OS=Mus musculus GN=Myef2 PE=1 SV=1 Back     alignment and function description
>sp|Q62826|HNRPM_RAT Heterogeneous nuclear ribonucleoprotein M OS=Rattus norvegicus GN=Hnrnpm PE=1 SV=4 Back     alignment and function description
>sp|P52272|HNRPM_HUMAN Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens GN=HNRNPM PE=1 SV=3 Back     alignment and function description
>sp|Q9D0E1|HNRPM_MOUSE Heterogeneous nuclear ribonucleoprotein M OS=Mus musculus GN=Hnrnpm PE=1 SV=3 Back     alignment and function description
>sp|Q9P3U1|YKX5_SCHPO Uncharacterized RNA-binding protein C328.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC328.05 PE=4 SV=3 Back     alignment and function description
>sp|Q6BI95|PABP_DEBHA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAB1 PE=3 SV=2 Back     alignment and function description
>sp|Q08937|ROC2_NICSY 29 kDa ribonucleoprotein B, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 Back     alignment and function description
>sp|A3LXL0|PABP_PICST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAB1 PE=3 SV=1 Back     alignment and function description
>sp|P31209|PABP_SCHPO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pab1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query587
50880296525 Hrp59 protein [Chironomus tentans] 0.761 0.851 0.391 2e-80
345494637559 PREDICTED: myelin expression factor 2-li 0.778 0.817 0.401 1e-79
242016244508 Nuclear and cytoplasmic polyadenylated R 0.359 0.415 0.589 1e-64
357619139514 Hrp59 protein [Danaus plexippus] 0.364 0.416 0.536 2e-60
91076808573 PREDICTED: similar to Hrp59 CG9373-PA [T 0.359 0.368 0.537 2e-59
193697751490 PREDICTED: myelin expression factor 2-li 0.361 0.432 0.531 6e-58
383855600542 PREDICTED: myelin expression factor 2-li 0.367 0.398 0.556 1e-57
328784140544 PREDICTED: myelin expression factor 2 [A 0.367 0.397 0.56 2e-57
340714953546 PREDICTED: myelin expression factor 2-li 0.367 0.395 0.553 3e-57
350402014546 PREDICTED: myelin expression factor 2-li 0.367 0.395 0.553 4e-57
>gi|50880296|emb|CAH05070.1| Hrp59 protein [Chironomus tentans] Back     alignment and taxonomy information
 Score =  306 bits (784), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 221/564 (39%), Positives = 299/564 (53%), Gaps = 117/564 (20%)

Query: 55  VGDVTYVEILNDDTGKPRGSAIVEFQSPDLVRKAVNKMHRFETKGRKLVIKEAVEDKGGR 114
           VG+V +VE+ ND++GKPRG  I+EF S D VR A++KM+R++  GR LVIKE   D G  
Sbjct: 48  VGEVAFVELFNDESGKPRGCGIIEFVSADSVRIALDKMNRYDLSGRNLVIKE---DSGNE 104

Query: 115 RNMGG------GGGVDRDLSALLQNNSSKFG-----------------NTYGLSPQFLES 151
           R+  G      G            N+SS+                   NTYGLS +FLE 
Sbjct: 105 RDKYGFVIKPQGSYRRDRDDDRSYNDSSRSHGGGGNNHGNNSSNLENFNTYGLSVKFLEG 164

Query: 152 LGIN-CPLINKVFVANLDYKVDEKKLREVFRLAGKVENVEIALDKDGKSRGFGTVEFDHP 210
           LGI   PL NKVFVANLDYKVD KKL++VF+LAGKV +V+++LDKDG SRGF  VE+DHP
Sbjct: 165 LGITQGPLHNKVFVANLDYKVDAKKLKQVFKLAGKVLSVDLSLDKDGNSRGFAVVEYDHP 224

Query: 211 VEAVQSISMLNNQNLFERRITVRMDRVADRLDGPVRLPEGLKSIGMGLGANGAPLQDVAN 270
           VEAVQSISM + Q LF+RR+TVR+DR+ D+ +G V+LPEGLKS+G+GLG NG PL+DVA 
Sbjct: 225 VEAVQSISMFDRQTLFDRRMTVRLDRIPDKSEG-VKLPEGLKSVGIGLGPNGEPLRDVA- 282

Query: 271 WLLQEKVQKLSLIISNRNTKEVLERWDFKLQYDKSSDENDAASVNTASKTDSTNAEKDKI 330
                           RN   +                               N  ++ +
Sbjct: 283 ----------------RNLPNL-----------------------------QNNPSQNSM 297

Query: 331 GNLPNMNTNPTPTASVSTPAALAAAVTALTQAQQPPP---PQPSLGNLGLNLGLGGAAND 387
            NL   NTN  P +S+S          +L Q   P P   PQ        N  L G   +
Sbjct: 298 SNL---NTNINPLSSLS---------NSLNQLTTPTPVAAPQ--------NSSLLGVPTN 337

Query: 388 LTSNLTSTLTSLAAANQNTAYPLNQLSSQSGLGQSNILSGMAAYSQGMQSQTSSLSSGNN 447
                 S L+ LAA  QN    L  L   S L  + +LS  AA    + S   +L++ N 
Sbjct: 338 ------SNLSGLAAL-QNVVGGLTSLGGVSALSANPLLSSAAA---SLNSLGLNLTASNQ 387

Query: 448 VYSNQSAPSTDYSRNASNMYGNSRYGSGGNEMD---YGGGSGQ-ASIQSGGYGNPRAGLD 503
              NQ A     ++++ N Y  S + +G    D   +GG   +  +  +  Y N R    
Sbjct: 388 NDVNQ-AQQQSMNQSSFNAYNTSGFNTGNRNDDMPSFGGNQIRNYNTSNDDYNNSRNFGG 446

Query: 504 SNRSMNQSSNIERDTVVVKNLPPTITWQELRDKFRNCGDIKFAEIKGKGDIGLVRFDSEW 563
           S+ S  Q S    DT++V+NLP + TWQ LRDKFR+ G++KFAEI+G  D G+VRF  E 
Sbjct: 447 SSSSRKQQS----DTILVRNLPSSWTWQNLRDKFRDVGEVKFAEIRGL-DTGVVRFSKER 501

Query: 564 TAKRAIDMMDRTRIDGKIIDVTFF 587
            A  AI ++D +R DG+++++ +F
Sbjct: 502 EADVAIKLLDGSRFDGRVVEIDYF 525




Source: Chironomus tentans

Species: Chironomus tentans

Genus: Chironomus

Family: Chironomidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|345494637|ref|XP_001603370.2| PREDICTED: myelin expression factor 2-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|242016244|ref|XP_002428739.1| Nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1, putative [Pediculus humanus corporis] gi|212513424|gb|EEB16001.1| Nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|357619139|gb|EHJ71829.1| Hrp59 protein [Danaus plexippus] Back     alignment and taxonomy information
>gi|91076808|ref|XP_974319.1| PREDICTED: similar to Hrp59 CG9373-PA [Tribolium castaneum] gi|270001929|gb|EEZ98376.1| hypothetical protein TcasGA2_TC000835 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|193697751|ref|XP_001948840.1| PREDICTED: myelin expression factor 2-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|383855600|ref|XP_003703298.1| PREDICTED: myelin expression factor 2-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|328784140|ref|XP_395436.3| PREDICTED: myelin expression factor 2 [Apis mellifera] Back     alignment and taxonomy information
>gi|340714953|ref|XP_003395986.1| PREDICTED: myelin expression factor 2-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350402014|ref|XP_003486336.1| PREDICTED: myelin expression factor 2-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query587
FB|FBgn0260010632 rump "rumpelstiltskin" [Drosop 0.231 0.215 0.659 1.4e-84
UNIPROTKB|F1NIP6541 MYEF2 "Uncharacterized protein 0.354 0.384 0.413 1.3e-49
UNIPROTKB|Q5ZHY2616 MYEF2 "Uncharacterized protein 0.354 0.337 0.413 1.2e-48
UNIPROTKB|F1PIL7492 MYEF2 "Uncharacterized protein 0.357 0.426 0.408 1.4e-48
UNIPROTKB|F1SN63533 MYEF2 "Uncharacterized protein 0.357 0.393 0.408 1.4e-48
UNIPROTKB|A6QQP0543 MYEF2 "MYEF2 protein" [Bos tau 0.356 0.384 0.406 1.4e-48
UNIPROTKB|Q9P2K5600 MYEF2 "Myelin expression facto 0.357 0.35 0.408 2.4e-48
ZFIN|ZDB-GENE-051120-114557 myef2 "myelin expression facto 0.362 0.382 0.410 5.1e-48
UNIPROTKB|D4AB08567 Myef2 "Protein Myef2" [Rattus 0.357 0.370 0.408 7.6e-48
UNIPROTKB|D4A1T2574 Myef2 "Protein Myef2" [Rattus 0.357 0.365 0.408 9.4e-48
FB|FBgn0260010 rump "rumpelstiltskin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 478 (173.3 bits), Expect = 1.4e-84, Sum P(3) = 1.4e-84
 Identities = 91/138 (65%), Positives = 118/138 (85%)

Query:   133 NNSSKFGNTYGLSPQFLESLGINCPLINKVFVANLDYKVDEKKLREVFRLAGKVENVEIA 192
             NNSS + N YGLS  FLESLGI+ PL NKVFVANLDYKVD KKL++VF+LAGKV++V+++
Sbjct:   206 NNSSNY-NLYGLSASFLESLGISGPLHNKVFVANLDYKVDNKKLKQVFKLAGKVQSVDLS 264

Query:   193 LDKDGKSRGFGTVEFDHPVEAVQSISMLNNQNLFERRITVRMDRVADRLDGPVRLPEGLK 252
             LDK+G SRGF  +E+DHPVEAVQ+ISML+ Q LF+RR+TVR+DR+ D+ +G ++LPEGL 
Sbjct:   265 LDKEGNSRGFAVIEYDHPVEAVQAISMLDRQMLFDRRMTVRLDRIPDKNEG-IKLPEGLG 323

Query:   253 SIGMGLGANGAPLQDVAN 270
              +G+GLG NG PL+DVA+
Sbjct:   324 GVGIGLGPNGEPLRDVAH 341


GO:0003729 "mRNA binding" evidence=ISS;IDA
GO:0003730 "mRNA 3'-UTR binding" evidence=IDA;TAS
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005634 "nucleus" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0008298 "intracellular mRNA localization" evidence=IMP
GO:0008595 "anterior/posterior axis specification, embryo" evidence=IMP
GO:0007067 "mitosis" evidence=IMP
GO:0035282 "segmentation" evidence=IGI
GO:0030529 "ribonucleoprotein complex" evidence=IDA
GO:0007277 "pole cell development" evidence=IGI
GO:0009952 "anterior/posterior pattern specification" evidence=IGI
GO:0045451 "pole plasm oskar mRNA localization" evidence=IGI
UNIPROTKB|F1NIP6 MYEF2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZHY2 MYEF2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1PIL7 MYEF2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SN63 MYEF2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|A6QQP0 MYEF2 "MYEF2 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9P2K5 MYEF2 "Myelin expression factor 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-051120-114 myef2 "myelin expression factor 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|D4AB08 Myef2 "Protein Myef2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D4A1T2 Myef2 "Protein Myef2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query587
cd1238674 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 1e-39
cd1265976 cd12659, RRM2_hnRNPM, RNA recognition motif 2 in v 3e-25
cd1266076 cd12660, RRM2_MYEF2, RNA recognition motif 2 in ve 4e-25
cd1238576 cd12385, RRM1_hnRNPM_like, RNA recognition motif 1 1e-19
smart0036073 smart00360, RRM, RNA recognition motif 2e-18
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 7e-18
cd1238772 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 3e-17
cd1233675 cd12336, RRM_RBM7_like, RNA recognition motif in R 4e-17
cd1238772 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 8e-16
smart0036073 smart00360, RRM, RNA recognition motif 1e-14
pfam0007670 pfam00076, RRM_1, RNA recognition motif 1e-14
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 2e-14
cd1266277 cd12662, RRM3_MYEF2, RNA recognition motif 3 in ve 6e-14
cd1233971 cd12339, RRM2_SRSF1_4_like, RNA recognition motif 8e-14
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 3e-13
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 3e-13
pfam0007670 pfam00076, RRM_1, RNA recognition motif 4e-13
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 5e-13
cd1266177 cd12661, RRM3_hnRNPM, RNA recognition motif 3 in v 1e-12
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 1e-12
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 2e-12
cd1259375 cd12593, RRM_RBM11, RNA recognition motif in verte 2e-12
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 1e-11
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 1e-11
cd1266277 cd12662, RRM3_MYEF2, RNA recognition motif 3 in ve 2e-11
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 3e-11
cd1265776 cd12657, RRM1_hnRNPM, RNA recognition motif 1 in v 3e-11
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 4e-11
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 4e-11
cd1259275 cd12592, RRM_RBM7, RNA recognition motif in verteb 6e-11
cd1241875 cd12418, RRM_Aly_REF_like, RNA recognition motif i 1e-10
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 1e-10
cd1233474 cd12334, RRM1_SF3B4, RNA recognition motif 1 in sp 2e-10
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 2e-10
cd1265876 cd12658, RRM1_MYEF2, RNA recognition motif 1 in ve 2e-10
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 3e-10
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 4e-10
cd1238576 cd12385, RRM1_hnRNPM_like, RNA recognition motif 1 6e-10
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 1e-09
smart0036073 smart00360, RRM, RNA recognition motif 2e-09
cd1266177 cd12661, RRM3_hnRNPM, RNA recognition motif 3 in v 2e-09
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 2e-09
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 2e-09
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 2e-09
cd1256576 cd12565, RRM1_MRD1, RNA recognition motif 1 in yea 2e-09
cd1228373 cd12283, RRM1_RBM39_like, RNA recognition motif 1 3e-09
cd1237977 cd12379, RRM2_I_PABPs, RNA recognition motif 2 fou 3e-09
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 3e-09
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 3e-09
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 4e-09
cd1261474 cd12614, RRM1_PUB1, RNA recognition motif 1 in yea 4e-09
cd1260072 cd12600, RRM2_SRSF4_like, RNA recognition motif 2 5e-09
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 5e-09
cd1267381 cd12673, RRM_BOULE, RNA recognition motif in prote 6e-09
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 6e-09
pfam0007670 pfam00076, RRM_1, RNA recognition motif 8e-09
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 8e-09
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 1e-08
cd1224078 cd12240, RRM_NCBP2, RNA recognition motif found in 1e-08
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 1e-08
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 1e-08
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 2e-08
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 2e-08
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 2e-08
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 3e-08
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 3e-08
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 3e-08
cd1224273 cd12242, RRM_SLIRP, RNA recognition motif found in 4e-08
cd1240277 cd12402, RRM_eIF4B, RNA recognition motif in eukar 5e-08
cd1260174 cd12601, RRM2_SRSF1_like, RNA recognition motif 2 6e-08
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 6e-08
cd1256476 cd12564, RRM1_RBM19, RNA recognition motif 1 in RN 6e-08
cd1267282 cd12672, RRM_DAZL, RNA recognition motif in verteb 7e-08
cd1232076 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot 8e-08
cd1238772 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 1e-07
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 1e-07
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 1e-07
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 2e-07
cd1227272 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Ar 2e-07
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 2e-07
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 2e-07
cd1255277 cd12552, RRM_Nop15p, RNA recognition motif in yeas 2e-07
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 2e-07
cd1233770 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 2e-07
cd1232177 cd12321, RRM1_TDP43, RNA recognition motif 1 in TA 2e-07
cd1276472 cd12764, RRM2_SRSF4, RNA recognition motif 2 in ve 2e-07
cd1257076 cd12570, RRM5_MRD1, RNA recognition motif 5 in yea 3e-07
cd1248578 cd12485, RRM1_RBM47, RNA recognition motif 1 found 3e-07
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 5e-07
cd1233075 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in ye 5e-07
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 6e-07
cd1233583 cd12335, RRM2_SF3B4, RNA recognition motif 2 in sp 6e-07
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 6e-07
cd1276673 cd12766, RRM2_SRSF6, RNA recognition motif 2 found 6e-07
cd1231577 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 7e-07
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 8e-07
cd1260276 cd12602, RRM2_SF2_plant_like, RNA recognition moti 8e-07
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 9e-07
cd1265876 cd12658, RRM1_MYEF2, RNA recognition motif 1 in ve 1e-06
cd1256576 cd12565, RRM1_MRD1, RNA recognition motif 1 in yea 1e-06
cd1237177 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U 1e-06
cd1257980 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in 1e-06
cd1238576 cd12385, RRM1_hnRNPM_like, RNA recognition motif 1 2e-06
cd1241875 cd12418, RRM_Aly_REF_like, RNA recognition motif i 2e-06
COG0724 306 COG0724, COG0724, RNA-binding proteins (RRM domain 2e-06
cd1268075 cd12680, RRM_THOC4, RNA recognition motif in THO c 2e-06
cd1258180 cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 i 2e-06
cd1276876 cd12768, RRM2_SRSF9, RNA recognition motif 2 in ve 2e-06
cd1237276 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif 2e-06
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 3e-06
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 3e-06
cd1259570 cd12595, RRM1_SRSF5, RNA recognition motif 1 in ve 3e-06
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 3e-06
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 4e-06
cd1240074 cd12400, RRM_Nop6, RNA recognition motif in Saccha 4e-06
cd1229671 cd12296, RRM1_Prp24, RNA recognition motif 1 in fu 4e-06
cd1232177 cd12321, RRM1_TDP43, RNA recognition motif 1 in TA 5e-06
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 5e-06
cd1265776 cd12657, RRM1_hnRNPM, RNA recognition motif 1 in v 8e-06
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 8e-06
cd1263780 cd12637, RRM2_FCA, RNA recognition motif 2 in plan 8e-06
cd1258077 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in 8e-06
cd1223583 cd12235, RRM_PPIL4, RNA recognition motif in pepti 9e-06
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 1e-05
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 1e-05
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 1e-05
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 1e-05
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 1e-05
cd1276776 cd12767, RRM2_SRSF1, RNA recognition motif 2 in se 1e-05
cd1256779 cd12567, RRM3_RBM19, RNA recognition motif 3 in RN 1e-05
cd1240776 cd12407, RRM_FOX1_like, RNA recognition motif in v 1e-05
cd1241189 cd12411, RRM_ist3_like, RNA recognition motif in i 1e-05
pfam02301186 pfam02301, HORMA, HORMA domain 1e-05
cd1225473 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognit 1e-05
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 1e-05
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 2e-05
cd1258280 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in 2e-05
cd1226085 cd12260, RRM2_SREK1, RNA recognition motif 2 in sp 2e-05
cd1240477 cd12404, RRM2_NCL, RNA recognition motif 2 in vert 2e-05
cd1263681 cd12636, RRM2_Bruno_like, RNA recognition motif 2 2e-05
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 2e-05
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 2e-05
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 2e-05
cd1231984 cd12319, RRM4_MRD1, RNA recognition motif 4 in yea 2e-05
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 2e-05
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 3e-05
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 3e-05
cd1228081 cd12280, RRM_FET, RNA recognition motif in the FET 3e-05
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 3e-05
cd1241698 cd12416, RRM4_RBM28_like, RNA recognition motif 4 3e-05
cd1240074 cd12400, RRM_Nop6, RNA recognition motif in Saccha 4e-05
cd1225473 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognit 4e-05
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 4e-05
cd1227884 cd12278, RRM_eIF3B, RNA recognition motif in eukar 4e-05
cd1239773 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 4e-05
cd1237679 cd12376, RRM2_Hu_like, RNA recognition motif 2 in 4e-05
cd1261975 cd12619, RRM2_PUB1, RNA recognition motif 2 in yea 5e-05
pfam1389356 pfam13893, RRM_5, RNA recognition motif 5e-05
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 6e-05
cd1265585 cd12655, RRM3_HuC, RNA recognition motif 3 in vert 7e-05
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 7e-05
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 8e-05
cd1232374 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- 8e-05
cd1232780 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in D 8e-05
cd1226868 cd12268, RRM_Vip1, RNA recognition motif in fissio 9e-05
cd1246380 cd12463, RRM_G3BP1, RNA recognition motif found in 9e-05
cd1258480 cd12584, RRM2_hnRNPAB, RNA recognition motif 2 in 1e-04
cd1248478 cd12484, RRM1_RBM46, RNA recognition motif 1 found 1e-04
cd1232975 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 1e-04
cd1258375 cd12583, RRM2_hnRNPD, RNA recognition motif 2 in h 1e-04
cd1237076 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U 1e-04
cd1264981 cd12649, RRM1_SXL, RNA recognition motif 1 in Dros 1e-04
cd1276575 cd12765, RRM2_SRSF5, RNA recognition motif 2 in ve 1e-04
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 1e-04
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 2e-04
cd1237977 cd12379, RRM2_I_PABPs, RNA recognition motif 2 fou 2e-04
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 2e-04
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 2e-04
cd1231577 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 2e-04
cd1255076 cd12550, RRM_II_PABPN1, RNA recognition motif in t 2e-04
cd1222678 cd12226, RRM_NOL8, RNA recognition motif in nucleo 2e-04
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 2e-04
cd1265279 cd12652, RRM2_Hu, RNA recognition motif 2 in the H 2e-04
cd1265279 cd12652, RRM2_Hu, RNA recognition motif 2 in the H 2e-04
cd1232488 cd12324, RRM_RBM8, RNA recognition motif in RNA-bi 2e-04
cd1258575 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in h 2e-04
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 2e-04
cd1229275 cd12292, RRM2_La_like, RNA recognition motif 2 in 2e-04
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 3e-04
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 3e-04
cd1240477 cd12404, RRM2_NCL, RNA recognition motif 2 in vert 3e-04
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 3e-04
cd1265078 cd12650, RRM1_Hu, RNA recognition motif 1 in the H 3e-04
TIGR01648578 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonu 3e-04
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 3e-04
cd1224978 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 3e-04
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 4e-04
cd1257980 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in 4e-04
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 4e-04
cd1226777 cd12267, RRM_YRA1_MLO3, RNA recognition motif in y 4e-04
cd1254278 cd12542, RRM2_LARP7, RNA recognition motif 2 in La 4e-04
cd1259474 cd12594, RRM1_SRSF4, RNA recognition motif 1 in ve 4e-04
cd1239092 cd12390, RRM3_RAVER, RNA recognition motif 3 in ri 4e-04
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 4e-04
cd1236774 cd12367, RRM2_RBM45, RNA recognition motif 2 in RN 4e-04
cd1231772 cd12317, RRM4_RBM19_RRM3_MRD1, RNA recognition mot 5e-04
cd1265179 cd12651, RRM2_SXL, RNA recognition motif 2 in Dros 6e-04
cd1235272 cd12352, RRM1_TIA1_like, RNA recognition motif 1 i 6e-04
cd1228192 cd12281, RRM1_TatSF1_like, RNA recognition motif 1 6e-04
cd1244684 cd12446, RRM_RBM25, RNA recognition motif in eukar 7e-04
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 8e-04
cd1256476 cd12564, RRM1_RBM19, RNA recognition motif 1 in RN 8e-04
cd1228081 cd12280, RRM_FET, RNA recognition motif in the FET 8e-04
cd1222981 cd12229, RRM_G3BP, RNA recognition motif (RRM) in 8e-04
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 9e-04
cd1265686 cd12656, RRM3_HuD, RNA recognition motif 3 in vert 9e-04
cd1265486 cd12654, RRM3_HuB, RNA recognition motif 3 in vert 9e-04
cd1223873 cd12238, RRM1_RBM40_like, RNA recognition motif 1 9e-04
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 0.001
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 0.001
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 0.001
pfam1389356 pfam13893, RRM_5, RNA recognition motif 0.001
cd1277481 cd12774, RRM2_HuD, RNA recognition motif 2 in vert 0.001
cd1233380 cd12333, RRM2_p54nrb_like, RNA recognition motif 2 0.001
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 0.001
cd1275775 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in 0.001
cd1264279 cd12642, RRM_TRA2A, RNA recognition motif in trans 0.001
cd1229080 cd12290, RRM1_LARP7, RNA recognition motif 1 in La 0.001
cd1238674 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 0.002
cd1238674 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 0.002
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 0.002
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 0.002
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 0.002
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 0.002
cd1226868 cd12268, RRM_Vip1, RNA recognition motif in fissio 0.002
cd1223873 cd12238, RRM1_RBM40_like, RNA recognition motif 1 0.002
cd1254176 cd12541, RRM2_La, RNA recognition motif 2 in La au 0.002
cd1245179 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nu 0.002
cd1277681 cd12776, RRM2_HuC, RNA recognition motif 2 in vert 0.002
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 0.002
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 0.002
cd1230493 cd12304, RRM_Set1, RNA recognition motif in the Se 0.002
cd1277590 cd12775, RRM2_HuB, RNA recognition motif 2 in vert 0.002
cd1248678 cd12486, RRM1_ACF, RNA recognition motif 1 found i 0.002
cd1259670 cd12596, RRM1_SRSF6, RNA recognition motif 1 in ve 0.002
cd1240984 cd12409, RRM1_RRT5, RNA recognition motif 1 in yea 0.002
cd1227671 cd12276, RRM2_MEI2_EAR1_like, RNA recognition moti 0.002
cd1257179 cd12571, RRM6_RBM19, RNA recognition motif 6 in RN 0.002
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 0.003
cd1240776 cd12407, RRM_FOX1_like, RNA recognition motif in v 0.003
cd1264981 cd12649, RRM1_SXL, RNA recognition motif 1 in Dros 0.003
cd1263892 cd12638, RRM3_CELF1_2, RNA recognition motif 3 in 0.003
cd1261780 cd12617, RRM2_TIAR, RNA recognition motif 2 in nuc 0.003
cd1265384 cd12653, RRM3_HuR, RNA recognition motif 3 in vert 0.003
cd1227974 cd12279, RRM_TUT1, RNA recognition motif in speckl 0.003
cd1252971 cd12529, RRM2_MEI2_like, RNA recognition motif 2 i 0.003
cd1264189 cd12641, RRM_TRA2B, RNA recognition motif in Trans 0.003
cd1265876 cd12658, RRM1_MYEF2, RNA recognition motif 1 in ve 0.004
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 0.004
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 0.004
cd1237276 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif 0.004
cd1231772 cd12317, RRM4_RBM19_RRM3_MRD1, RNA recognition mot 0.004
cd1252771 cd12527, RRM2_EAR1_like, RNA recognition motif 2 i 0.004
cd1255177 cd12551, RRM_II_PABPN1L, RNA recognition motif in 0.004
cd1257878 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 0.004
cd1225689 cd12256, RRM2_LKAP, RNA recognition motif 2 in Lim 0.004
>gnl|CDD|240832 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
 Score =  138 bits (350), Expect = 1e-39
 Identities = 48/74 (64%), Positives = 60/74 (81%)

Query: 162 VFVANLDYKVDEKKLREVFRLAGKVENVEIALDKDGKSRGFGTVEFDHPVEAVQSISMLN 221
           +FVANLDYKV  KKL+EVF+LAGKV   +I  DK+GKSRG G V+F+HP+EAVQ+ISM N
Sbjct: 1   IFVANLDYKVGWKKLKEVFKLAGKVVRADIKEDKEGKSRGMGVVQFEHPIEAVQAISMFN 60

Query: 222 NQNLFERRITVRMD 235
            Q LF+R + V+MD
Sbjct: 61  GQMLFDRPMRVKMD 74


This subfamily corresponds to the RRM2 of heterogeneous nuclear ribonucleoprotein M (hnRNP M), myelin expression factor 2 (MEF-2 or MyEF-2 or MST156) and similar proteins. hnRNP M is pre-mRNA binding protein that may play an important role in the pre-mRNA processing. It also preferentially binds to poly(G) and poly(U) RNA homopolymers. hnRNP M is able to interact with early spliceosomes, further influencing splicing patterns of specific pre-mRNAs. It functions as the receptor of carcinoembryonic antigen (CEA) that contains the penta-peptide sequence PELPK signaling motif. In addition, hnRNP M and another splicing factor Nova-1 work together as dopamine D2 receptor (D2R) pre-mRNA-binding proteins. They regulate alternative splicing of D2R pre-mRNA in an antagonistic manner. hnRNP M contains three RNA recognition motifs (RRMs), also termed RBDs (RNA binding domains) or RNPs (ribonucleoprotein domains), and an unusual hexapeptide-repeat region rich in methionine and arginine residues (MR repeat motif). MEF-2 is a sequence-specific single-stranded DNA (ssDNA) binding protein that binds specifically to ssDNA derived from the proximal (MB1) element of the myelin basic protein (MBP) promoter and represses transcription of the MBP gene. MEF-2 shows high sequence homology with hnRNP M. It also contains three RRMs, which may be responsible for its ssDNA binding activity. . Length = 74

>gnl|CDD|241103 cd12659, RRM2_hnRNPM, RNA recognition motif 2 in vertebrate heterogeneous nuclear ribonucleoprotein M (hnRNP M) Back     alignment and domain information
>gnl|CDD|241104 cd12660, RRM2_MYEF2, RNA recognition motif 2 in vertebrate myelin expression factor 2 (MEF-2) Back     alignment and domain information
>gnl|CDD|240831 cd12385, RRM1_hnRNPM_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240833 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins Back     alignment and domain information
>gnl|CDD|240833 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|241106 cd12662, RRM3_MYEF2, RNA recognition motif 3 in vertebrate myelin expression factor 2 (MEF-2) Back     alignment and domain information
>gnl|CDD|240785 cd12339, RRM2_SRSF1_4_like, RNA recognition motif 2 in serine/arginine-rich splicing factor SRSF1, SRSF4 and similar proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|241105 cd12661, RRM3_hnRNPM, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein M (hnRNP M) Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|241037 cd12593, RRM_RBM11, RNA recognition motif in vertebrate RNA-binding protein 11 (RBM11) Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|241106 cd12662, RRM3_MYEF2, RNA recognition motif 3 in vertebrate myelin expression factor 2 (MEF-2) Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241101 cd12657, RRM1_hnRNPM, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein M (hnRNP M) Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|241036 cd12592, RRM_RBM7, RNA recognition motif in vertebrate RNA-binding protein 7 (RBM7) Back     alignment and domain information
>gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|241102 cd12658, RRM1_MYEF2, RNA recognition motif 1 in vertebrate myelin expression factor 2 (MEF-2) Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|240831 cd12385, RRM1_hnRNPM_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|241105 cd12661, RRM3_hnRNPM, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein M (hnRNP M) Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|241058 cd12614, RRM1_PUB1, RNA recognition motif 1 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|241044 cd12600, RRM2_SRSF4_like, RNA recognition motif 2 in serine/arginine-rich splicing factor 4 (SRSF4) and similar proteins Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|241117 cd12673, RRM_BOULE, RNA recognition motif in protein BOULE Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear cap-binding protein subunit 2 (CBP20) and similar proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins Back     alignment and domain information
>gnl|CDD|240848 cd12402, RRM_eIF4B, RNA recognition motif in eukaryotic translation initiation factor 4B (eIF-4B) and similar proteins Back     alignment and domain information
>gnl|CDD|241045 cd12601, RRM2_SRSF1_like, RNA recognition motif 2 in serine/arginine-rich splicing factor SRSF1, SRSF9 and similar proteins Back     alignment and domain information
>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|241008 cd12564, RRM1_RBM19, RNA recognition motif 1 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|241116 cd12672, RRM_DAZL, RNA recognition motif in vertebrate deleted in azoospermia-like (DAZL) proteins Back     alignment and domain information
>gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240833 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240718 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|240783 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 4 (SRSF4) and similar proteins Back     alignment and domain information
>gnl|CDD|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|241208 cd12764, RRM2_SRSF4, RNA recognition motif 2 in vertebrate serine/arginine-rich splicing factor 4 (SRSF4) Back     alignment and domain information
>gnl|CDD|241014 cd12570, RRM5_MRD1, RNA recognition motif 5 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240929 cd12485, RRM1_RBM47, RNA recognition motif 1 found in vertebrate RNA-binding protein 47 (RBM47) Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|241210 cd12766, RRM2_SRSF6, RNA recognition motif 2 found in vertebrate serine/arginine-rich splicing factor 6 (SRSF6) Back     alignment and domain information
>gnl|CDD|240761 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 in RNA-binding protein 19 (RBM19), yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|241046 cd12602, RRM2_SF2_plant_like, RNA recognition motif 2 in plant pre-mRNA-splicing factor SF2 and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|241102 cd12658, RRM1_MYEF2, RNA recognition motif 1 in vertebrate myelin expression factor 2 (MEF-2) Back     alignment and domain information
>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|241023 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240831 cd12385, RRM1_hnRNPM_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|241124 cd12680, RRM_THOC4, RNA recognition motif in THO complex subunit 4 (THOC4) and similar proteins Back     alignment and domain information
>gnl|CDD|241025 cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins Back     alignment and domain information
>gnl|CDD|241212 cd12768, RRM2_SRSF9, RNA recognition motif 2 in vertebrate serine/arginine-rich splicing factor 9 (SRSF9) Back     alignment and domain information
>gnl|CDD|240818 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif of pre-mRNA cleavage factor Im 68 kDa subunit (CFIm68 or CPSF6), pre-mRNA cleavage factor Im 59 kDa subunit (CFIm59 or CPSF7), and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|241039 cd12595, RRM1_SRSF5, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 5 (SRSF5) Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins Back     alignment and domain information
>gnl|CDD|240742 cd12296, RRM1_Prp24, RNA recognition motif 1 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|241101 cd12657, RRM1_hnRNPM, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein M (hnRNP M) Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|241081 cd12637, RRM2_FCA, RNA recognition motif 2 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|241024 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) and similar proteins Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|241211 cd12767, RRM2_SRSF1, RNA recognition motif 2 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins Back     alignment and domain information
>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA binding protein fox-1 homologs and similar proteins Back     alignment and domain information
>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family Back     alignment and domain information
>gnl|CDD|216966 pfam02301, HORMA, HORMA domain Back     alignment and domain information
>gnl|CDD|240700 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognition motif found in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family, epithelial splicing regulatory proteins (ESRPs), Drosophila RNA-binding protein Fusilli, RNA-binding protein 12 (RBM12) and similar proteins Back     alignment and domain information
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241026 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins Back     alignment and domain information
>gnl|CDD|240706 cd12260, RRM2_SREK1, RNA recognition motif 2 in splicing regulatory glutamine/lysine-rich protein 1 (SREK1) and similar proteins Back     alignment and domain information
>gnl|CDD|240850 cd12404, RRM2_NCL, RNA recognition motif 2 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|241080 cd12636, RRM2_Bruno_like, RNA recognition motif 2 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240765 cd12319, RRM4_MRD1, RNA recognition motif 4 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240726 cd12280, RRM_FET, RNA recognition motif in the FET family of RNA-binding proteins Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|240862 cd12416, RRM4_RBM28_like, RNA recognition motif 4 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins Back     alignment and domain information
>gnl|CDD|240700 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognition motif found in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family, epithelial splicing regulatory proteins (ESRPs), Drosophila RNA-binding protein Fusilli, RNA-binding protein 12 (RBM12) and similar proteins Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|240724 cd12278, RRM_eIF3B, RNA recognition motif in eukaryotic translation initiation factor 3 subunit B (eIF-3B) and similar proteins Back     alignment and domain information
>gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast nucleolar protein 13 (Nop13p) and similar proteins Back     alignment and domain information
>gnl|CDD|240822 cd12376, RRM2_Hu_like, RNA recognition motif 2 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|241063 cd12619, RRM2_PUB1, RNA recognition motif 2 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|241099 cd12655, RRM3_HuC, RNA recognition motif 3 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240714 cd12268, RRM_Vip1, RNA recognition motif in fission yeast protein Vip1 and similar proteins Back     alignment and domain information
>gnl|CDD|240909 cd12463, RRM_G3BP1, RNA recognition motif found in ras GTPase-activating protein-binding protein 1 (G3BP1) and similar proteins Back     alignment and domain information
>gnl|CDD|241028 cd12584, RRM2_hnRNPAB, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|240928 cd12484, RRM1_RBM46, RNA recognition motif 1 found in vertebrate RNA-binding protein 46 (RBM46) Back     alignment and domain information
>gnl|CDD|240775 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|241027 cd12583, RRM2_hnRNPD, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins Back     alignment and domain information
>gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|241209 cd12765, RRM2_SRSF5, RNA recognition motif 2 in vertebrate serine/arginine-rich splicing factor 5 (SRSF5) Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240761 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 in RNA-binding protein 19 (RBM19), yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240994 cd12550, RRM_II_PABPN1, RNA recognition motif in type II polyadenylate-binding protein 2 (PABP-2) and similar proteins Back     alignment and domain information
>gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8 (NOL8) and similar proteins Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|241096 cd12652, RRM2_Hu, RNA recognition motif 2 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|241096 cd12652, RRM2_Hu, RNA recognition motif 2 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins Back     alignment and domain information
>gnl|CDD|241029 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP DL) and similar proteins Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|240738 cd12292, RRM2_La_like, RNA recognition motif 2 in La autoantigen (La or SS-B or LARP3), La-related protein 7 (LARP7 or PIP7S) and similar proteins Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240850 cd12404, RRM2_NCL, RNA recognition motif 2 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|233507 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240695 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241023 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240713 cd12267, RRM_YRA1_MLO3, RNA recognition motif in yeast RNA annealing protein YRA1 (Yra1p), yeast mRNA export protein mlo3 and similar proteins Back     alignment and domain information
>gnl|CDD|240986 cd12542, RRM2_LARP7, RNA recognition motif 2 in La-related protein 7 (LARP7) and similar proteins Back     alignment and domain information
>gnl|CDD|241038 cd12594, RRM1_SRSF4, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 4 (SRSF4) Back     alignment and domain information
>gnl|CDD|240836 cd12390, RRM3_RAVER, RNA recognition motif 3 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240813 cd12367, RRM2_RBM45, RNA recognition motif 2 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240763 cd12317, RRM4_RBM19_RRM3_MRD1, RNA recognition motif 4 in RNA-binding protein 19 (RBM19) and RNA recognition motif 3 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240727 cd12281, RRM1_TatSF1_like, RNA recognition motif 1 in HIV Tat-specific factor 1 (Tat-SF1) and similar proteins Back     alignment and domain information
>gnl|CDD|240892 cd12446, RRM_RBM25, RNA recognition motif in eukaryotic RNA-binding protein 25 and similar proteins Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|241008 cd12564, RRM1_RBM19, RNA recognition motif 1 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240726 cd12280, RRM_FET, RNA recognition motif in the FET family of RNA-binding proteins Back     alignment and domain information
>gnl|CDD|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras GTPase-activating protein-binding protein G3BP1, G3BP2 and similar proteins Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|241100 cd12656, RRM3_HuD, RNA recognition motif 3 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|241098 cd12654, RRM3_HuB, RNA recognition motif 3 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240684 cd12238, RRM1_RBM40_like, RNA recognition motif 1 in RNA-binding protein 40 (RBM40) and similar proteins Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|241218 cd12774, RRM2_HuD, RNA recognition motif 2 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240779 cd12333, RRM2_p54nrb_like, RNA recognition motif 2 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|241201 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|241086 cd12642, RRM_TRA2A, RNA recognition motif in transformer-2 protein homolog alpha (TRA-2 alpha) and similar proteins Back     alignment and domain information
>gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins Back     alignment and domain information
>gnl|CDD|240832 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|240832 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|240714 cd12268, RRM_Vip1, RNA recognition motif in fission yeast protein Vip1 and similar proteins Back     alignment and domain information
>gnl|CDD|240684 cd12238, RRM1_RBM40_like, RNA recognition motif 1 in RNA-binding protein 40 (RBM40) and similar proteins Back     alignment and domain information
>gnl|CDD|240985 cd12541, RRM2_La, RNA recognition motif 2 in La autoantigen (La or LARP3) and similar proteins Back     alignment and domain information
>gnl|CDD|240897 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|241220 cd12776, RRM2_HuC, RNA recognition motif 2 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240750 cd12304, RRM_Set1, RNA recognition motif in the Set1-like family of histone-lysine N-methyltransferases Back     alignment and domain information
>gnl|CDD|241219 cd12775, RRM2_HuB, RNA recognition motif 2 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240930 cd12486, RRM1_ACF, RNA recognition motif 1 found in vertebrate APOBEC-1 complementation factor (ACF) Back     alignment and domain information
>gnl|CDD|241040 cd12596, RRM1_SRSF6, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 6 (SRSF6) Back     alignment and domain information
>gnl|CDD|240855 cd12409, RRM1_RRT5, RNA recognition motif 1 in yeast regulator of rDNA transcription protein 5 (RRT5) and similar proteins Back     alignment and domain information
>gnl|CDD|240722 cd12276, RRM2_MEI2_EAR1_like, RNA recognition motif 2 in Mei2-like proteins and terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|241015 cd12571, RRM6_RBM19, RNA recognition motif 6 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA binding protein fox-1 homologs and similar proteins Back     alignment and domain information
>gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|241082 cd12638, RRM3_CELF1_2, RNA recognition motif 3 in CUGBP Elav-like family member CELF-1, CELF-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241061 cd12617, RRM2_TIAR, RNA recognition motif 2 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|241097 cd12653, RRM3_HuR, RNA recognition motif 3 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|240725 cd12279, RRM_TUT1, RNA recognition motif in speckle targeted PIP5K1A-regulated poly(A) polymerase (Star-PAP) and similar proteins Back     alignment and domain information
>gnl|CDD|240973 cd12529, RRM2_MEI2_like, RNA recognition motif 2 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|241085 cd12641, RRM_TRA2B, RNA recognition motif in Transformer-2 protein homolog beta (TRA-2 beta) and similar proteins Back     alignment and domain information
>gnl|CDD|241102 cd12658, RRM1_MYEF2, RNA recognition motif 1 in vertebrate myelin expression factor 2 (MEF-2) Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|240818 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif of pre-mRNA cleavage factor Im 68 kDa subunit (CFIm68 or CPSF6), pre-mRNA cleavage factor Im 59 kDa subunit (CFIm59 or CPSF7), and similar proteins Back     alignment and domain information
>gnl|CDD|240763 cd12317, RRM4_RBM19_RRM3_MRD1, RNA recognition motif 4 in RNA-binding protein 19 (RBM19) and RNA recognition motif 3 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240971 cd12527, RRM2_EAR1_like, RNA recognition motif 2 in terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|240995 cd12551, RRM_II_PABPN1L, RNA recognition motif in vertebrate type II embryonic polyadenylate-binding protein 2 (ePABP-2) Back     alignment and domain information
>gnl|CDD|241022 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240702 cd12256, RRM2_LKAP, RNA recognition motif 2 in Limkain-b1 (LKAP) and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 587
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 100.0
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 100.0
KOG4212|consensus608 100.0
KOG0144|consensus510 100.0
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 100.0
KOG0117|consensus506 100.0
KOG0145|consensus360 100.0
TIGR01648578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 100.0
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 100.0
TIGR01645612 half-pint poly-U binding splicing factor, half-pin 100.0
KOG0127|consensus 678 100.0
KOG0123|consensus369 100.0
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 100.0
TIGR01628562 PABP-1234 polyadenylate binding protein, human typ 100.0
KOG0148|consensus321 100.0
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 100.0
KOG0148|consensus321 99.97
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.96
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.96
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.95
KOG0124|consensus544 99.95
KOG0147|consensus549 99.94
KOG0131|consensus203 99.94
TIGR01648578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.94
KOG0123|consensus369 99.94
KOG0105|consensus241 99.94
KOG0117|consensus506 99.93
KOG0146|consensus371 99.93
KOG0110|consensus725 99.93
TIGR01645612 half-pint poly-U binding splicing factor, half-pin 99.93
KOG4211|consensus510 99.93
KOG0109|consensus346 99.92
KOG0145|consensus360 99.92
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.92
KOG0127|consensus678 99.91
KOG0146|consensus371 99.9
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.89
KOG0144|consensus510 99.88
KOG0110|consensus725 99.87
KOG4205|consensus311 99.86
KOG0109|consensus 346 99.85
KOG0105|consensus241 99.83
KOG1190|consensus492 99.82
KOG0131|consensus203 99.81
KOG4211|consensus510 99.79
KOG1190|consensus492 99.77
KOG0124|consensus544 99.77
KOG0147|consensus549 99.77
KOG4206|consensus221 99.74
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.73
KOG4307|consensus944 99.7
KOG1456|consensus494 99.7
KOG1548|consensus382 99.7
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.69
KOG4212|consensus 608 99.68
KOG0106|consensus216 99.68
KOG0106|consensus216 99.65
KOG1456|consensus494 99.62
KOG4205|consensus311 99.6
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.59
KOG1457|consensus284 99.59
KOG1365|consensus508 99.59
KOG0120|consensus500 99.56
KOG0120|consensus500 99.55
KOG0125|consensus376 99.55
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.54
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.51
KOG0107|consensus195 99.51
KOG4206|consensus221 99.51
KOG0149|consensus247 99.51
KOG1457|consensus284 99.5
KOG0126|consensus219 99.49
KOG0122|consensus270 99.47
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.47
KOG0107|consensus195 99.47
KOG0125|consensus376 99.46
KOG0122|consensus270 99.46
KOG0121|consensus153 99.45
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.45
KOG0149|consensus247 99.44
PLN03120260 nucleic acid binding protein; Provisional 99.43
KOG0121|consensus153 99.43
KOG1548|consensus382 99.43
PLN03120260 nucleic acid binding protein; Provisional 99.42
KOG4207|consensus256 99.41
PLN03213 759 repressor of silencing 3; Provisional 99.37
KOG0113|consensus335 99.37
PLN03121243 nucleic acid binding protein; Provisional 99.36
KOG0130|consensus170 99.36
smart0036272 RRM_2 RNA recognition motif. 99.35
KOG0114|consensus124 99.35
KOG4207|consensus256 99.35
KOG0113|consensus335 99.35
KOG0114|consensus124 99.32
PLN03121243 nucleic acid binding protein; Provisional 99.31
smart0036272 RRM_2 RNA recognition motif. 99.31
PLN03213 759 repressor of silencing 3; Provisional 99.31
KOG4454|consensus267 99.31
KOG1365|consensus508 99.29
KOG0108|consensus435 99.29
smart0036071 RRM RNA recognition motif. 99.28
KOG0111|consensus298 99.28
KOG0111|consensus298 99.27
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.25
KOG0126|consensus219 99.24
smart0036071 RRM RNA recognition motif. 99.22
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.22
KOG0130|consensus170 99.22
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.2
smart0036170 RRM_1 RNA recognition motif. 99.18
KOG0108|consensus435 99.18
KOG0129|consensus520 99.16
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.11
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.1
smart0036170 RRM_1 RNA recognition motif. 99.06
KOG4208|consensus214 99.03
KOG0128|consensus881 98.95
KOG0415|consensus479 98.92
KOG0415|consensus479 98.9
KOG0226|consensus290 98.89
KOG4210|consensus285 98.83
KOG0132|consensus894 98.76
KOG4307|consensus944 98.73
KOG4661|consensus940 98.72
KOG0153|consensus377 98.71
KOG0132|consensus 894 98.7
KOG0533|consensus243 98.69
KOG0153|consensus377 98.69
KOG4208|consensus214 98.68
KOG0128|consensus881 98.65
KOG0533|consensus243 98.65
KOG0112|consensus975 98.59
KOG4661|consensus 940 98.56
KOG0129|consensus520 98.47
KOG0151|consensus 877 98.45
KOG4454|consensus267 98.45
KOG0226|consensus290 98.43
KOG4209|consensus231 98.39
KOG0116|consensus419 98.37
KOG0116|consensus419 98.36
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 98.33
KOG4660|consensus549 98.25
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 98.25
KOG0151|consensus 877 98.24
KOG4660|consensus549 98.24
KOG4209|consensus231 98.23
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 98.22
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 98.2
KOG2193|consensus584 98.09
KOG1995|consensus 351 98.02
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 97.99
KOG0112|consensus 975 97.79
KOG1995|consensus351 97.72
KOG4676|consensus479 97.72
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 97.71
KOG2314|consensus698 97.61
KOG0115|consensus275 97.59
KOG4676|consensus479 97.58
COG5175480 MOT2 Transcriptional repressor [Transcription] 97.55
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 97.53
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 97.49
KOG2193|consensus 584 97.49
KOG2314|consensus 698 97.26
KOG4210|consensus285 97.21
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 97.13
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 97.09
COG5175480 MOT2 Transcriptional repressor [Transcription] 97.0
KOG2202|consensus260 96.91
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 96.86
KOG4849|consensus498 96.85
KOG1855|consensus 484 96.81
KOG1855|consensus484 96.73
KOG2202|consensus260 96.73
KOG0115|consensus275 96.62
KOG4849|consensus498 96.62
KOG1996|consensus378 96.61
KOG3152|consensus278 96.59
KOG1996|consensus378 96.51
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 96.35
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 95.92
KOG0921|consensus1282 95.85
KOG3152|consensus 278 95.81
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 95.59
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 95.46
KOG2591|consensus684 95.32
PF15023166 DUF4523: Protein of unknown function (DUF4523) 95.3
KOG2416|consensus718 94.99
KOG4285|consensus350 94.22
KOG2068|consensus327 93.83
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 93.82
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 93.77
PF04847 184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 93.74
PF15023166 DUF4523: Protein of unknown function (DUF4523) 93.59
KOG2591|consensus 684 93.27
KOG2416|consensus718 93.25
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 93.02
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 92.64
KOG2135|consensus526 92.62
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 92.33
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 90.27
KOG3285|consensus203 89.99
KOG4574|consensus 1007 89.79
KOG4574|consensus 1007 89.26
KOG2068|consensus327 88.74
PF0729288 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 88.55
KOG4285|consensus350 88.49
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 88.29
PF10567309 Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IP 88.25
KOG0804|consensus493 87.16
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 86.88
KOG2135|consensus526 85.98
KOG2253|consensus 668 85.92
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 84.45
KOG2253|consensus 668 83.62
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 80.19
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
Probab=100.00  E-value=9.4e-45  Score=399.70  Aligned_cols=346  Identities=23%  Similarity=0.316  Sum_probs=275.6

Q ss_pred             cEEEcCCCCCCCHHHH-HhcccCCCeEEEEEeeCC-CCCcceEEEEEECCHHHHHHHHHHhCCceeCCeEEEEEeccccc
Q psy1534          34 PVVMDLIQGDASLYQI-SHLSTVGDVTYVEILNDD-TGKPRGSAIVEFQSPDLVRKAVNKMHRFETKGRKLVIKEAVEDK  111 (587)
Q Consensus        34 ~vfV~nlp~~~t~~~l-~~F~~~G~V~~v~i~~d~-~g~skG~aFV~F~~~e~A~~Al~~l~g~~l~gr~i~V~~a~~~~  111 (587)
                      .|||+|||.++||++| ++|++||+|.+|+|++|. +++++|||||+|.+.++|++|++.|++..|.|++|+|.|+.++.
T Consensus         2 sl~VgnLp~~vte~~L~~~F~~~G~v~~v~v~~d~~t~~s~G~afV~F~~~~~A~~Al~~ln~~~i~gk~i~i~~s~~~~   81 (562)
T TIGR01628         2 SLYVGDLDPDVTEAKLYDLFKPFGPVLSVRVCRDSVTRRSLGYGYVNFQNPADAERALETMNFKRLGGKPIRIMWSQRDP   81 (562)
T ss_pred             eEEEeCCCCCCCHHHHHHHHHhcCCEEEEEEEecCCCCCcceEEEEEECCHHHHHHHHHHhCCCEECCeeEEeecccccc
Confidence            6999999999999999 899999999999999997 89999999999999999999999999999999999999987443


Q ss_pred             CCCCCCCCCCCCCCchhhhhccCCcccCCCCCCChhhhhccCCCCCCCcEEEEecCCCCCcHHHHHHHHHhcCCeeEEEE
Q psy1534         112 GGRRNMGGGGGVDRDLSALLQNNSSKFGNTYGLSPQFLESLGINCPLINKVFVANLDYKVDEKKLREVFRLAGKVENVEI  191 (587)
Q Consensus       112 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~V~nLp~~~te~~l~~~F~~~G~i~~v~i  191 (587)
                      ..+.                                         ....+|||+|||.++++++|+++|+.||.|.+|+|
T Consensus        82 ~~~~-----------------------------------------~~~~~vfV~nLp~~~~~~~L~~~F~~~G~i~~~~i  120 (562)
T TIGR01628        82 SLRR-----------------------------------------SGVGNIFVKNLDKSVDNKALFDTFSKFGNILSCKV  120 (562)
T ss_pred             cccc-----------------------------------------cCCCceEEcCCCccCCHHHHHHHHHhcCCcceeEe
Confidence            2111                                         11357999999999999999999999999999999


Q ss_pred             eeCCCCCcceEEEEEecCHHHHHHHHHHhCCceeCCeEEEEEEccCCCCCC-CCCCCCCCcccccCCCCCCCchHHHHHH
Q psy1534         192 ALDKDGKSRGFGTVEFDHPVEAVQSISMLNNQNLFERRITVRMDRVADRLD-GPVRLPEGLKSIGMGLGANGAPLQDVAN  270 (587)
Q Consensus       192 ~~~~~g~~~g~afV~f~~~~~A~~Al~~l~g~~~~g~~l~v~~a~~~~~~~-~~~~~~~~~~~~g~~~~~~~~~l~~~~~  270 (587)
                      .++.+|+++|||||+|.+.++|.+|++.||+..+.++.|.|.....+.... ........+...+++...+++.|+++|.
T Consensus       121 ~~~~~g~skg~afV~F~~~e~A~~Ai~~lng~~~~~~~i~v~~~~~~~~~~~~~~~~~~~l~V~nl~~~~tee~L~~~F~  200 (562)
T TIGR01628       121 ATDENGKSRGYGFVHFEKEESAKAAIQKVNGMLLNDKEVYVGRFIKKHEREAAPLKKFTNLYVKNLDPSVNEDKLRELFA  200 (562)
T ss_pred             eecCCCCcccEEEEEECCHHHHHHHHHHhcccEecCceEEEeccccccccccccccCCCeEEEeCCCCcCCHHHHHHHHH
Confidence            999889999999999999999999999999999999999997655443321 1222345677889999999999999999


Q ss_pred             hhhccccceeEEEEeccCccceeeeeceeeeeecCCCCCCc-eeEecCCCCCCHHHHHHHHhcCCCCCCC----CCCCCC
Q psy1534         271 WLLQEKVQKLSLIISNRNTKEVLERWDFKLQYDKSSDENDA-ASVNTASKTDSTNAEKDKIGNLPNMNTN----PTPTAS  345 (587)
Q Consensus       271 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~fv~~~~~~~~~~~~~~ai~~l~g~~~~----g~~~~~  345 (587)
                      .++.+..                 .   .+..+ .++.+++ +||.    |.+.+++.+|+..|+|..+.    ++.+. 
T Consensus       201 ~fG~i~~-----------------~---~i~~~-~~g~~~G~afV~----F~~~e~A~~Av~~l~g~~i~~~~~g~~l~-  254 (562)
T TIGR01628       201 KFGEITS-----------------A---AVMKD-GSGRSRGFAFVN----FEKHEDAAKAVEEMNGKKIGLAKEGKKLY-  254 (562)
T ss_pred             hcCCEEE-----------------E---EEEEC-CCCCcccEEEEE----ECCHHHHHHHHHHhCCcEecccccceeeE-
Confidence            9876411                 0   22223 3556666 6999    88999999999999998887    66554 


Q ss_pred             CchhhhhcccccccccCCCCCCCCCCcccccccCCCCCCcccccccccccccccccccCCCCCCCCCCCCCCCCCCCccc
Q psy1534         346 VSTPAALAAAVTALTQAQQPPPPQPSLGNLGLNLGLGGAANDLTSNLTSTLTSLAAANQNTAYPLNQLSSQSGLGQSNIL  425 (587)
Q Consensus       346 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~g~~~~~~~~~~~~~~  425 (587)
                      +..+...         ......    +.                    ..+...                          
T Consensus       255 v~~a~~k---------~er~~~----~~--------------------~~~~~~--------------------------  275 (562)
T TIGR01628       255 VGRAQKR---------AEREAE----LR--------------------RKFEEL--------------------------  275 (562)
T ss_pred             eecccCh---------hhhHHH----HH--------------------hhHHhh--------------------------
Confidence            1111000         000000    00                    000000                          


Q ss_pred             ccccccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q psy1534         426 SGMAAYSQGMQSQTSSLSSGNNVYSNQSAPSTDYSRNASNMYGNSRYGSGGNEMDYGGGSGQASIQSGGYGNPRAGLDSN  505 (587)
Q Consensus       426 ~g~~~~~~~~g~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~g~~~~~~~~~~~~~~~~~~~g~~~~~~~~~  505 (587)
                                                                                                      
T Consensus       276 --------------------------------------------------------------------------------  275 (562)
T TIGR01628       276 --------------------------------------------------------------------------------  275 (562)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             CCCCCCCCCCCCeEEEeCCCCCCChHHHHHHHhhcCCeeEEEeecC-----CCeEEEEECCHHHHHHHHHHhCCCcccCc
Q psy1534         506 RSMNQSSNIERDTVVVKNLPPTITWQELRDKFRNCGDIKFAEIKGK-----GDIGLVRFDSEWTAKRAIDMMDRTRIDGK  580 (587)
Q Consensus       506 ~~~~~~~~~~~~~v~V~~Lp~~~~~~~l~~~f~~~G~v~~~~~~~~-----~g~g~v~f~~~~~a~~Ai~~l~g~~~~g~  580 (587)
                       ...........+|||.|||+++|+++|+++|++||.|+.|+|..+     +|+|||+|.+.++|++||+.|||..|+|+
T Consensus       276 -~~~~~~~~~~~~l~V~nl~~~~~~~~L~~~F~~~G~i~~~~i~~d~~g~~~g~gfV~f~~~~~A~~A~~~~~g~~~~gk  354 (562)
T TIGR01628       276 -QQERKMKAQGVNLYVKNLDDTVTDEKLRELFSECGEITSAKVMLDEKGVSRGFGFVCFSNPEEANRAVTEMHGRMLGGK  354 (562)
T ss_pred             -hhhhhcccCCCEEEEeCCCCccCHHHHHHHHHhcCCeEEEEEEECCCCCcCCeEEEEeCCHHHHHHHHHHhcCCeeCCc
Confidence             000000112458999999999999999999999999999999654     48999999999999999999999999999


Q ss_pred             eEEEEE
Q psy1534         581 IIDVTF  586 (587)
Q Consensus       581 ~i~v~~  586 (587)
                      +|+|.+
T Consensus       355 ~l~V~~  360 (562)
T TIGR01628       355 PLYVAL  360 (562)
T ss_pred             eeEEEe
Confidence            999975



There are four paralogs in Homo sapiens which are expressed in testis, platelets, broadly expressed, or of unknown tissue range.

>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>KOG0226|consensus Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>KOG0226|consensus Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>KOG1995|consensus Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG1995|consensus Back     alignment and domain information
>KOG4676|consensus Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG0115|consensus Back     alignment and domain information
>KOG4676|consensus Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG2202|consensus Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG4849|consensus Back     alignment and domain information
>KOG1855|consensus Back     alignment and domain information
>KOG1855|consensus Back     alignment and domain information
>KOG2202|consensus Back     alignment and domain information
>KOG0115|consensus Back     alignment and domain information
>KOG4849|consensus Back     alignment and domain information
>KOG1996|consensus Back     alignment and domain information
>KOG3152|consensus Back     alignment and domain information
>KOG1996|consensus Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>KOG0921|consensus Back     alignment and domain information
>KOG3152|consensus Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>KOG2591|consensus Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>KOG2416|consensus Back     alignment and domain information
>KOG4285|consensus Back     alignment and domain information
>KOG2068|consensus Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>KOG2591|consensus Back     alignment and domain information
>KOG2416|consensus Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>KOG2135|consensus Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>KOG3285|consensus Back     alignment and domain information
>KOG4574|consensus Back     alignment and domain information
>KOG4574|consensus Back     alignment and domain information
>KOG2068|consensus Back     alignment and domain information
>PF07292 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 This entry represents a domain of approximately 90 residues that is tandemly repeated within interferon-induced 35 kDa protein (IFP 35) and the homologous N-myc-interactor (Nmi) Back     alignment and domain information
>KOG4285|consensus Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information
>PF10567 Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IPR018885 This conserved domain is found in fungal proteins and appears to be involved in RNA-processing Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>KOG2135|consensus Back     alignment and domain information
>KOG2253|consensus Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>KOG2253|consensus Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query587
2do0_A114 Solution Structure Of The Rna Binding Domain Of Het 3e-20
2ywk_A95 Crystal Structure Of Rrm-Domain Derived From Human 2e-08
2dgv_A92 Solution Structure Of The Rna Binding Domain In Het 2e-08
2dh9_A89 Solution Structure Of The C-Terminal Rna Binding Do 3e-08
1u6f_A139 Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit 1e-06
2d9p_A103 Solution Structure Of Rna Binding Domain 4 In Polya 4e-06
2fy1_A116 A Dual Mode Of Rna Recognition By The Rbmy Protein 8e-06
2dnz_A95 Solution Structure Of The Second Rna Binding Domain 3e-05
2cqb_A102 Solution Structure Of The Rna Recognition Motif In 4e-05
1duj_A187 Solution Structure Of The Spindle Assembly Checkpoi 5e-05
2v64_D207 Crystallographic Structure Of The Conformational Di 5e-05
2vfx_A206 Structure Of The Symmetric Mad2 Dimer Length = 206 6e-05
3gmh_A207 Crystal Structure Of The Mad2 Dimer Length = 207 6e-05
2qyf_A206 Crystal Structure Of The Mad2P31(COMET)MAD2-Binding 7e-05
1s2h_A206 The Mad2 Spindle Checkpoint Protein Possesses Two D 7e-05
2v64_A213 Crystallographic Structure Of The Conformational Di 7e-05
1p1t_A104 Nmr Structure Of The N-Terminal Rrm Domain Of Cleav 7e-05
1klq_A197 The Mad2 Spindle Checkpoint Protein Undergoes Simil 7e-05
1go4_A205 Crystal Structure Of Mad1-Mad2 Reveals A Conserved 8e-05
2xsf_A89 Crystal Structure Of The Rrm Domain Of Mouse Delete 8e-05
4f02_A213 Crystal Structure Of The Pabp-Binding Site Of Eif4g 8e-05
2ku7_A140 Solution Structure Of Mll1 Phd3-Cyp33 Rrm Chimeric 1e-04
3pgw_S437 Crystal Structure Of Human U1 Snrnp Length = 437 1e-04
1cvj_A190 X-Ray Crystal Structure Of The Poly(A)-Binding Prot 1e-04
2xs2_A102 Crystal Structure Of The Rrm Domain Of Mouse Delete 1e-04
2k8g_A95 Solution Structure Of Rrm2 Domain Of Pabp1 Length = 1e-04
2xs5_A87 Crystal Structure Of The Rrm Domain Of Mouse Delete 1e-04
3cw1_K216 Crystal Structure Of Human Spliceosomal U1 Snrnp Le 2e-04
2o3d_A113 Structure Of Human Sf2ASF RNA RECOGNITION MOTIF 2 ( 2e-04
1x5s_A102 Solution Structure Of Rrm Domain In A18 Hnrnp Lengt 2e-04
2kyx_A83 Solution Structure Of The Rrm Domain Of Cyp33 Lengt 2e-04
3mdf_A85 Crystal Structure Of The Rrm Domain Of Cyclophilin 2e-04
3beg_B115 Crystal Structure Of Sr Protein Kinase 1 Complexed 2e-04
3lpy_A79 Crystal Structure Of The Rrm Domain Of Cyp33 Length 2e-04
1x4c_A108 Solution Structure Of Rrm Domain In Splicing Factor 3e-04
1l3k_A196 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 3e-04
1pgz_A195 Crystal Structure Of Up1 Complexed With D(Ttagggtta 3e-04
4f25_A115 Crystal Structure Of The Second Rrm Domain Of Human 3e-04
2lyv_A197 Solution Structure Of The Two Rrm Domains Of Hnrnp 4e-04
2krr_A180 Solution Structure Of The Rbd1,2 Domains From Human 4e-04
1x5u_A105 Solution Structure Of Rrm Domain In Splicing Factor 4e-04
1ha1_A184 Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 4e-04
2up1_A183 Structure Of Up1-Telomeric Dna Complex Length = 183 4e-04
2jrs_A108 Solution Nmr Structure Of Caper Rrm2 Domain. Northe 6e-04
3md3_A166 Crystal Structure Of The First Two Rrm Domains Of Y 7e-04
1wg4_A98 Solution Structure Of Rrm Domain In Protein Bab3198 9e-04
>pdb|2DO0|A Chain A, Solution Structure Of The Rna Binding Domain Of Heterogeneous Nuclear Ribonucleoprotein M Length = 114 Back     alignment and structure

Iteration: 1

Score = 96.7 bits (239), Expect = 3e-20, Method: Compositional matrix adjust. Identities = 49/81 (60%), Positives = 59/81 (72%) Query: 158 LINKVFVANLDYKVDEKKLREVFRLAGKVENVEIALDKDGKSRGFGTVEFDHPVEAVQSI 217 L + VFVANLDYKV KKL+EVF +AG V +I DKDGKSRG GTV F+ +EAVQ+I Sbjct: 14 LGSTVFVANLDYKVGWKKLKEVFSMAGVVVRADILEDKDGKSRGIGTVTFEQSIEAVQAI 73 Query: 218 SMLNNQNLFERRITVRMDRVA 238 SM N Q LF+R + V+MD A Sbjct: 74 SMFNGQLLFDRPMHVKMDERA 94
>pdb|2YWK|A Chain A, Crystal Structure Of Rrm-Domain Derived From Human Putative Rna-Binding Protein 11 Length = 95 Back     alignment and structure
>pdb|2DGV|A Chain A, Solution Structure Of The Rna Binding Domain In Heterogeneous Nuclear Ribonucleoprotein M Length = 92 Back     alignment and structure
>pdb|2DH9|A Chain A, Solution Structure Of The C-Terminal Rna Binding Domain In Heterogeneous Nuclear Ribonucleoprotein M Length = 89 Back     alignment and structure
>pdb|1U6F|A Chain A, Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit From Trypanosoma Cruzi Length = 139 Back     alignment and structure
>pdb|2D9P|A Chain A, Solution Structure Of Rna Binding Domain 4 In Polyadenylation Binding Protein 3 Length = 103 Back     alignment and structure
>pdb|2FY1|A Chain A, A Dual Mode Of Rna Recognition By The Rbmy Protein Length = 116 Back     alignment and structure
>pdb|2DNZ|A Chain A, Solution Structure Of The Second Rna Binding Domain Of Rna Binding Motif Protein 23 Length = 95 Back     alignment and structure
>pdb|2CQB|A Chain A, Solution Structure Of The Rna Recognition Motif In Peptidyl- Prolyl Cis-Trans Isomerase E Length = 102 Back     alignment and structure
>pdb|1DUJ|A Chain A, Solution Structure Of The Spindle Assembly Checkpoint Protein Human Mad2 Length = 187 Back     alignment and structure
>pdb|2V64|D Chain D, Crystallographic Structure Of The Conformational Dimer Of The Spindle Assembly Checkpoint Protein Mad2. Length = 207 Back     alignment and structure
>pdb|2VFX|A Chain A, Structure Of The Symmetric Mad2 Dimer Length = 206 Back     alignment and structure
>pdb|3GMH|A Chain A, Crystal Structure Of The Mad2 Dimer Length = 207 Back     alignment and structure
>pdb|2QYF|A Chain A, Crystal Structure Of The Mad2P31(COMET)MAD2-Binding Peptide Ternary Complex Length = 206 Back     alignment and structure
>pdb|1S2H|A Chain A, The Mad2 Spindle Checkpoint Protein Possesses Two Distinct Natively Folded States Length = 206 Back     alignment and structure
>pdb|2V64|A Chain A, Crystallographic Structure Of The Conformational Dimer Of The Spindle Assembly Checkpoint Protein Mad2. Length = 213 Back     alignment and structure
>pdb|1P1T|A Chain A, Nmr Structure Of The N-Terminal Rrm Domain Of Cleavage Stimulation Factor 64 Kda Subunit Length = 104 Back     alignment and structure
>pdb|1KLQ|A Chain A, The Mad2 Spindle Checkpoint Protein Undergoes Similar Major Conformational Changes Upon Binding To Either Mad1 Or Cdc20 Length = 197 Back     alignment and structure
>pdb|1GO4|A Chain A, Crystal Structure Of Mad1-Mad2 Reveals A Conserved Mad2 Binding Motif In Mad1 And Cdc20. Length = 205 Back     alignment and structure
>pdb|2XSF|A Chain A, Crystal Structure Of The Rrm Domain Of Mouse Deleted In Azoospermia-Like Length = 89 Back     alignment and structure
>pdb|4F02|A Chain A, Crystal Structure Of The Pabp-Binding Site Of Eif4g In Complex With Rrm1-2 Of Pabp And Poly(A) Length = 213 Back     alignment and structure
>pdb|2KU7|A Chain A, Solution Structure Of Mll1 Phd3-Cyp33 Rrm Chimeric Protein Length = 140 Back     alignment and structure
>pdb|3PGW|S Chain S, Crystal Structure Of Human U1 Snrnp Length = 437 Back     alignment and structure
>pdb|1CVJ|A Chain A, X-Ray Crystal Structure Of The Poly(A)-Binding Protein In Complex With Polyadenylate Rna Length = 190 Back     alignment and structure
>pdb|2XS2|A Chain A, Crystal Structure Of The Rrm Domain Of Mouse Deleted In Azoospermia-Like In Complex With Rna, Uuguucuu Length = 102 Back     alignment and structure
>pdb|2K8G|A Chain A, Solution Structure Of Rrm2 Domain Of Pabp1 Length = 95 Back     alignment and structure
>pdb|2XS5|A Chain A, Crystal Structure Of The Rrm Domain Of Mouse Deleted In Azoospermia-Like In Complex With Mvh Rna, Uguuc Length = 87 Back     alignment and structure
>pdb|3CW1|K Chain K, Crystal Structure Of Human Spliceosomal U1 Snrnp Length = 216 Back     alignment and structure
>pdb|2O3D|A Chain A, Structure Of Human Sf2ASF RNA RECOGNITION MOTIF 2 (RRM2) Length = 113 Back     alignment and structure
>pdb|1X5S|A Chain A, Solution Structure Of Rrm Domain In A18 Hnrnp Length = 102 Back     alignment and structure
>pdb|2KYX|A Chain A, Solution Structure Of The Rrm Domain Of Cyp33 Length = 83 Back     alignment and structure
>pdb|3MDF|A Chain A, Crystal Structure Of The Rrm Domain Of Cyclophilin 33 Length = 85 Back     alignment and structure
>pdb|3BEG|B Chain B, Crystal Structure Of Sr Protein Kinase 1 Complexed To Its Substrate AsfSF2 Length = 115 Back     alignment and structure
>pdb|3LPY|A Chain A, Crystal Structure Of The Rrm Domain Of Cyp33 Length = 79 Back     alignment and structure
>pdb|1X4C|A Chain A, Solution Structure Of Rrm Domain In Splicing Factor 2 Length = 108 Back     alignment and structure
>pdb|1L3K|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 196 Back     alignment and structure
>pdb|1PGZ|A Chain A, Crystal Structure Of Up1 Complexed With D(Ttagggttag(6-Mi) G); A Human Telomeric Repeat Containing 6-Methyl-8-(2- Deoxy-Beta-Ribofuranosyl)isoxanthopteridine (6-Mi) Length = 195 Back     alignment and structure
>pdb|4F25|A Chain A, Crystal Structure Of The Second Rrm Domain Of Human Pabpc1 At Ph 6.0 Length = 115 Back     alignment and structure
>pdb|2LYV|A Chain A, Solution Structure Of The Two Rrm Domains Of Hnrnp A1 (up1) Using Segmental Isotope Labeling Length = 197 Back     alignment and structure
>pdb|2KRR|A Chain A, Solution Structure Of The Rbd1,2 Domains From Human Nucleoli Length = 180 Back     alignment and structure
>pdb|1X5U|A Chain A, Solution Structure Of Rrm Domain In Splicing Factor 3b Length = 105 Back     alignment and structure
>pdb|1HA1|A Chain A, Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 Back     alignment and structure
>pdb|2UP1|A Chain A, Structure Of Up1-Telomeric Dna Complex Length = 183 Back     alignment and structure
>pdb|2JRS|A Chain A, Solution Nmr Structure Of Caper Rrm2 Domain. Northeast Structural Genomics Target Hr4730a Length = 108 Back     alignment and structure
>pdb|3MD3|A Chain A, Crystal Structure Of The First Two Rrm Domains Of Yeast Poly Binding Protein (Pub1) Length = 166 Back     alignment and structure
>pdb|1WG4|A Chain A, Solution Structure Of Rrm Domain In Protein Bab31986 Length = 98 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query587
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 1e-28
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 5e-14
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 5e-10
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 8e-24
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 1e-14
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 4e-09
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 8e-23
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 7e-09
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 3e-08
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 2e-22
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 5e-16
2qfj_A 216 FBP-interacting repressor; protein-DNA complex; HE 5e-09
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 1e-06
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 3e-05
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 8e-22
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 9e-11
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 6e-09
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 1e-21
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 7e-17
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 7e-11
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 1e-08
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 1e-06
2f3j_A177 RNA and export factor binding protein 2; RRM domai 2e-21
2f3j_A177 RNA and export factor binding protein 2; RRM domai 1e-10
2f3j_A177 RNA and export factor binding protein 2; RRM domai 1e-08
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 2e-21
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 8e-21
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 1e-12
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 3e-10
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 2e-09
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 3e-09
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 4e-21
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 3e-11
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 4e-07
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 4e-06
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 7e-21
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 3e-15
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 8e-08
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 3e-07
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 2e-20
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 2e-16
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 3e-08
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 4e-08
2kt5_A124 RNA and export factor-binding protein 2; chaperone 2e-20
2kt5_A124 RNA and export factor-binding protein 2; chaperone 7e-10
2kt5_A124 RNA and export factor-binding protein 2; chaperone 3e-09
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 4e-20
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 6e-16
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-06
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-06
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 4e-20
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 2e-12
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 6e-08
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 6e-20
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 3e-19
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 1e-14
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 1e-10
2ghp_A 292 U4/U6 snRNA-associated splicing factor PRP24; RNA 3e-09
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 9e-06
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 8e-20
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 8e-12
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 3e-06
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 3e-05
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 5e-04
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 2e-19
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 6e-15
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 2e-06
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 1e-05
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 4e-05
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 2e-19
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 1e-08
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 2e-08
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 3e-19
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 6e-10
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 2e-08
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 1e-18
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 8e-07
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 2e-06
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 2e-18
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 1e-12
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 1e-07
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 2e-18
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 4e-08
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 9e-06
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 4e-18
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 1e-10
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 2e-06
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 4e-18
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 3e-07
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 1e-05
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 5e-18
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 1e-12
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 1e-08
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 3e-06
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 3e-05
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 6e-18
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 2e-11
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 2e-07
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 4e-06
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 1e-17
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 1e-07
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 6e-07
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 2e-17
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 4e-08
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 1e-05
1x5o_A114 RNA binding motif, single-stranded interacting pro 2e-17
1x5o_A114 RNA binding motif, single-stranded interacting pro 1e-09
1x5o_A114 RNA binding motif, single-stranded interacting pro 3e-07
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 3e-17
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 6e-08
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 2e-06
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 3e-17
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 6e-08
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 3e-07
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 3e-17
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 1e-09
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 5e-05
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 4e-17
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 2e-08
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 8e-05
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 4e-17
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 3e-09
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 4e-08
3tyt_A 205 Heterogeneous nuclear ribonucleoprotein L; ferredo 7e-08
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 7e-17
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 1e-09
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 5e-06
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 8e-17
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 1e-08
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 2e-06
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 9e-17
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 8e-12
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 4e-09
4f02_A 213 Polyadenylate-binding protein 1; mRNA, eukaryotic 4e-05
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 1e-16
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 1e-09
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 2e-06
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-16
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-06
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 3e-05
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 1e-16
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 3e-08
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 1e-05
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 1e-16
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 1e-08
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 9e-05
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 2e-16
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 4e-06
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 8e-06
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 2e-16
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 2e-08
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 5e-06
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 3e-16
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 1e-07
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 6e-04
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 3e-16
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 4e-09
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 3e-16
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 5e-12
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 3e-08
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 3e-16
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 2e-07
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 4e-06
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 3e-16
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 3e-08
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 1e-05
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 3e-16
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 6e-07
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 2e-06
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 3e-16
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 3e-08
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 5e-06
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 4e-16
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 5e-09
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 2e-05
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 5e-16
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 3e-09
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 6e-16
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 6e-07
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 6e-16
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 3e-07
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 7e-06
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 6e-16
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 3e-09
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 1e-06
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 7e-16
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 6e-08
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 3e-06
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 7e-16
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 4e-07
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 6e-06
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 7e-16
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 4e-07
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 9e-07
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 1e-15
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 8e-07
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 9e-06
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 1e-15
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 4e-06
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 3e-05
1x4e_A85 RNA binding motif, single-stranded interacting pro 1e-15
1x4e_A85 RNA binding motif, single-stranded interacting pro 7e-07
1x4e_A85 RNA binding motif, single-stranded interacting pro 2e-05
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 1e-15
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 3e-07
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 1e-06
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 1e-15
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 3e-07
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 2e-05
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 2e-15
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 5e-06
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 7e-06
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 2e-15
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 3e-08
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 3e-05
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 3e-15
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 1e-09
1qm9_A 198 Polypyrimidine tract-binding protein; ribonucleopr 2e-08
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 8e-08
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 4e-15
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 9e-07
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 1e-05
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 4e-15
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 6e-07
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 2e-06
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 4e-15
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 1e-06
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 5e-06
3p5t_L90 Cleavage and polyadenylation specificity factor S; 5e-15
3p5t_L90 Cleavage and polyadenylation specificity factor S; 2e-07
3p5t_L90 Cleavage and polyadenylation specificity factor S; 4e-06
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 6e-15
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 6e-08
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 2e-07
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 6e-15
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 6e-06
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 9e-15
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 7e-09
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 2e-08
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 1e-14
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 2e-08
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 4e-05
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 1e-14
2adc_A 229 Polypyrimidine tract-binding protein 1; RBD, RRM, 2e-10
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 2e-08
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 2e-07
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 2e-14
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 4e-11
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 8e-06
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 2e-14
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 9e-09
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 2e-08
2cph_A107 RNA binding motif protein 19; RNA recognition moti 2e-14
2cph_A107 RNA binding motif protein 19; RNA recognition moti 2e-08
2cph_A107 RNA binding motif protein 19; RNA recognition moti 1e-06
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 2e-14
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 1e-06
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 5e-06
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 2e-14
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 1e-05
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 5e-05
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 3e-14
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 7e-09
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 8e-04
3n9u_C156 Cleavage and polyadenylation specificity factor S; 3e-14
3n9u_C156 Cleavage and polyadenylation specificity factor S; 7e-08
3n9u_C156 Cleavage and polyadenylation specificity factor S; 3e-07
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 3e-14
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 1e-08
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 7e-07
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 4e-14
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 9e-14
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 1e-07
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 5e-14
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 3e-10
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 4e-07
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 7e-14
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 2e-06
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 5e-06
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 1e-13
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 2e-05
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 1e-13
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 7e-06
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 4e-05
2cpj_A99 Non-POU domain-containing octamer-binding protein; 2e-13
2cpj_A99 Non-POU domain-containing octamer-binding protein; 2e-11
3q2s_C229 Cleavage and polyadenylation specificity factor S; 2e-13
3q2s_C229 Cleavage and polyadenylation specificity factor S; 2e-08
3q2s_C229 Cleavage and polyadenylation specificity factor S; 5e-06
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 3e-13
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 7e-07
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 3e-04
2i2y_A150 Fusion protein consists of immunoglobin G- binding 4e-13
2i2y_A150 Fusion protein consists of immunoglobin G- binding 9e-08
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 4e-13
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 8e-08
2la6_A99 RNA-binding protein FUS; structural genomics, nort 5e-13
2la6_A99 RNA-binding protein FUS; structural genomics, nort 2e-09
2la6_A99 RNA-binding protein FUS; structural genomics, nort 4e-05
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 5e-13
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 1e-07
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 4e-07
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 5e-13
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 4e-10
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 5e-07
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 5e-13
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 5e-07
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 5e-13
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 3e-12
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 7e-13
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 9e-09
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 3e-04
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 8e-13
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 2e-06
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 3e-06
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 9e-13
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 4e-11
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 9e-04
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 1e-12
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 6e-08
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 2e-06
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 1e-12
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 3e-08
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 2e-12
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 2e-06
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 6e-05
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 2e-12
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 1e-06
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 2e-12
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 3e-04
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 2e-12
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 1e-08
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 2e-04
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 2e-12
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 2e-06
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 3e-12
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 2e-06
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 3e-12
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 3e-10
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 4e-12
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 6e-05
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 5e-04
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 4e-12
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 2e-07
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 2e-04
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 5e-12
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 4e-07
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 7e-07
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 5e-12
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 5e-05
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 7e-12
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 7e-05
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 5e-04
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 7e-12
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 5e-05
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 6e-05
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 8e-12
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 4e-06
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 2e-04
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 1e-11
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 2e-05
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 1e-04
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 1e-11
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 1e-06
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 8e-06
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 2e-11
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 3e-05
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 8e-04
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 2e-11
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 1e-10
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 1e-04
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 3e-11
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 5e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-11
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 3e-11
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 6e-10
2div_A99 TRNA selenocysteine associated protein; structural 5e-11
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 6e-11
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 5e-08
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 8e-11
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-10
2cqd_A116 RNA-binding region containing protein 1; RNA recog 1e-10
2cqd_A116 RNA-binding region containing protein 1; RNA recog 2e-05
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 1e-10
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 2e-10
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 8e-08
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 2e-05
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 3e-04
2krb_A81 Eukaryotic translation initiation factor 3 subunit 2e-10
2krb_A81 Eukaryotic translation initiation factor 3 subunit 5e-05
2krb_A81 Eukaryotic translation initiation factor 3 subunit 2e-04
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 2e-10
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 3e-10
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 1e-07
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 3e-10
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 5e-10
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 3e-10
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 7e-06
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 6e-05
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 4e-10
1x5p_A97 Negative elongation factor E; structure genomics, 4e-10
1x5p_A97 Negative elongation factor E; structure genomics, 1e-06
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 5e-10
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 2e-06
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 6e-10
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 7e-10
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 1e-06
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 7e-04
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 7e-10
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 1e-04
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 9e-10
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 9e-10
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 9e-08
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 1e-09
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 4e-07
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 2e-04
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 1e-09
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 2e-06
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 2e-09
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 2e-09
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 2e-09
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 3e-06
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 6e-04
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 2e-09
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 1e-07
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 3e-09
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 5e-07
2dis_A109 Unnamed protein product; structural genomics, RRM 4e-09
2dis_A109 Unnamed protein product; structural genomics, RRM 3e-07
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 6e-09
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 7e-04
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 1e-08
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 4e-05
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 1e-08
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 1e-06
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 2e-08
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 1e-04
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 2e-08
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 8e-04
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 2e-08
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 7e-05
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 5e-04
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 4e-08
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 4e-08
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 5e-08
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 2e-07
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 8e-06
2dnl_A114 Cytoplasmic polyadenylation element binding protei 2e-07
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 2e-07
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 6e-05
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 3e-04
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 5e-07
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 3e-05
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 7e-07
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 8e-07
4aez_B203 MAD2, mitotic spindle checkpoint component MAD2; c 1e-06
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 2e-06
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 1e-05
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 6e-06
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 4e-05
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 8e-06
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 7e-05
2vfx_A206 Mitotic spindle assembly checkpoint protein MAD2A; 1e-05
3abd_A227 Mitotic spindle assembly checkpoint protein MAD2B; 2e-05
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 9e-05
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 2e-04
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 8e-04
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 7e-04
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
 Score =  108 bits (273), Expect = 1e-28
 Identities = 48/81 (59%), Positives = 58/81 (71%)

Query: 160 NKVFVANLDYKVDEKKLREVFRLAGKVENVEIALDKDGKSRGFGTVEFDHPVEAVQSISM 219
           + VFVANLDYKV  KKL+EVF +AG V   +I  DKDGKSRG GTV F+  +EAVQ+ISM
Sbjct: 16  STVFVANLDYKVGWKKLKEVFSMAGVVVRADILEDKDGKSRGIGTVTFEQSIEAVQAISM 75

Query: 220 LNNQNLFERRITVRMDRVADR 240
            N Q LF+R + V+MD  A  
Sbjct: 76  FNGQLLFDRPMHVKMDERALP 96


>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>4aez_B MAD2, mitotic spindle checkpoint component MAD2; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Length = 203 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>2vfx_A Mitotic spindle assembly checkpoint protein MAD2A; CDC2, nucleus, mitosis, anaphase, cell cycle, CE division, spindle checkpoint; HET: PE4 PE3; 1.95A {Homo sapiens} PDB: 2qyf_A 2v64_A 1s2h_A 1go4_A 3gmh_A 1klq_A 2v64_D 1duj_A Length = 206 Back     alignment and structure
>3abd_A Mitotic spindle assembly checkpoint protein MAD2B; horma, DNA replication, translesion DNA SYNT cell cycle, cell division, mitosis, DNA damage; HET: DNA; 1.90A {Homo sapiens} PDB: 3abe_C* Length = 227 Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Length = 240 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query587
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 100.0
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 100.0
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 100.0
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 100.0
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 100.0
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 100.0
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 100.0
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 100.0
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.98
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.97
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.97
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.97
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.97
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.97
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.97
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.96
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.96
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.96
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.96
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.96
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.96
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.95
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.95
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.95
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.95
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.94
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.94
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.94
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.94
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.93
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.93
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.93
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.92
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.92
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.92
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.9
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.88
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.86
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.84
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.81
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.79
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.79
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.76
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.75
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.75
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.75
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.75
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.75
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.75
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.74
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.74
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.74
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.74
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.74
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.74
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.74
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.74
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.74
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.74
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.74
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.74
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.73
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.73
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.73
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.73
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.73
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.73
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.73
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.73
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.73
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.72
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.72
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.72
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.72
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.72
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.72
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.72
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.72
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.72
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.72
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.72
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.72
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.72
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.72
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.72
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.72
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.72
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.71
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.71
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.71
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.71
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.71
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.71
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.71
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.71
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.71
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.71
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.71
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.71
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.71
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.71
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.71
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.71
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.71
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.71
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.71
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.71
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.71
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.71
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.7
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.7
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.7
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.7
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.7
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.7
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.7
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.7
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.7
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.7
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.7
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.7
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.7
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.7
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.7
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.7
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.7
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.7
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.7
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.7
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.7
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.7
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.7
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.7
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.7
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.7
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.7
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.69
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.69
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.69
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.69
2div_A99 TRNA selenocysteine associated protein; structural 99.69
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.69
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.69
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.69
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.69
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.69
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.69
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.69
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.69
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.69
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.69
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.69
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.69
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.68
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.68
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.68
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.68
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.68
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.68
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.68
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.68
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.68
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.68
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.68
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.68
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.68
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.68
2div_A99 TRNA selenocysteine associated protein; structural 99.68
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.68
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.68
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.68
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.68
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.68
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.68
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.68
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.68
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.68
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.67
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.67
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.67
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.67
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.67
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.67
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.67
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.67
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.67
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.67
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.67
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.67
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.67
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.67
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.67
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.66
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.66
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.66
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.66
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.66
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.66
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.66
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.66
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.66
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.66
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.66
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.66
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.66
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.66
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.66
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.66
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.66
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.66
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.66
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.65
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.65
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.65
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.65
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.65
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.65
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.65
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.65
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.65
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.65
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.65
2dis_A109 Unnamed protein product; structural genomics, RRM 99.65
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.65
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.65
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.64
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.64
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.64
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.64
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.64
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.64
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.64
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.45
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.64
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.64
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.64
2dis_A109 Unnamed protein product; structural genomics, RRM 99.64
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.64
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.64
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.64
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.64
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.64
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.64
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.64
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.64
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.64
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.63
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.63
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.63
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.63
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.63
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.63
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.63
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.63
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.63
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.63
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.63
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.63
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.63
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.63
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.63
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.63
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.63
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.63
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.63
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.63
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.62
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.62
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.62
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.62
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.62
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.62
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.62
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.62
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.61
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.61
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.61
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.61
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.61
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.61
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.61
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.61
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.61
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.61
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.61
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.61
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.61
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.61
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.61
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.6
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.6
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.6
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.6
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.6
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.6
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.6
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.6
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.6
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.6
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.6
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.59
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.59
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.59
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.59
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.59
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.59
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.59
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.58
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.58
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.58
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.58
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.58
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.58
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.58
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.58
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.58
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.58
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.58
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.57
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.57
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.57
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.57
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.57
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.57
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.57
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.56
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.34
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.56
1x5p_A97 Negative elongation factor E; structure genomics, 99.56
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.56
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.56
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.56
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.55
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.55
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.55
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.55
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.54
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.54
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.54
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.54
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.54
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.53
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.53
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.53
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.52
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.52
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.52
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.52
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.51
1x5p_A97 Negative elongation factor E; structure genomics, 99.51
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.51
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.5
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.48
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.47
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.47
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.46
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.45
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.42
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.42
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.41
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.41
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.41
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.41
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.39
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.39
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.34
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.28
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.25
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.22
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 99.2
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 99.19
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.18
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 99.17
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 99.17
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 99.08
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 99.03
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 98.97
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.85
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.73
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.62
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.6
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.2
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 97.99
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 97.81
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 97.66
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 97.63
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 97.13
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 97.07
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 96.93
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 96.83
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 96.72
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 96.66
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 96.55
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 96.42
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 96.29
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 96.24
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 95.49
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 95.01
3pq1_A464 Poly(A) RNA polymerase; nucleotidyl transferase, R 93.94
3pq1_A464 Poly(A) RNA polymerase; nucleotidyl transferase, R 93.41
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
Probab=100.00  E-value=2.2e-40  Score=334.56  Aligned_cols=161  Identities=11%  Similarity=0.138  Sum_probs=139.3

Q ss_pred             CCCCCCCcEEEcCCCCCCCHHHH-HhcccCCCeEEEEEeeCCCCCcceEEEEEECCHHHHHHHHHHhCCceeCCeEEEEE
Q psy1534          27 TGAPLEVPVVMDLIQGDASLYQI-SHLSTVGDVTYVEILNDDTGKPRGSAIVEFQSPDLVRKAVNKMHRFETKGRKLVIK  105 (587)
Q Consensus        27 ~~~~~~~~vfV~nlp~~~t~~~l-~~F~~~G~V~~v~i~~d~~g~skG~aFV~F~~~e~A~~Al~~l~g~~l~gr~i~V~  105 (587)
                      ...+..++|||+|||+++|+++| ++|++||+|.+|+|++++.+ ++|||||+|.+.++|++|++ +++..|.|++|.|.
T Consensus        36 ~~~~~~~~l~V~nLp~~~t~~~l~~~F~~~G~i~~v~i~~~~~~-~~g~afV~f~~~~~A~~A~~-~~~~~~~g~~i~v~  113 (292)
T 2ghp_A           36 TRNRELTTVLVKNLPKSYNQNKVYKYFKHCGPIIHVDVADSLKK-NFRFARIEFARYDGALAAIT-KTHKVVGQNEIIVS  113 (292)
T ss_dssp             ------CEEEEEEECTTCCHHHHHHHHGGGSCEEEEEEEECTTS-SSEEEEEEESSHHHHHHHHT-TTTCEETTEECEEE
T ss_pred             ccCCCCCEEEEeCCCCCCCHHHHHHHHHhcCCeEEEEEEECCCC-CcEEEEEEECCHHHHHHHHH-hCCcEeCCcEEEEE
Confidence            34457789999999999999999 89999999999999998755 58999999999999999994 89999999999999


Q ss_pred             ecccccCCCCCCCCCCCCCCchhhhhccCCcccCCCCCCChhhhhccCCCCCCCcEEEEecCCCCCcHHHHHHHHHhcC-
Q psy1534         106 EAVEDKGGRRNMGGGGGVDRDLSALLQNNSSKFGNTYGLSPQFLESLGINCPLINKVFVANLDYKVDEKKLREVFRLAG-  184 (587)
Q Consensus       106 ~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~V~nLp~~~te~~l~~~F~~~G-  184 (587)
                      ++.                                                  .++|||+|||+++++++|+++|+.|| 
T Consensus       114 ~~~--------------------------------------------------~~~l~v~nlp~~~t~~~l~~~f~~~G~  143 (292)
T 2ghp_A          114 HLT--------------------------------------------------ECTLWMTNFPPSYTQRNIRDLLQDINV  143 (292)
T ss_dssp             ECC--------------------------------------------------SCEEEEECCCTTCCHHHHHHHHHHTTC
T ss_pred             ECC--------------------------------------------------CCEEEEECCCCCCCHHHHHHHHHHhCC
Confidence            864                                                  35899999999999999999999999 


Q ss_pred             CeeEEEEeeCCCCCcceEEEEEecCHHHHHHHHHHhCCceeCCeEEEEEEccCCC
Q psy1534         185 KVENVEIALDKDGKSRGFGTVEFDHPVEAVQSISMLNNQNLFERRITVRMDRVAD  239 (587)
Q Consensus       185 ~i~~v~i~~~~~g~~~g~afV~f~~~~~A~~Al~~l~g~~~~g~~l~v~~a~~~~  239 (587)
                      .|..|.|++++.+.++|||||+|.+.++|.+|++.||+..+.|++|.|.++.+..
T Consensus       144 ~i~~v~i~~~~~~~~~g~afV~f~~~~~a~~A~~~l~g~~~~g~~l~v~~a~~~~  198 (292)
T 2ghp_A          144 VALSIRLPSLRFNTSRRFAYIDVTSKEDARYCVEKLNGLKIEGYTLVTKVSNPLE  198 (292)
T ss_dssp             CCCEEECC-------CCEEEEECSSHHHHHHHHHHHTTCEETTEECEEEECCCC-
T ss_pred             CeEEEEEEeCCCCCcceEEEEEECCHHHHHHHHHHhCCCEeCCcEEEEEECCCCc
Confidence            9999999999888899999999999999999999999999999999999987553



>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 587
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 7e-14
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 4e-10
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 2e-05
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 1e-12
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 6e-11
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 1e-04
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 1e-12
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 6e-10
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 6e-12
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 8e-11
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 3e-04
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 8e-12
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 3e-10
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 2e-04
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 1e-11
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 1e-08
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 1e-11
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 2e-11
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 2e-05
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 1e-11
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 2e-09
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 5e-04
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 3e-11
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 2e-10
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 1e-04
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 6e-11
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 7e-07
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 7e-11
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 3e-10
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 0.003
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 7e-11
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 8e-08
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 2e-10
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 6e-07
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 2e-10
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 6e-10
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 0.003
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 2e-10
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 7e-08
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 2e-10
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 6e-08
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 3e-05
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 2e-10
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 1e-08
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 0.001
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 2e-10
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 4e-10
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 2e-10
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 1e-06
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 5e-10
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 2e-09
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 9e-05
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 5e-10
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 3e-09
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 8e-04
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 5e-10
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-08
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 6e-10
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 9e-08
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 6e-04
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 7e-10
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 9e-10
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 8e-10
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 2e-06
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 2e-05
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 1e-09
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 7e-08
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 1e-09
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 1e-08
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 4e-04
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-09
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 4e-09
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-04
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 2e-09
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 2e-09
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 7e-05
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 2e-09
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 1e-08
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 0.002
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 2e-09
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 5e-09
d1go4a_196 d.135.1.1 (A:) The spindle assembly checkpoint pro 3e-09
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 3e-09
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 4e-06
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 0.003
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 3e-09
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 9e-09
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 4e-09
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 2e-08
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 6e-04
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 5e-09
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 5e-08
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 5e-09
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 1e-08
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 7e-09
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 3e-07
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 7e-09
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 4e-08
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 7e-09
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 9e-09
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 1e-08
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 9e-08
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 2e-08
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 5e-08
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 2e-08
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 2e-04
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 2e-08
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 2e-07
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 7e-04
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 2e-08
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 5e-08
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 3e-08
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 2e-04
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 5e-08
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 6e-08
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 7e-08
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 2e-05
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 4e-04
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 8e-08
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 1e-05
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 9e-08
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 1e-06
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 5e-05
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 9e-08
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 3e-06
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 1e-07
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 5e-05
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 1e-07
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 7e-07
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 2e-07
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 8e-07
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 2e-07
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 3e-05
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 3e-07
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 9e-05
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 3e-07
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 2e-06
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 4e-07
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 8e-07
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 8e-07
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 2e-04
d1owxa_113 d.58.7.1 (A:) Lupus LA protein {Human (Homo sapien 1e-06
d1owxa_113 d.58.7.1 (A:) Lupus LA protein {Human (Homo sapien 9e-05
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 1e-06
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 5e-05
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 1e-06
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 8e-06
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 1e-06
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 2e-06
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 1e-06
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 1e-05
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 0.002
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 2e-06
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 6e-05
d1wi6a175 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 2e-06
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 3e-06
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 0.003
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 3e-06
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 2e-05
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 3e-06
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 0.002
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 3e-06
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 9e-06
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 3e-06
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 3e-06
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 5e-06
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 3e-05
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 6e-06
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 5e-04
d2cq1a188 d.58.7.1 (A:51-138) Polypyrimidine tract-binding p 6e-06
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 9e-06
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 4e-05
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 0.004
d3begb187 d.58.7.1 (B:121-207) Splicing factor, arginine/ser 9e-06
d3begb187 d.58.7.1 (B:121-207) Splicing factor, arginine/ser 9e-05
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 1e-05
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 3e-05
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 1e-05
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 1e-05
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 3e-04
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 7e-04
d1whxa_111 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 2e-05
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 2e-05
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 4e-04
d2b0ga183 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosoph 4e-05
d1weza_102 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 7e-05
d1weza_102 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 3e-04
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Probable RNA-binding protein 19, Rbm19
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 65.3 bits (159), Expect = 7e-14
 Identities = 19/78 (24%), Positives = 46/78 (58%), Gaps = 3/78 (3%)

Query: 160 NKVFVANLDYKVDEKKLREVFRLAGKVENVEIALDKD--GKSRGFGTVEFDHPVEAVQSI 217
           +K+ V N+ ++ +++++RE+F   G+++ V +       G  RGFG V+F    +A ++ 
Sbjct: 9   SKILVRNIPFQANQREIRELFSTFGELKTVRLPKKMTGTGAHRGFGFVDFITKQDAKKAF 68

Query: 218 -SMLNNQNLFERRITVRM 234
            ++ ++ +L+ RR+ +  
Sbjct: 69  NALCHSTHLYGRRLVLEW 86


>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1go4a_ d.135.1.1 (A:) The spindle assembly checkpoint protein mad2 {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Length = 83 Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query587
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.97
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.91
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.8
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.8
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.8
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.79
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.79
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.79
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.79
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.79
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.79
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.79
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.78
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.78
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.78
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.78
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.78
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.78
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.78
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.78
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.78
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.78
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.77
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.77
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.77
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.77
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.77
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.77
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.77
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.76
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.76
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.76
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.76
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.76
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.76
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.76
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.75
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.75
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.75
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.75
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.75
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.75
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.75
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.75
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.75
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.75
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.75
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.75
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.74
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.74
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.74
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.74
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.74
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.74
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.74
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.74
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.73
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.73
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.73
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.73
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.73
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.73
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.73
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.73
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.72
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.72
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.72
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.72
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.72
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.72
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.71
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.71
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.71
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.71
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.7
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.7
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.7
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.7
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.7
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.7
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.7
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.7
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.69
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.69
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.69
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.69
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.69
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.69
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.69
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.69
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.69
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.68
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.68
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.68
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.68
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.68
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.68
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.67
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.67
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.67
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.67
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.67
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.67
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.67
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.67
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.67
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.66
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.66
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.66
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.66
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.65
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.65
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.65
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.65
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.65
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.65
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.65
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.65
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.65
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.65
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.64
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.64
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.64
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.64
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.64
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.64
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.64
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.64
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.63
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.63
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.63
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.63
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.63
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.62
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.62
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.62
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.62
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.62
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.62
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.62
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.62
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.62
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.61
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.61
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.61
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.61
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.61
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.6
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.59
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.59
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.57
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.56
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.56
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.55
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.53
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.53
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.51
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.5
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.5
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.49
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.48
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.42
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.41
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.4
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.39
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.38
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.35
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.31
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.31
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.29
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.26
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.23
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 97.65
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 97.47
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 97.35
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 97.32
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 97.16
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 96.7
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 94.64
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 94.46
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.97  E-value=1e-29  Score=235.87  Aligned_cols=168  Identities=24%  Similarity=0.349  Sum_probs=147.6

Q ss_pred             CCcEEEcCCCCCCCHHHH-HhcccCCCeEEEEEeeCC-CCCcceEEEEEECCHHHHHHHHHHhCCceeCCeEEEEEeccc
Q psy1534          32 EVPVVMDLIQGDASLYQI-SHLSTVGDVTYVEILNDD-TGKPRGSAIVEFQSPDLVRKAVNKMHRFETKGRKLVIKEAVE  109 (587)
Q Consensus        32 ~~~vfV~nlp~~~t~~~l-~~F~~~G~V~~v~i~~d~-~g~skG~aFV~F~~~e~A~~Al~~l~g~~l~gr~i~V~~a~~  109 (587)
                      .++|||+|||+++|+++| ++|++||+|++|+++++. ++.++|||||+|.+.++|++|++. ++..+..+.+.+.+...
T Consensus         6 ~r~lfV~nLp~~~te~~L~~~F~~~G~v~~~~~~~~~~~~~~~g~afv~f~~~~~a~~a~~~-~~~~~~~~~~~~~~~~~   84 (183)
T d1u1qa_           6 LRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNA-RPHKVDGRVVEPKRAVS   84 (183)
T ss_dssp             HHEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHHT-CSCEETTEECEEEECCC
T ss_pred             CCEEEEECCCCCCCHHHHHHHHHHcCCEEEEEeeecccCCCccCceecccCCHHHHHHHHHh-cCCcccccchhhhhhhh
Confidence            378999999999999999 899999999999999997 999999999999999999999975 67888999998887763


Q ss_pred             ccCCCCCCCCCCCCCCchhhhhccCCcccCCCCCCChhhhhccCCCCCCCcEEEEecCCCCCcHHHHHHHHHhcCCeeEE
Q psy1534         110 DKGGRRNMGGGGGVDRDLSALLQNNSSKFGNTYGLSPQFLESLGINCPLINKVFVANLDYKVDEKKLREVFRLAGKVENV  189 (587)
Q Consensus       110 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~V~nLp~~~te~~l~~~F~~~G~i~~v  189 (587)
                      ......                                     .......++|||+|||+.+++++|+++|+.||.|..+
T Consensus        85 ~~~~~~-------------------------------------~~~~~~~~~i~V~~lp~~~te~~L~~~f~~~G~v~~~  127 (183)
T d1u1qa_          85 REDSQR-------------------------------------PGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVI  127 (183)
T ss_dssp             TTGGGS-------------------------------------TTTTCCCSEEEEECCCTTCCHHHHHHHHGGGSCEEEE
T ss_pred             cccccc-------------------------------------cccccccceeEEccCCCcCCHHHHhhhhccCCceeee
Confidence            321000                                     0123345799999999999999999999999999999


Q ss_pred             EEeeCCC-CCcceEEEEEecCHHHHHHHHHHhCCceeCCeEEEEEEccCC
Q psy1534         190 EIALDKD-GKSRGFGTVEFDHPVEAVQSISMLNNQNLFERRITVRMDRVA  238 (587)
Q Consensus       190 ~i~~~~~-g~~~g~afV~f~~~~~A~~Al~~l~g~~~~g~~l~v~~a~~~  238 (587)
                      .|+.+.. ++++|||||+|.+.++|.+||+ ++++.+.|++|+|++|.++
T Consensus       128 ~i~~~~~~~~~~g~~fV~f~~~e~A~~Al~-~~~~~~~G~~i~V~~A~~k  176 (183)
T d1u1qa_         128 EIMTDRGSGKKRGFAFVTFDDHDSVDKIVI-QKYHTVNGHNCEVRKALSK  176 (183)
T ss_dssp             EEEECTTTCCEEEEEEEEESCHHHHHHHHT-SSCEEETTEEEEEEECCCH
T ss_pred             eeecccccCccceeEEEEECCHHHHHHHHH-hCCCeECCEEEEEEecCCc
Confidence            9999886 8999999999999999999996 6889999999999998654



>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure