Psyllid ID: psy15351


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350--
MGRGLKDIEKHLKNVDIVIEVHDSRMPFTGRNHLLQQSVQNIRPMVLVLNKRDLINSKHESLIEEKVRKEQSHISEVIFTNCRNPNCKGVQKILPTLQHISDNMTRYHRTEVYNTTVMVVGVPNVGKSSIINALRSSHMKKGKAVPILPTLQHISDNMTRYHRTEVYNTTVMVVGVPNVGKSSIINALRSSHMKKGKAVPVGPKAGVTRSVMSQVKISEKPLIYILDTPGISLPRIDNLECGMRLAACATLQDHLVGEINIADYILFYLNRTGNYRYVDFFNLDEPSDDIVMLLAKAAIKKKWFKRAFDVSSNSVRMFPDTGEVARIFIEHFRKGSFGSVMLDRDFLELDIS
ccHHHHHHHHHcccccEEEEEEEcccccccccccHHHHHHccccEEEEEEccccccHHHHHHHHHHHHHHcccccEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHccccccEEEEEcccccccHHHHHHHHHcccccccccccccHHHHHHccccccccccccccEEEEEcccccccHHHHHHHHHcccccccccccccccccEEEEccEEEccccccEEEEEcccccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcHHHHHHHHccccccccHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccc
cHHHHHHHHHHHHcccEEEEEEEcccccccccHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHHHccccEHEHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHcccccccHEEEEccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccccEEEEEEEcccccHHHHHHHHHHHHHHcccEEEEcccccccEEEEEEEEEEEcccEEEEccccEEcccccccHccEEEEEEcccccccccHHHHHHHHHHHHHHHcHHHHHHHcccccccccHHHHHHHHHHHHcHHccccEEcccEccccccHHHHHHHHHHHHHccccccEEccccccHHHcc
MGRGLKDIEKHLKNVDIVIEVhdsrmpftgrnhLLQQSVQNIRPMVLVLNKRDLINSKHESLIEEKVRKEQSHISEVIftncrnpnckgvqkILPTLQHISDNMTRYHRTEVYNTTVMVVGVPNVGKSSIINALRSshmkkgkavpilptlqhisdnmtryhrtEVYNTTVMVVGVPNVGKSSIINALRsshmkkgkavpvgpkagvtRSVMSQVkisekpliyildtpgislpridnlecGMRLAACATLQDHLVGEINIADYILFYLNrtgnyryvdffnldepsdDIVMLLAKAAIKKKWFKRafdvssnsvrmfpdtGEVARIFIEHFrkgsfgsvmldrdfleldis
MGRGLKDIEKHLKNVDIVIEVHDSRMPFTGRNHLLQQSVQNIRPMVLVLNKRDLINSKHESLIEEKVRKEQSHISeviftncrnpncKGVQKILPTLQHISDNMTRYHRTEVYNTTVMVVGVPNVGKSSIINALRSSHMKKGKAVPILPTLQHISDNMTRYHRTEVYNTTVMVVGVPNVGKSSIINALrsshmkkgkavpvgpkagvtrsvmsqvkisekpliyilDTPGISLPRIDNLECGMRLAACATLQDHLVGEINIADYILFYLNRTGNYRYVDFFNLDEPSDDIVMLLAKAAIKKKWfkrafdvssnsvrmfpdTGEVARIFIEhfrkgsfgsvmldRDFLELDIS
MGRGLKDIEKHLKNVDIVIEVHDSRMPFTGRNHLLQQSVQNIRPMVLVLNKRDLINSKHESLIEEKVRKEQSHISEVIFTNCRNPNCKGVQKILPTLQHISDNMTRYHRTEVYNTTVMVVGVPNVGKSSIINALRSSHMKKGKAVPILPTLQHISDNMTRYHRTEVYNTTVMVVGVPNVGKSSIINALRSSHMKKGKAVPVGPKAGVTRSVMSQVKISEKPLIYILDTPGISLPRIDNLECGMRLAACATLQDHLVGEINIADYILFYLNRTGNYRYVDFFNLDEPSDDIVMLLAKAAIKKKWFKRAFDVSSNSVRMFPDTGEVARIFIEHFRKGSFGSVMLDRDFLELDIS
**********HLKNVDIVIEVHDSRMPFTGRNHLLQQSVQNIRPMVLVLNKRDLINSKH**LI********SHISEVIFTNCRNPNCKGVQKILPTLQHISDNMTRYHRTEVYNTTVMVVGVPNVGKSSIINALRSSHMKKGKAVPILPTLQHISDNMTRYHRTEVYNTTVMVVGVPNVGKSSIINAL*********************SVMSQVKISEKPLIYILDTPGISLPRIDNLECGMRLAACATLQDHLVGEINIADYILFYLNRTGNYRYVDFFNLDEPSDDIVMLLAKAAIKKKWFKRAFDVSSNSVRMFPDTGEVARIFIEHFRKGSFGSVMLDRDFLE****
MGRGLKDIEKHLKNVDIVIEVHDSRMPFTGRNHLLQQSVQNIRPMVLVLNKRDLINSKHESLIEEKVRKEQSHISEVIFTNCRNPNCKGVQKILPTLQHISDNMT*****EVYNTTVMVVGVPNVGKSSIINALRSSHMKKGKAVPILPTLQH**********TEVYNTTVMVVGVPNVGKSSIINALRS**M********GPKAGVTRSVMSQVKISEKPLIYILDTPGISLPRIDNLECGMRLAACATLQDHLVGEINIADYILFYLNRTGNYRYVDFFNLDEPSDDIVMLLAKAAIKKKWFKRAFDVSSNSVRMFPDTGEVARIFIEHFRKGSFGSVMLDRDFLEL***
MGRGLKDIEKHLKNVDIVIEVHDSRMPFTGRNHLLQQSVQNIRPMVLVLNKRDLINSKHESLIEEKVRKEQSHISEVIFTNCRNPNCKGVQKILPTLQHISDNMTRYHRTEVYNTTVMVVGVPNVGKSSIINALRSSHMKKGKAVPILPTLQHISDNMTRYHRTEVYNTTVMVVGVPNVGKSSIINALRSSH**********PKAGVTRSVMSQVKISEKPLIYILDTPGISLPRIDNLECGMRLAACATLQDHLVGEINIADYILFYLNRTGNYRYVDFFNLDEPSDDIVMLLAKAAIKKKWFKRAFDVSSNSVRMFPDTGEVARIFIEHFRKGSFGSVMLDRDFLELDIS
*GRGLKDIEKHLKNVDIVIEVHDSRMPFTGRNHLLQQSVQNIRPMVLVLNKRDLINSKHESLIEEKVRKEQSHISEVIFTNCRNPNCKGVQKILPTLQHISDNMTRYHRTEVYNTTVMVVGVPNVGKSSIINALRSSHMKKGKAVPILPTLQHISDNMTRYHRTEVYNTTVMVVGVPNVGKSSIINALRSSHMKKGKAVPVGPKAGVTRSVMSQVKISEKPLIYILDTPGISLPRIDNLECGMRLAACATLQDHLVGEINIADYILFYLNRTGNYRYVDFFNLDEPSDDIVMLLAKAAIKKKWFKRAFDVSSNSVRMFPDTGEVARIFIEHFRKGSFGSVMLDRDFL*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRGLKDIEKHLKNVDIVIEVHDSRMPFTGRNHLLQQSVQNIRPMVLVLNKRDLINSKHESLIEEKVRKEQSHISEVIFTNCRNPNCKGVQKILPTLQHISDNMTRYHRTEVYNTTVMVVGVPNVGKSSIINALRSSHMKKGKAVPILPTLQHISDNMTRYHRTEVYNTTVMVVGVPNVGKSSIINALRSSHMKKGKAVPVGPKAGVTRSVMSQVKISEKPLIYILDTPGISLPRIDNLECGMRLAACATLQDHLVGEINIADYILFYLNRTGNYRYVDFFNLDEPSDDIVMLLAKAAIKKKWFKRAFDVSSNSVRMFPDTGEVARIFIEHFRKGSFGSVMLDRDFLELDIS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query352 2.2.26 [Sep-21-2011]
Q17EJ1316 Mitochondrial GTPase 1 OS N/A N/A 0.818 0.911 0.363 2e-61
Q8R2R6326 Mitochondrial GTPase 1 OS yes N/A 0.818 0.883 0.372 2e-58
Q4PS77332 Mitochondrial GTPase 1 OS yes N/A 0.821 0.870 0.365 3e-58
E3TDS3320 Mitochondrial GTPase 1 OS N/A N/A 0.809 0.890 0.372 3e-57
Q9BT17334 Mitochondrial GTPase 1 OS yes N/A 0.818 0.862 0.358 2e-56
Q29AU5320 Mitochondrial GTPase 1 OS yes N/A 0.818 0.9 0.358 1e-53
Q9VCU5323 Mitochondrial GTPase 1 OS yes N/A 0.818 0.891 0.338 2e-52
A9JTX2311 Mitochondrial GTPase 1 OS yes N/A 0.559 0.633 0.452 1e-45
O74776328 Mitochondrial GTPase 1 OS yes N/A 0.809 0.868 0.264 2e-22
B6JW87328 Mitochondrial GTPase 1 OS N/A N/A 0.457 0.490 0.329 4e-18
>sp|Q17EJ1|MTG1_AEDAE Mitochondrial GTPase 1 OS=Aedes aegypti GN=AAEL003813 PE=3 SV=1 Back     alignment and function desciption
 Score =  236 bits (602), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 126/347 (36%), Positives = 196/347 (56%), Gaps = 59/347 (17%)

Query: 1   MGRGLKDIEKHLKNVDIVIEVHDSRMPFTGRNHLLQQSVQNIRPMVLVLNKRDLINSKHE 60
           MG+G+K +++ LK VD VIEVHD+R+P +GRN   + ++  ++P +LVLNK+D I+ + +
Sbjct: 24  MGKGMKQMQQKLKQVDCVIEVHDARIPLSGRNSEFRYTISGVKPHILVLNKKDKIDRRLQ 83

Query: 61  SLIEEKVRKEQSHISEVIFTNCRNPNCKGVQKILPTLQHISDNMTRYHRTEVYNTTVMVV 120
             + +++++E S    ++FTNC++ +C                                 
Sbjct: 84  GRVVDRLQQEDSEARHILFTNCKDQSC--------------------------------- 110

Query: 121 GVPNVGKSSIINALRSSHMKKGKAVPILPTLQHISDNMTRYHRTEVYNTTVMVVGVPNVG 180
                      N +R           ++P  Q +  +  R++R +     +M++GVPNVG
Sbjct: 111 -----------NGIRK----------VMPLAQDLILSSNRFNRADQKEYCIMIIGVPNVG 149

Query: 181 KSSIINALRSSHMKKGKAVPVGPKAGVTRSVMSQVKISEKPLIYILDTPGISLPRIDNLE 240
           KSS+IN LR+ H+ K  A  VG  AG+TRSV++++KISE PL+Y+LDTPGI  P I + E
Sbjct: 150 KSSLINVLRNRHLNKKGASQVGAVAGITRSVLNKIKISEDPLVYLLDTPGILKPNIADTE 209

Query: 241 CGMRLAACATLQDHLVGEINIADYILFYLNRTGNYRYVDFFNLDEPSDDI--VMLLAKAA 298
            G+RLA  + LQDHLVGE  IADY+L+ LN+ GN++YV+   L EP+D I  V++     
Sbjct: 210 TGLRLALVSCLQDHLVGEELIADYLLYLLNKRGNFKYVELMGLKEPTDSIAEVLIAGSKH 269

Query: 299 IKKKWFKRAFDVSSNSVRMFPDTGEVARIFIEHFRKGSFGSVMLDRD 345
           + K    R +D    S  + PD    AR  I+ FR G+FG +++D D
Sbjct: 270 LDKTVRVRHYD---GSFVIRPDAMLAARHMIKAFRTGAFGKILIDDD 313




Mitochondrial GTPase. May be involved in assembly of the large ribosomal subunit.
Aedes aegypti (taxid: 7159)
>sp|Q8R2R6|MTG1_MOUSE Mitochondrial GTPase 1 OS=Mus musculus GN=Mtg1 PE=2 SV=2 Back     alignment and function description
>sp|Q4PS77|MTG1_BOVIN Mitochondrial GTPase 1 OS=Bos taurus GN=MTG1 PE=2 SV=2 Back     alignment and function description
>sp|E3TDS3|MTG1_ICTPU Mitochondrial GTPase 1 OS=Ictalurus punctatus GN=mtg1 PE=2 SV=1 Back     alignment and function description
>sp|Q9BT17|MTG1_HUMAN Mitochondrial GTPase 1 OS=Homo sapiens GN=MTG1 PE=1 SV=2 Back     alignment and function description
>sp|Q29AU5|MTG1_DROPS Mitochondrial GTPase 1 OS=Drosophila pseudoobscura pseudoobscura GN=GA14342 PE=3 SV=2 Back     alignment and function description
>sp|Q9VCU5|MTG1_DROME Mitochondrial GTPase 1 OS=Drosophila melanogaster GN=CG17141 PE=1 SV=2 Back     alignment and function description
>sp|A9JTX2|MTG1_XENTR Mitochondrial GTPase 1 OS=Xenopus tropicalis GN=mtg1 PE=2 SV=1 Back     alignment and function description
>sp|O74776|MTG1_SCHPO Mitochondrial GTPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mtg1 PE=3 SV=1 Back     alignment and function description
>sp|B6JW87|MTG1_SCHJY Mitochondrial GTPase 1 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=mtg1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query352
328713005314 PREDICTED: mitochondrial GTPase 1-like [ 0.826 0.926 0.400 2e-68
357616532335 mitochondrial GTPase 1 [Danaus plexippus 0.826 0.868 0.391 2e-64
91086203317 PREDICTED: similar to Mitochondrial GTPa 0.821 0.911 0.391 5e-64
158297975326 AGAP004736-PA [Anopheles gambiae str. PE 0.823 0.889 0.388 1e-63
350593188408 PREDICTED: mitochondrial GTPase 1 [Sus s 0.948 0.818 0.377 7e-62
157138211316 hypothetical protein AaeL_AAEL003813 [Ae 0.818 0.911 0.363 1e-59
395501203336 PREDICTED: mitochondrial GTPase 1 [Sarco 0.821 0.860 0.391 9e-59
350593186332 PREDICTED: mitochondrial GTPase 1 isofor 0.821 0.870 0.368 8e-58
170064624315 mitochondrial GTPase 1 [Culex quinquefas 0.826 0.923 0.368 9e-58
348507344319 PREDICTED: mitochondrial GTPase 1-like [ 0.812 0.896 0.368 2e-57
>gi|328713005|ref|XP_003244970.1| PREDICTED: mitochondrial GTPase 1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  265 bits (678), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 139/347 (40%), Positives = 206/347 (59%), Gaps = 56/347 (16%)

Query: 1   MGRGLKDIEKHLKNVDIVIEVHDSRMPFTGRNHLLQQSVQNIRPMVLVLNKRDLINSKHE 60
           MG+G+K +++ LK+VD +IEVHD+R+P +GRN   + S+  ++P +LVLNK DL +  ++
Sbjct: 24  MGKGMKQMQQKLKSVDCIIEVHDARIPLSGRNPDFKYSISGLKPHILVLNKMDLADLNYK 83

Query: 61  SLIEEKVRKEQSHISEVIFTNCRNPNCKGVQKILPTLQHISDNMTRYHRTEVYNTTVMVV 120
             +EEK+  EQ  IS++I+TNC+N  C                                 
Sbjct: 84  QKVEEKIMHEQK-ISKIIYTNCKNSLC--------------------------------- 109

Query: 121 GVPNVGKSSIINALRSSHMKKGKAVPILPTLQHISDNMTRYHRTEVYNTTVMVVGVPNVG 180
             P V K                   ++PT   +     RY+R+E  ++ +MV+GVPNVG
Sbjct: 110 --PGVKK-------------------VMPTALSLIKGSNRYNRSENTDSRIMVIGVPNVG 148

Query: 181 KSSIINALRSSHMKKGKAVPVGPKAGVTRSVMSQVKISEKPLIYILDTPGISLPRIDNLE 240
           KSS+IN++R++ + K  A PVG  AG+TR+V +Q+K+S  PL+Y+LDTPG+  P I N+E
Sbjct: 149 KSSLINSIRNTILGKKSAAPVGAVAGITRAVQNQIKVSHDPLVYVLDTPGVVSPTIKNVE 208

Query: 241 CGMRLAACATLQDHLVGEINIADYILFYLNRTGNYRYVDFFNLDEPSDDIVMLLAKAAIK 300
            G++LA CATLQDHLVGE  IADY+L++ N+   + YV + N DEP+DDI ++LAKAAI 
Sbjct: 209 TGLKLALCATLQDHLVGEEIIADYLLYWFNKNNYFDYVSYLNCDEPTDDIRIVLAKAAIH 268

Query: 301 KKWFKRAFDVSSNSVRMFPDTGEVARIFIEHFRKGSFGSVMLDRDFL 347
           +K   +  +   + +   PD   +AR F+  FR G FG V+LD D L
Sbjct: 269 RKSSIKYLNFDGSYIYR-PDMQGMARNFLNAFRTGVFGKVLLDNDLL 314




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|357616532|gb|EHJ70245.1| mitochondrial GTPase 1 [Danaus plexippus] Back     alignment and taxonomy information
>gi|91086203|ref|XP_971754.1| PREDICTED: similar to Mitochondrial GTPase 1, mitochondrial precursor (GTP-binding protein 7) [Tribolium castaneum] gi|270010239|gb|EFA06687.1| hypothetical protein TcasGA2_TC009617 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|158297975|ref|XP_318086.4| AGAP004736-PA [Anopheles gambiae str. PEST] gi|157014585|gb|EAA13293.4| AGAP004736-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|350593188|ref|XP_003483631.1| PREDICTED: mitochondrial GTPase 1 [Sus scrofa] Back     alignment and taxonomy information
>gi|157138211|ref|XP_001664178.1| hypothetical protein AaeL_AAEL003813 [Aedes aegypti] gi|122068838|sp|Q17EJ1.1|MTG1_AEDAE RecName: Full=Mitochondrial GTPase 1; Flags: Precursor gi|108880663|gb|EAT44888.1| AAEL003813-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|395501203|ref|XP_003754987.1| PREDICTED: mitochondrial GTPase 1 [Sarcophilus harrisii] Back     alignment and taxonomy information
>gi|350593186|ref|XP_001927683.3| PREDICTED: mitochondrial GTPase 1 isoform 1 [Sus scrofa] Back     alignment and taxonomy information
>gi|170064624|ref|XP_001867602.1| mitochondrial GTPase 1 [Culex quinquefasciatus] gi|167881951|gb|EDS45334.1| mitochondrial GTPase 1 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|348507344|ref|XP_003441216.1| PREDICTED: mitochondrial GTPase 1-like [Oreochromis niloticus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query352
UNIPROTKB|I3LR29336 LOC100153322 "Mitochondrial GT 0.630 0.660 0.428 3.4e-45
UNIPROTKB|Q4PS77332 MTG1 "Mitochondrial GTPase 1" 0.644 0.683 0.414 7.1e-45
ZFIN|ZDB-GENE-031110-2248 gtpbpl "GTP binding protein li 0.559 0.794 0.462 3.1e-44
MGI|MGI:2685015326 Mtg1 "mitochondrial GTPase 1 h 0.642 0.693 0.421 1e-43
UNIPROTKB|E7EVK2283 MTG1 "Mitochondrial GTPase 1" 0.375 0.466 0.410 1.2e-43
UNIPROTKB|Q9BT17334 MTG1 "Mitochondrial GTPase 1" 0.613 0.646 0.422 1.7e-43
UNIPROTKB|E9PI62339 MTG1 "Mitochondrial GTPase 1" 0.613 0.637 0.422 1.7e-43
RGD|6497155326 LOC100910751 "mitochondrial GT 0.642 0.693 0.421 7.3e-43
UNIPROTKB|J9NSS4212 LOC607676 "Uncharacterized pro 0.571 0.948 0.438 4e-42
FB|FBgn0039020323 CG17141 [Drosophila melanogast 0.556 0.606 0.434 8.9e-38
UNIPROTKB|I3LR29 LOC100153322 "Mitochondrial GTPase 1" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
 Score = 475 (172.3 bits), Expect = 3.4e-45, P = 3.4e-45
 Identities = 96/224 (42%), Positives = 142/224 (63%)

Query:   127 KSSIINALRSSHMKKGKAVPILPTLQHISDNMTRYHRTEVYNTTVMVVGVPNVGKSSIIN 186
             +  + N + ++ +K      I+P +  +  +  RYHR E     +MV+GVPNVGKSS+IN
Sbjct:   106 REGLKNVIFTNCVKDENIKQIIPKVTELVGSSCRYHRGESVEYCIMVIGVPNVGKSSLIN 165

Query:   187 ALRSSHMKKGKAVPVGPKAGVTRSVMSQVKISEKPLIYILDTPGISLPRIDNLECGMRLA 246
             ALR  H++KGKA  VG + G+TR+VMS+V++ E+PL+++LDTPG+  PRI N+E G++LA
Sbjct:   166 ALRRQHLRKGKATKVGGEPGITRAVMSRVQVCERPLMFLLDTPGVLAPRIQNVETGLKLA 225

Query:   247 ACATLQDHLVGEINIADYILFYLNRTGNYRYVDFFNLDEPSDDIVMLLAKAAIK-KKWFK 305
              C T+ DHLVGE  +ADY+L+ LNR     YV  + L +  DDI  +L + A++ +K  K
Sbjct:   226 LCGTVLDHLVGEETLADYLLYTLNRHQLLGYVQHYGLGQACDDITSVLKQVAVRLRKTQK 285

Query:   306 RAFDVSSNSVRMF-PDTGEVARIFIEHFRKGSFGSVMLDRDFLE 348
                   +  V +  P+    AR F+  FR G+ G VMLDRD L+
Sbjct:   286 VKVLTGTGDVNVVQPNYPAAARDFLRAFRSGALGPVMLDRDILQ 329


GO:0005739 "mitochondrion" evidence=IEA
GO:0005525 "GTP binding" evidence=IEA
UNIPROTKB|Q4PS77 MTG1 "Mitochondrial GTPase 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-031110-2 gtpbpl "GTP binding protein like" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:2685015 Mtg1 "mitochondrial GTPase 1 homolog (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E7EVK2 MTG1 "Mitochondrial GTPase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BT17 MTG1 "Mitochondrial GTPase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E9PI62 MTG1 "Mitochondrial GTPase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|6497155 LOC100910751 "mitochondrial GTPase 1-like" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|J9NSS4 LOC607676 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
FB|FBgn0039020 CG17141 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8R2R6MTG1_MOUSENo assigned EC number0.37240.81810.8834yesN/A
Q9BT17MTG1_HUMANNo assigned EC number0.35810.81810.8622yesN/A
O74776MTG1_SCHPONo assigned EC number0.26450.80960.8689yesN/A
Q4PS77MTG1_BOVINNo assigned EC number0.36570.82100.8704yesN/A
Q29AU5MTG1_DROPSNo assigned EC number0.35830.81810.9yesN/A
Q9VCU5MTG1_DROMENo assigned EC number0.33810.81810.8916yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query352
TIGR03596276 TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-bi 4e-47
PRK09563287 PRK09563, rbgA, GTPase YlqF; Reviewed 4e-42
cd01856171 cd01856, YlqF, Circularly permuted YlqF GTPase 3e-38
COG1161322 COG1161, COG1161, Predicted GTPases [General funct 2e-25
cd04178171 cd04178, Nucleostemin_like, A circularly permuted 1e-14
cd01859157 cd01859, MJ1464, An uncharacterized, circularly pe 7e-14
cd04178171 cd04178, Nucleostemin_like, A circularly permuted 3e-12
pfam01926117 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase 6e-12
cd01859157 cd01859, MJ1464, An uncharacterized, circularly pe 1e-11
cd01849146 cd01849, YlqF_related_GTPase, Circularly permuted 1e-11
cd01858157 cd01858, NGP_1, A novel nucleolar GTP-binding prot 4e-11
cd01855191 cd01855, YqeH, Circularly permuted YqeH GTPase 1e-08
cd01849146 cd01849, YlqF_related_GTPase, Circularly permuted 4e-07
cd01855191 cd01855, YqeH, Circularly permuted YqeH GTPase 4e-07
COG1159 298 COG1159, Era, GTPase [General function prediction 8e-07
cd00880161 cd00880, Era_like, E 9e-07
TIGR03597360 TIGR03597, GTPase_YqeH, ribosome biogenesis GTPase 3e-06
cd01857140 cd01857, HSR1_MMR1, A circularly permuted subfamil 4e-06
TIGR03597360 TIGR03597, GTPase_YqeH, ribosome biogenesis GTPase 5e-06
cd01854211 cd01854, YjeQ_EngC, Ribosomal interacting GTPase Y 9e-06
COG0370 653 COG0370, FeoB, Fe2+ transport system protein B [In 9e-06
cd01894157 cd01894, EngA1, EngA1 GTPase contains the first do 1e-05
cd01879159 cd01879, FeoB, Ferrous iron transport protein B (F 2e-05
cd01895174 cd01895, EngA2, EngA2 GTPase contains the second d 2e-05
TIGR03594429 TIGR03594, GTPase_EngA, ribosome-associated GTPase 3e-05
cd00882161 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s 3e-05
COG0486454 COG0486, ThdF, Predicted GTPase [General function 3e-05
PRK00093435 PRK00093, PRK00093, GTP-binding protein Der; Revie 3e-05
cd01857140 cd01857, HSR1_MMR1, A circularly permuted subfamil 4e-05
cd04163168 cd04163, Era, E 4e-05
PRK00093 435 PRK00093, PRK00093, GTP-binding protein Der; Revie 8e-05
pfam01926117 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase 1e-04
TIGR03594 429 TIGR03594, GTPase_EngA, ribosome-associated GTPase 1e-04
COG1160444 COG1160, COG1160, Predicted GTPases [General funct 1e-04
TIGR00436270 TIGR00436, era, GTP-binding protein Era 1e-04
TIGR03594429 TIGR03594, GTPase_EngA, ribosome-associated GTPase 2e-04
PRK00093435 PRK00093, PRK00093, GTP-binding protein Der; Revie 3e-04
COG1160 444 COG1160, COG1160, Predicted GTPases [General funct 3e-04
pfam02421190 pfam02421, FeoB_N, Ferrous iron transport protein 4e-04
PRK00089 292 PRK00089, era, GTPase Era; Reviewed 5e-04
TIGR00437 591 TIGR00437, feoB, ferrous iron transporter FeoB 6e-04
TIGR00450442 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPas 7e-04
PRK13796365 PRK13796, PRK13796, GTPase YqeH; Provisional 8e-04
PRK15494 339 PRK15494, era, GTPase Era; Provisional 0.001
TIGR00450442 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPas 0.002
PRK03003472 PRK03003, PRK03003, GTP-binding protein Der; Revie 0.002
PRK05291449 PRK05291, trmE, tRNA modification GTPase TrmE; Rev 0.002
PRK00098298 PRK00098, PRK00098, GTPase RsgA; Reviewed 0.002
PRK09518712 PRK09518, PRK09518, bifunctional cytidylate kinase 0.002
cd01876170 cd01876, YihA_EngB, YihA (EngB) GTPase family 0.003
TIGR00231162 TIGR00231, small_GTP, small GTP-binding protein do 0.004
PRK04213201 PRK04213, PRK04213, GTP-binding protein; Provision 0.004
>gnl|CDD|213833 TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
 Score =  160 bits (408), Expect = 4e-47
 Identities = 89/343 (25%), Positives = 149/343 (43%), Gaps = 74/343 (21%)

Query: 1   MGRGLKDIEKHLKNVDIVIEVHDSRMPFTGRNHLLQQSVQNIRPMVLVLNKRDLINSKHE 60
           M +  ++I++ LK VD+VIEV D+R+P + RN ++ +   N +P ++VLNK DL +    
Sbjct: 8   MAKARREIKEKLKLVDVVIEVLDARIPLSSRNPMIDEIRGN-KPRLIVLNKADLADPAVT 66

Query: 61  SLIEEKVRKEQSHISEVIFTNCRNPNCKGVQKILPTLQHISDNMTRYHRTEVYNTTVMVV 120
               +   ++     + +  N +    KGV+KI+                          
Sbjct: 67  KQWLKYFEEKGI---KALAINAKKG--KGVKKIIK------------------------- 96

Query: 121 GVPNVGKSSIINALRSSHMKKGKAVPILPTLQHISDNMTRYHRTEVYNTTVMVVGVPNVG 180
                        L     +K KA  +L                       M+VG+PNVG
Sbjct: 97  ---------AAKKLLKEKNEKLKAKGLLNR-----------------PIRAMIVGIPNVG 130

Query: 181 KSSIINALRSSHMKKGKAVPVGPKAGVTRSVMSQVKISEKPLIYILDTPGISLPRIDNLE 240
           KS++IN      +   K   VG + GVT+     +K+S+   + +LDTPGI  P+ ++ E
Sbjct: 131 KSTLIN-----RLAGKKVAKVGNRPGVTKG-QQWIKLSDG--LELLDTPGILWPKFEDQE 182

Query: 241 CGMRLAACATLQDHLVGEINIADYILFYLNRTGNYRYVDFFNLDEPSDDIVMLLAKAAIK 300
            G++LAA   ++D  +   ++A ++L YL         + + LDE  +DIV LL   A K
Sbjct: 183 VGLKLAATGAIKDEALDLEDVALFLLEYLLEHYPELLKERYKLDELPEDIVELLEAIAKK 242

Query: 301 KKWFKRAFDVSSNSVRMFPDTGEVARIFIEHFRKGSFGSVMLD 343
           +    +  ++         D    A I +  FRKG  G + L+
Sbjct: 243 RGCLLKGGEL---------DLDRAAEILLNDFRKGKLGRITLE 276


Members of this protein family are GTP-binding proteins involved in ribosome biogenesis, including the essential YlqF protein of Bacillus subtilis, which is an essential protein. They are related to Era, EngA, and other GTPases of ribosome biogenesis, but are circularly permuted. This family is not universal, and is not present in Escherichia coli, and so is not as well studied as some other GTPases. This model is built for bacterial members [Protein synthesis, Other]. Length = 276

>gnl|CDD|236570 PRK09563, rbgA, GTPase YlqF; Reviewed Back     alignment and domain information
>gnl|CDD|206749 cd01856, YlqF, Circularly permuted YlqF GTPase Back     alignment and domain information
>gnl|CDD|224083 COG1161, COG1161, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|206753 cd04178, Nucleostemin_like, A circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|206752 cd01859, MJ1464, An uncharacterized, circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|206753 cd04178, Nucleostemin_like, A circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|216791 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase Back     alignment and domain information
>gnl|CDD|206752 cd01859, MJ1464, An uncharacterized, circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|206746 cd01849, YlqF_related_GTPase, Circularly permuted YlqF-related GTPases Back     alignment and domain information
>gnl|CDD|206751 cd01858, NGP_1, A novel nucleolar GTP-binding protein, circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|206748 cd01855, YqeH, Circularly permuted YqeH GTPase Back     alignment and domain information
>gnl|CDD|206746 cd01849, YlqF_related_GTPase, Circularly permuted YlqF-related GTPases Back     alignment and domain information
>gnl|CDD|206748 cd01855, YqeH, Circularly permuted YqeH GTPase Back     alignment and domain information
>gnl|CDD|224081 COG1159, Era, GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|206646 cd00880, Era_like, E Back     alignment and domain information
>gnl|CDD|213834 TIGR03597, GTPase_YqeH, ribosome biogenesis GTPase YqeH Back     alignment and domain information
>gnl|CDD|206750 cd01857, HSR1_MMR1, A circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|213834 TIGR03597, GTPase_YqeH, ribosome biogenesis GTPase YqeH Back     alignment and domain information
>gnl|CDD|206747 cd01854, YjeQ_EngC, Ribosomal interacting GTPase YjeQ/EngC, a circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|223447 COG0370, FeoB, Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|206681 cd01894, EngA1, EngA1 GTPase contains the first domain of EngA Back     alignment and domain information
>gnl|CDD|206667 cd01879, FeoB, Ferrous iron transport protein B (FeoB) family Back     alignment and domain information
>gnl|CDD|206682 cd01895, EngA2, EngA2 GTPase contains the second domain of EngA Back     alignment and domain information
>gnl|CDD|234274 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA Back     alignment and domain information
>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|223561 COG0486, ThdF, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|234628 PRK00093, PRK00093, GTP-binding protein Der; Reviewed Back     alignment and domain information
>gnl|CDD|206750 cd01857, HSR1_MMR1, A circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|206726 cd04163, Era, E Back     alignment and domain information
>gnl|CDD|234628 PRK00093, PRK00093, GTP-binding protein Der; Reviewed Back     alignment and domain information
>gnl|CDD|216791 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase Back     alignment and domain information
>gnl|CDD|234274 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA Back     alignment and domain information
>gnl|CDD|224082 COG1160, COG1160, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|129528 TIGR00436, era, GTP-binding protein Era Back     alignment and domain information
>gnl|CDD|234274 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA Back     alignment and domain information
>gnl|CDD|234628 PRK00093, PRK00093, GTP-binding protein Der; Reviewed Back     alignment and domain information
>gnl|CDD|224082 COG1160, COG1160, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|217025 pfam02421, FeoB_N, Ferrous iron transport protein B Back     alignment and domain information
>gnl|CDD|234624 PRK00089, era, GTPase Era; Reviewed Back     alignment and domain information
>gnl|CDD|232975 TIGR00437, feoB, ferrous iron transporter FeoB Back     alignment and domain information
>gnl|CDD|232980 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPase TrmE Back     alignment and domain information
>gnl|CDD|237511 PRK13796, PRK13796, GTPase YqeH; Provisional Back     alignment and domain information
>gnl|CDD|185391 PRK15494, era, GTPase Era; Provisional Back     alignment and domain information
>gnl|CDD|232980 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPase TrmE Back     alignment and domain information
>gnl|CDD|179525 PRK03003, PRK03003, GTP-binding protein Der; Reviewed Back     alignment and domain information
>gnl|CDD|235392 PRK05291, trmE, tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>gnl|CDD|234631 PRK00098, PRK00098, GTPase RsgA; Reviewed Back     alignment and domain information
>gnl|CDD|236546 PRK09518, PRK09518, bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>gnl|CDD|206665 cd01876, YihA_EngB, YihA (EngB) GTPase family Back     alignment and domain information
>gnl|CDD|232886 TIGR00231, small_GTP, small GTP-binding protein domain Back     alignment and domain information
>gnl|CDD|179790 PRK04213, PRK04213, GTP-binding protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 352
PRK09563287 rbgA GTPase YlqF; Reviewed 100.0
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 100.0
KOG2485|consensus335 100.0
KOG2484|consensus435 100.0
COG1161322 Predicted GTPases [General function prediction onl 100.0
KOG1424|consensus562 100.0
KOG2423|consensus 572 100.0
COG1160444 Predicted GTPases [General function prediction onl 99.97
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 99.96
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 99.95
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 99.94
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 99.94
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 99.93
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 99.93
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 99.93
PRK12289352 GTPase RsgA; Reviewed 99.91
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 99.91
PRK13796365 GTPase YqeH; Provisional 99.9
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.9
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 99.89
PRK12288347 GTPase RsgA; Reviewed 99.89
PRK00093435 GTP-binding protein Der; Reviewed 99.88
PRK00098298 GTPase RsgA; Reviewed 99.87
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 99.87
PRK03003472 GTP-binding protein Der; Reviewed 99.87
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.85
COG1162301 Predicted GTPases [General function prediction onl 99.8
PRK01889356 GTPase RsgA; Reviewed 99.72
COG1159 298 Era GTPase [General function prediction only] 99.68
COG1084346 Predicted GTPase [General function prediction only 99.59
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 99.59
COG1160 444 Predicted GTPases [General function prediction onl 99.58
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 99.56
COG0486454 ThdF Predicted GTPase [General function prediction 99.49
PTZ00258 390 GTP-binding protein; Provisional 99.48
PRK09601 364 GTP-binding protein YchF; Reviewed 99.44
cd01900274 YchF YchF subfamily. YchF is a member of the Obg f 99.43
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 99.41
PRK12298390 obgE GTPase CgtA; Reviewed 99.37
KOG1191|consensus531 99.37
TIGR00436270 era GTP-binding protein Era. Era is an essential G 99.36
COG0218200 Predicted GTPase [General function prediction only 99.32
KOG1423|consensus 379 99.32
COG0012 372 Predicted GTPase, probable translation factor [Tra 99.31
COG0536369 Obg Predicted GTPase [General function prediction 99.26
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 99.24
PRK09602 396 translation-associated GTPase; Reviewed 99.21
PRK15494 339 era GTPase Era; Provisional 99.21
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 99.21
PRK00089 292 era GTPase Era; Reviewed 99.2
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic io 99.18
cd01899 318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 99.18
PRK12296 500 obgE GTPase CgtA; Reviewed 99.17
PRK12299335 obgE GTPase CgtA; Reviewed 99.17
KOG1489|consensus366 99.17
KOG1491|consensus 391 99.16
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 99.15
KOG1547|consensus 336 99.14
TIGR00991313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 99.13
PRK12297424 obgE GTPase CgtA; Reviewed 99.12
TIGR00092 368 GTP-binding protein YchF. This predicted GTP-bindi 99.11
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 99.1
COG1159298 Era GTPase [General function prediction only] 99.1
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 99.05
KOG1490|consensus 620 99.05
KOG1249|consensus572 99.04
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 99.03
PRK03003 472 GTP-binding protein Der; Reviewed 99.01
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 99.01
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 99.0
COG1163 365 DRG Predicted GTPase [General function prediction 98.98
PRK11058426 GTPase HflX; Provisional 98.97
COG3596296 Predicted GTPase [General function prediction only 98.96
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 98.95
PF04548212 AIG1: AIG1 family; InterPro: IPR006703 This entry 98.94
TIGR00436270 era GTP-binding protein Era. Era is an essential G 98.94
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 98.93
cd01896233 DRG The developmentally regulated GTP-binding prot 98.92
PRK04213201 GTP-binding protein; Provisional 98.92
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 98.91
TIGR00993 763 3a0901s04IAP86 chloroplast protein import componen 98.91
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 98.9
COG0486454 ThdF Predicted GTPase [General function prediction 98.89
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 98.88
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 98.87
COG5019 373 CDC3 Septin family protein [Cell division and chro 98.86
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 98.86
COG2262411 HflX GTPases [General function prediction only] 98.85
PRK15467158 ethanolamine utilization protein EutP; Provisional 98.84
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 98.84
KOG2655|consensus 366 98.84
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 98.84
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 98.83
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 98.83
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 98.82
cd01878204 HflX HflX subfamily. A distinct conserved domain w 98.8
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 98.8
PRK15494339 era GTPase Era; Provisional 98.8
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 98.79
COG2262411 HflX GTPases [General function prediction only] 98.79
PRK00454196 engB GTP-binding protein YsxC; Reviewed 98.78
PRK00089292 era GTPase Era; Reviewed 98.78
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 98.77
PRK00093435 GTP-binding protein Der; Reviewed 98.76
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 98.75
PRK09866 741 hypothetical protein; Provisional 98.75
cd04171164 SelB SelB subfamily. SelB is an elongation factor 98.75
cd01881176 Obg_like The Obg-like subfamily consists of five w 98.74
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 98.71
PF00735281 Septin: Septin; InterPro: IPR000038 Septins consti 98.7
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 98.68
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 98.67
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 98.67
cd00881189 GTP_translation_factor GTP translation factor fami 98.67
cd01851224 GBP Guanylate-binding protein (GBP), N-terminal do 98.66
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved fam 98.65
PRK12299335 obgE GTPase CgtA; Reviewed 98.65
PF05049 376 IIGP: Interferon-inducible GTPase (IIGP); InterPro 98.64
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 98.64
cd04171164 SelB SelB subfamily. SelB is an elongation factor 98.63
PRK12296500 obgE GTPase CgtA; Reviewed 98.63
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 98.62
cd01878204 HflX HflX subfamily. A distinct conserved domain w 98.62
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 98.6
TIGR00231161 small_GTP small GTP-binding protein domain. This m 98.59
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 98.58
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 98.58
PRK12298390 obgE GTPase CgtA; Reviewed 98.57
TIGR00437 591 feoB ferrous iron transporter FeoB. FeoB (773 amin 98.57
PTZ00327460 eukaryotic translation initiation factor 2 gamma s 98.54
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 98.51
PRK10512 614 selenocysteinyl-tRNA-specific translation factor; 98.51
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 98.5
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 98.49
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 98.47
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 98.47
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 98.47
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 98.47
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 98.47
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 98.46
PRK12297424 obgE GTPase CgtA; Reviewed 98.46
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 98.45
COG0218200 Predicted GTPase [General function prediction only 98.45
COG4917148 EutP Ethanolamine utilization protein [Amino acid 98.43
TIGR00475 581 selB selenocysteine-specific elongation factor Sel 98.43
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 98.43
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 98.42
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 98.42
PRK04000411 translation initiation factor IF-2 subunit gamma; 98.41
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 98.4
PRK00454196 engB GTP-binding protein YsxC; Reviewed 98.4
KOG1486|consensus 364 98.39
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 98.39
TIGR03680406 eif2g_arch translation initiation factor 2 subunit 98.39
PTZ00099176 rab6; Provisional 98.39
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 98.39
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 98.39
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 98.37
cd01881176 Obg_like The Obg-like subfamily consists of five w 98.37
smart00178184 SAR Sar1p-like members of the Ras-family of small 98.37
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 98.36
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 98.36
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 98.36
PRK11058426 GTPase HflX; Provisional 98.36
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 98.36
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 98.35
KOG1489|consensus366 98.35
cd00154159 Rab Rab family. Rab GTPases form the largest famil 98.35
PRK13768253 GTPase; Provisional 98.35
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 98.34
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 98.34
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 98.34
KOG1423|consensus379 98.33
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 98.33
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 98.33
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 98.33
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 98.33
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 98.33
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 98.33
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 98.32
PLN03118211 Rab family protein; Provisional 98.32
COG0536369 Obg Predicted GTPase [General function prediction 98.31
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 98.31
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 98.31
TIGR01393 595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 98.31
PRK12317 425 elongation factor 1-alpha; Reviewed 98.3
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 98.3
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 98.29
PRK05433 600 GTP-binding protein LepA; Provisional 98.29
cd00881189 GTP_translation_factor GTP translation factor fami 98.29
KOG0410|consensus410 98.29
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 98.28
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 98.27
PLN00223181 ADP-ribosylation factor; Provisional 98.27
TIGR02836 492 spore_IV_A stage IV sporulation protein A. A compa 98.27
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 98.27
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 98.27
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 98.27
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 98.26
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 98.26
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 98.26
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 98.25
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 98.24
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 98.24
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 98.23
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 98.23
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 98.23
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 98.23
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 98.23
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 98.23
TIGR02034406 CysN sulfate adenylyltransferase, large subunit. H 98.22
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 98.22
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 98.22
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 98.22
PRK12736394 elongation factor Tu; Reviewed 98.22
TIGR00484 689 EF-G translation elongation factor EF-G. After pep 98.22
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 98.21
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 98.21
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 98.21
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 98.21
PTZ00133182 ADP-ribosylation factor; Provisional 98.21
PRK15467158 ethanolamine utilization protein EutP; Provisional 98.21
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 98.2
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 98.2
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 98.2
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 98.19
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 98.19
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 98.19
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 98.19
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 98.18
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 98.18
CHL00071 409 tufA elongation factor Tu 98.18
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 98.18
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 98.18
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 98.18
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 98.18
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 98.18
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 98.18
smart00178184 SAR Sar1p-like members of the Ras-family of small 98.18
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 98.17
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 98.17
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 98.16
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 98.16
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 98.16
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 98.16
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 98.15
PF00350168 Dynamin_N: Dynamin family; InterPro: IPR001401 Mem 98.15
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 98.15
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 98.15
cd04123162 Rab21 Rab21 subfamily. The localization and functi 98.15
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 98.14
CHL00071409 tufA elongation factor Tu 98.14
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 98.14
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 98.13
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 98.13
PF00025175 Arf: ADP-ribosylation factor family The prints ent 98.13
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 98.12
cd00154159 Rab Rab family. Rab GTPases form the largest famil 98.12
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 98.12
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 98.12
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 98.12
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 98.11
PRK00007 693 elongation factor G; Reviewed 98.11
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 98.11
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 98.11
cd04123162 Rab21 Rab21 subfamily. The localization and functi 98.11
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 98.11
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 98.11
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 98.11
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 98.1
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 98.1
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 98.1
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 98.1
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 98.1
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 98.1
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 98.1
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 98.09
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 98.09
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 98.09
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 98.08
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 98.08
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 98.08
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 98.07
PRK12317425 elongation factor 1-alpha; Reviewed 98.07
cd00876160 Ras Ras family. The Ras family of the Ras superfam 98.07
PRK12735 396 elongation factor Tu; Reviewed 98.07
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 98.07
PRK00049396 elongation factor Tu; Reviewed 98.06
TIGR00487 587 IF-2 translation initiation factor IF-2. This mode 98.06
PTZ00369189 Ras-like protein; Provisional 98.06
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 98.06
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 98.06
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 98.06
PRK12739 691 elongation factor G; Reviewed 98.06
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 98.05
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 98.05
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 98.05
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 98.04
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 98.04
PRK05506 632 bifunctional sulfate adenylyltransferase subunit 1 98.04
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 98.04
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 98.04
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 98.04
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 98.03
PRK04213201 GTP-binding protein; Provisional 98.03
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 98.02
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 98.02
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 98.02
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 98.01
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 98.01
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 98.01
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 98.01
TIGR00483426 EF-1_alpha translation elongation factor EF-1 alph 98.01
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 98.01
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 98.01
PLN03127 447 Elongation factor Tu; Provisional 98.0
TIGR00485394 EF-Tu translation elongation factor TU. This align 98.0
PLN03118211 Rab family protein; Provisional 98.0
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 98.0
PRK05124474 cysN sulfate adenylyltransferase subunit 1; Provis 98.0
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 97.99
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 97.99
CHL00189742 infB translation initiation factor 2; Provisional 97.99
PLN03071219 GTP-binding nuclear protein Ran; Provisional 97.98
PTZ00133182 ADP-ribosylation factor; Provisional 97.98
PLN03127447 Elongation factor Tu; Provisional 97.98
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 97.98
PRK12735396 elongation factor Tu; Reviewed 97.98
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 97.97
PLN03071219 GTP-binding nuclear protein Ran; Provisional 97.97
TIGR01394 594 TypA_BipA GTP-binding protein TypA/BipA. This bact 97.97
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 97.96
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 97.96
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 97.96
cd00876160 Ras Ras family. The Ras family of the Ras superfam 97.95
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 97.95
TIGR00437 591 feoB ferrous iron transporter FeoB. FeoB (773 amin 97.95
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 97.95
TIGR00491 590 aIF-2 translation initiation factor aIF-2/yIF-2. T 97.95
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 97.95
PRK05306 787 infB translation initiation factor IF-2; Validated 97.95
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 97.95
TIGR00231161 small_GTP small GTP-binding protein domain. This m 97.94
KOG2486|consensus320 97.94
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 97.94
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 97.94
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 97.93
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 97.93
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 97.93
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 97.93
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 97.93
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 97.93
PLN03108210 Rab family protein; Provisional 97.92
KOG0462|consensus 650 97.92
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 97.92
PRK00049 396 elongation factor Tu; Reviewed 97.91
COG0532509 InfB Translation initiation factor 2 (IF-2; GTPase 97.91
TIGR00487587 IF-2 translation initiation factor IF-2. This mode 97.91
PLN03126478 Elongation factor Tu; Provisional 97.91
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 97.91
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 97.9
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 97.9
PLN03110216 Rab GTPase; Provisional 97.9
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 97.9
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 97.89
PRK05306787 infB translation initiation factor IF-2; Validated 97.89
KOG1191|consensus531 97.89
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 97.88
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 97.88
PRK14845 1049 translation initiation factor IF-2; Provisional 97.88
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 97.86
PLN03110216 Rab GTPase; Provisional 97.86
PRK10218 607 GTP-binding protein; Provisional 97.86
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 97.86
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 97.86
KOG0075|consensus186 97.86
PTZ00369189 Ras-like protein; Provisional 97.85
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 97.85
PRK05506 632 bifunctional sulfate adenylyltransferase subunit 1 97.85
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 97.85
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 97.85
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 97.84
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 97.84
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 97.84
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 97.84
KOG1487|consensus 358 97.83
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 97.82
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 97.82
COG3276447 SelB Selenocysteine-specific translation elongatio 97.82
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 97.82
PRK12736 394 elongation factor Tu; Reviewed 97.81
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 97.81
TIGR00475 581 selB selenocysteine-specific elongation factor Sel 97.81
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 97.8
PLN00223181 ADP-ribosylation factor; Provisional 97.8
PLN03108210 Rab family protein; Provisional 97.8
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 97.8
TIGR00485 394 EF-Tu translation elongation factor TU. This align 97.79
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 97.79
CHL00189 742 infB translation initiation factor 2; Provisional 97.78
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 97.77
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 97.76
COG2895431 CysN GTPases - Sulfate adenylate transferase subun 97.76
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 97.75
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 97.75
PRK04004 586 translation initiation factor IF-2; Validated 97.74
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 97.74
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 97.73
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 97.73
COG5257415 GCD11 Translation initiation factor 2, gamma subun 97.73
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 97.72
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 97.72
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 97.7
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 97.7
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 97.69
COG2229187 Predicted GTPase [General function prediction only 97.69
PLN03126 478 Elongation factor Tu; Provisional 97.69
PTZ00141446 elongation factor 1- alpha; Provisional 97.69
TIGR00491 590 aIF-2 translation initiation factor aIF-2/yIF-2. T 97.68
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 97.67
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 97.66
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 97.65
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 97.65
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 97.65
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 97.64
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 97.63
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 97.63
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 97.62
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate v 97.62
cd01896233 DRG The developmentally regulated GTP-binding prot 97.61
KOG0078|consensus207 97.6
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 97.59
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 97.59
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 97.59
cd04105203 SR_beta Signal recognition particle receptor, beta 97.58
PRK12739 691 elongation factor G; Reviewed 97.56
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 97.55
PRK05124 474 cysN sulfate adenylyltransferase subunit 1; Provis 97.55
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 97.55
TIGR00503 527 prfC peptide chain release factor 3. This translat 97.54
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 97.54
TIGR00483 426 EF-1_alpha translation elongation factor EF-1 alph 97.52
PRK09435332 membrane ATPase/protein kinase; Provisional 97.52
KOG1145|consensus 683 97.52
PRK00007 693 elongation factor G; Reviewed 97.51
COG1100219 GTPase SAR1 and related small G proteins [General 97.51
PRK10512 614 selenocysteinyl-tRNA-specific translation factor; 97.5
KOG0073|consensus185 97.5
KOG0094|consensus221 97.49
COG5256428 TEF1 Translation elongation factor EF-1alpha (GTPa 97.48
PF00025175 Arf: ADP-ribosylation factor family The prints ent 97.47
PLN00043447 elongation factor 1-alpha; Provisional 97.47
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 97.46
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 97.45
PRK13351 687 elongation factor G; Reviewed 97.45
KOG0072|consensus182 97.44
PRK00741 526 prfC peptide chain release factor 3; Provisional 97.44
PRK04004 586 translation initiation factor IF-2; Validated 97.44
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 97.43
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 97.43
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 97.42
KOG0092|consensus200 97.41
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic io 97.41
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 97.41
TIGR01393 595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 97.41
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 97.39
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 97.39
COG0481 603 LepA Membrane GTPase LepA [Cell envelope biogenesi 97.39
KOG0076|consensus197 97.36
PRK10218 607 GTP-binding protein; Provisional 97.36
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 97.34
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 97.32
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 97.32
KOG0073|consensus185 97.31
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 97.29
PRK00741526 prfC peptide chain release factor 3; Provisional 97.29
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 97.28
TIGR02034 406 CysN sulfate adenylyltransferase, large subunit. H 97.26
KOG3859|consensus 406 97.26
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 97.25
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 97.24
KOG0084|consensus205 97.24
PRK12740 668 elongation factor G; Reviewed 97.22
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 97.22
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 97.21
COG1217 603 TypA Predicted membrane GTPase involved in stress 97.21
COG1163365 DRG Predicted GTPase [General function prediction 97.2
PRK13351 687 elongation factor G; Reviewed 97.19
TIGR00101199 ureG urease accessory protein UreG. This model rep 97.15
KOG0461|consensus522 97.13
TIGR01394 594 TypA_BipA GTP-binding protein TypA/BipA. This bact 97.11
PRK09866 741 hypothetical protein; Provisional 97.1
TIGR00503527 prfC peptide chain release factor 3. This translat 97.1
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 97.06
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 97.05
KOG1532|consensus366 97.05
TIGR00484 689 EF-G translation elongation factor EF-G. After pep 97.03
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate v 97.02
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 97.01
PF09439181 SRPRB: Signal recognition particle receptor beta s 97.0
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
Probab=100.00  E-value=3.8e-47  Score=350.89  Aligned_cols=273  Identities=28%  Similarity=0.484  Sum_probs=233.9

Q ss_pred             ChhHHHHHHHHhhccCEEEEEEcCCCCCCCcCHHHHHHHhCCCCEEEEEEcccCCCccchHHHHHHHHhhcCCCCcEEEe
Q psy15351          1 MGRGLKDIEKHLKNVDIVIEVHDSRMPFTGRNHLLQQSVQNIRPMVLVLNKRDLINSKHESLIEEKVRKEQSHISEVIFT   80 (352)
Q Consensus         1 m~~~~~~~~~~i~~aD~vl~VvDar~p~~~~~~~l~~~l~~~k~~ilVlNK~Dl~~~~~~~~~~~~~~~~~~~~~~v~~i   80 (352)
                      |+|+++++++.+++||+||+|+|+|.|+++.++.+.+++ .++|+++|+||+||+++.....|.+++++.+..   ++++
T Consensus        11 m~k~~~~l~~~l~~aDvIL~VvDar~p~~~~~~~l~~~~-~~kp~iiVlNK~DL~~~~~~~~~~~~~~~~~~~---vi~v   86 (287)
T PRK09563         11 MAKARREIKENLKLVDVVIEVLDARIPLSSENPMIDKII-GNKPRLLILNKSDLADPEVTKKWIEYFEEQGIK---ALAI   86 (287)
T ss_pred             HHHHHHHHHHHhhhCCEEEEEEECCCCCCCCChhHHHHh-CCCCEEEEEEchhcCCHHHHHHHHHHHHHcCCe---EEEE
Confidence            899999999999999999999999999999999888877 589999999999998776567888888655544   8999


Q ss_pred             ecCCCCCCCHHHHHHHHHHHhhhccccccccccceeEEEeccCCCCchhHHHHHhhhhcccCCCCCCCcchhhhhccccc
Q psy15351         81 NCRNPNCKGVQKILPTLQHISDNMTRYHRTEVYNTTVMVVGVPNVGKSSIINALRSSHMKKGKAVPILPTLQHISDNMTR  160 (352)
Q Consensus        81 Sa~~~~~~gi~~L~~~i~~~~~~~~~~~~~~~~~~~~~~~g~~nvgksslin~l~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (352)
                      ||+++  .|+++|++.+.+++++...+                          .+                         
T Consensus        87 Sa~~~--~gi~~L~~~l~~~l~~~~~~--------------------------~~-------------------------  113 (287)
T PRK09563         87 NAKKG--QGVKKILKAAKKLLKEKNER--------------------------RK-------------------------  113 (287)
T ss_pred             ECCCc--ccHHHHHHHHHHHHHHHHhh--------------------------hh-------------------------
Confidence            99999  99999999988877642100                          00                         


Q ss_pred             cccccCcceEEEEeCCCCCChHHHHHHHhCCCCCCCCceecCCCCCceeEeeeeEEecCCCcEEEEeCCCCCCCCCCCHH
Q psy15351        161 YHRTEVYNTTVMVVGVPNVGKSSIINALRSSHMKKGKAVPVGPKAGVTRSVMSQVKISEKPLIYILDTPGISLPRIDNLE  240 (352)
Q Consensus       161 ~~~~~~~~~~v~i~G~pnvGKStliN~l~~~~~~~~~~~~~~~~pg~T~~~~~~~~~~~~~~~~l~DtPGi~~~~~~~~~  240 (352)
                      ........++++++|.|||||||+||+|.+     .+.+.+++.||+|++.+ .+..  +.+++++||||+..+...+.+
T Consensus       114 ~~~~~~~~~~~~~~G~pnvGKSsliN~l~~-----~~~~~~~~~~g~T~~~~-~~~~--~~~~~l~DtPGi~~~~~~~~~  185 (287)
T PRK09563        114 AKGMRPRAIRAMIIGIPNVGKSTLINRLAG-----KKIAKTGNRPGVTKAQQ-WIKL--GKGLELLDTPGILWPKLEDQE  185 (287)
T ss_pred             hcccCcCceEEEEECCCCCCHHHHHHHHhc-----CCccccCCCCCeEEEEE-EEEe--CCcEEEEECCCcCCCCCCcHH
Confidence            000113568999999999999999999997     56678999999999986 4444  346999999999999888888


Q ss_pred             HHHHHHHHhhhhhhccchhhhhHhHHhhhcCCCCCcccccccCCCCCccHHHHHHHHHHHhccccccccccCCcccCCCC
Q psy15351        241 CGMRLAACATLQDHLVGEINIADYILFYLNRTGNYRYVDFFNLDEPSDDIVMLLAKAAIKKKWFKRAFDVSSNSVRMFPD  320 (352)
Q Consensus       241 ~~~~l~~~~~i~~~~~~~~~~~~~il~~~~~~~~~~~~~~~~l~~~~~~~~~~l~~~a~~~g~~~~~~~~~~g~~~~~~d  320 (352)
                      .+.++++++++.+..++...++++++..+++..+..+...|+++.+.+++.++|+.+|+++|++.++         |.||
T Consensus       186 ~~~~l~~~~~i~~~~~~~~~~~~~ll~~l~~~~~~~l~~~y~~~~~~~~~~~~l~~~a~~~g~~~k~---------g~~D  256 (287)
T PRK09563        186 VGLKLALTGAIKDEALDLEEVAIFALEYLSKHYPERLKERYKLDELPEDILELLEAIARKRGALRKG---------GEID  256 (287)
T ss_pred             HHHHHHHhCCcchhhcChHHHHHHHHHHHHhhCHHHHHHHhCCCCCCCCHHHHHHHHHHHhCccccC---------CccC
Confidence            8899999999999999999999999999998877778889999877678999999999999998764         6899


Q ss_pred             HHHHHHHHHHHHhCCCCcceecCcccc
Q psy15351        321 TGEVARIFIEHFRKGSFGSVMLDRDFL  347 (352)
Q Consensus       321 ~~~a~~~~l~~~~~g~l~~~~~~~~~~  347 (352)
                      +.+||+.+|++|++|+||++++|.++.
T Consensus       257 ~~~aa~~~l~d~~~Gklg~~~ld~~~~  283 (287)
T PRK09563        257 YERASELLLNEFRNGKLGKITLETPEM  283 (287)
T ss_pred             HHHHHHHHHHHHHcCCCCcEEccCCcc
Confidence            999999999999999999999998864



>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>KOG2485|consensus Back     alignment and domain information
>KOG2484|consensus Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>KOG1424|consensus Back     alignment and domain information
>KOG2423|consensus Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>PTZ00258 GTP-binding protein; Provisional Back     alignment and domain information
>PRK09601 GTP-binding protein YchF; Reviewed Back     alignment and domain information
>cd01900 YchF YchF subfamily Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>KOG1191|consensus Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG1423|consensus Back     alignment and domain information
>COG0012 Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>KOG1489|consensus Back     alignment and domain information
>KOG1491|consensus Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>KOG1547|consensus Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>TIGR00092 GTP-binding protein YchF Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>KOG1490|consensus Back     alignment and domain information
>KOG1249|consensus Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>COG3596 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton] Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>KOG2655|consensus Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>KOG1486|consensus Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>PTZ00099 rab6; Provisional Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>KOG1489|consensus Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>KOG1423|consensus Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>KOG0410|consensus Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>TIGR02836 spore_IV_A stage IV sporulation protein A Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>KOG2486|consensus Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>KOG0462|consensus Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>KOG1191|consensus Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>PRK14845 translation initiation factor IF-2; Provisional Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>KOG0075|consensus Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>KOG1487|consensus Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>COG2229 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>smart00053 DYNc Dynamin, GTPase Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>KOG0078|consensus Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>KOG1145|consensus Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>KOG0073|consensus Back     alignment and domain information
>KOG0094|consensus Back     alignment and domain information
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>KOG0072|consensus Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>KOG0092|consensus Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG0076|consensus Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>KOG0073|consensus Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>KOG3859|consensus Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>KOG0084|consensus Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>KOG0461|consensus Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>KOG1532|consensus Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>smart00053 DYNc Dynamin, GTPase Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query352
1puj_A282 Structure Of B. Subtilis Ylqf Gtpase Length = 282 2e-16
3r9w_A 307 Crystal Structure Of Era In Complex With Mggdpnp An 2e-06
3iev_A 308 Crystal Structure Of Era In Complex With Mggnp And 2e-06
3cnl_A262 Crystal Structure Of Gnp-Bound Ylqf From T. Maritim 9e-06
3cnl_A262 Crystal Structure Of Gnp-Bound Ylqf From T. Maritim 1e-05
1xzp_A482 Structure Of The Gtp-Binding Protein Trme From Ther 1e-04
1wf3_A 301 Crystal Structure Of Gtp-Binding Protein Tt1341 Fro 7e-04
>pdb|1PUJ|A Chain A, Structure Of B. Subtilis Ylqf Gtpase Length = 282 Back     alignment and structure

Iteration: 1

Score = 83.2 bits (204), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 70/294 (23%), Positives = 133/294 (45%), Gaps = 65/294 (22%) Query: 1 MGRGLKDIEKHLKNVDIVIEVHDSRMPFTGRNHLLQQSVQNIRPMVLVLNKRDLINSKHE 60 M + +++ + LK +DIV E+ D+R+P + RN +++ ++N +P +++LNK D K + Sbjct: 10 MAKARREVTEKLKLIDIVYELVDARIPMSSRNPMIEDILKN-KPRIMLLNKAD----KAD 64 Query: 61 SLIEEKVRKEQSHISEVIFTNCRNPNCKGVQKILPTLQHISDNMTRYHRTEVYNTTVMVV 120 + + ++ KE + + + N +G+ +I+P + I Sbjct: 65 AAVTQQW-KEHFENQGIRSLSINSVNGQGLNQIVPASKEI-------------------- 103 Query: 121 GVPNVGKSSIINALRSSHMKKGKAVPILPTLQHISDNMTRYHRTEVYNTTVMVVGVPNVG 180 LQ D M R + +++G+PNVG Sbjct: 104 ------------------------------LQEKFDRM-RAKGVKPRAIRALIIGIPNVG 132 Query: 181 KSSIINALRSSHMKKGKAVPVGPKAGVTRSVMSQVKISEKPLIYILDTPGISLPRIDNLE 240 KS++IN L ++ K G + G+T S VK+ ++ + +LDTPGI P+ ++ Sbjct: 133 KSTLINRLAKKNIAK-----TGDRPGITTS-QQWVKVGKE--LELLDTPGILWPKFEDEL 184 Query: 241 CGMRLAACATLQDHLVGEINIADYILFYLNRTGNYRYVDFFNLDEPSDDIVMLL 294 G+RLA ++D ++ ++A + L +L R + + LDE +DI L Sbjct: 185 VGLRLAVTGAIKDSIINLQDVAVFGLRFLEEHYPERLKERYGLDEIPEDIAELF 238
>pdb|3R9W|A Chain A, Crystal Structure Of Era In Complex With Mggdpnp And Nucleotides 1506- 1542 Of 16s Ribosomal Rna Length = 307 Back     alignment and structure
>pdb|3IEV|A Chain A, Crystal Structure Of Era In Complex With Mggnp And The 3' End Of 16s Rrna Length = 308 Back     alignment and structure
>pdb|3CNL|A Chain A, Crystal Structure Of Gnp-Bound Ylqf From T. Maritima Length = 262 Back     alignment and structure
>pdb|3CNL|A Chain A, Crystal Structure Of Gnp-Bound Ylqf From T. Maritima Length = 262 Back     alignment and structure
>pdb|1XZP|A Chain A, Structure Of The Gtp-Binding Protein Trme From Thermotoga Maritima Length = 482 Back     alignment and structure
>pdb|1WF3|A Chain A, Crystal Structure Of Gtp-Binding Protein Tt1341 From Thermus Thermophilus Hb8 Length = 301 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query352
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 1e-70
3cnl_A262 YLQF, putative uncharacterized protein; circular p 1e-37
3cnl_A262 YLQF, putative uncharacterized protein; circular p 4e-27
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 3e-17
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 9e-16
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 5e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-12
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 1e-08
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 2e-04
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 3e-08
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 1e-06
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 4e-06
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 1e-05
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 2e-05
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 9e-04
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 2e-05
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 2e-05
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 5e-04
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 4e-05
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 4e-05
1wf3_A 301 GTP-binding protein; GTPase, riken structural geno 8e-05
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 1e-04
1ega_A 301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 1e-04
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 1e-04
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 2e-04
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 2e-04
3iev_A 308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 6e-04
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 9e-04
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Length = 282 Back     alignment and structure
 Score =  221 bits (564), Expect = 1e-70
 Identities = 73/344 (21%), Positives = 137/344 (39%), Gaps = 74/344 (21%)

Query: 1   MGRGLKDIEKHLKNVDIVIEVHDSRMPFTGRNHLLQQSVQNIRPMVLVLNKRDLINSKHE 60
           M +  +++ + LK +DIV E+ D+R+P + RN +++  ++N +P +++LNK D  ++   
Sbjct: 10  MAKARREVTEKLKLIDIVYELVDARIPMSSRNPMIEDILKN-KPRIMLLNKADKADAAVT 68

Query: 61  SLIEEKVRKEQSHISEVIFTNCRNPNCKGVQKILPTLQHISDNMTRYHRTEVYNTTVMVV 120
              +E    +       +  N  N   +G+ +I+P  + I        R           
Sbjct: 69  QQWKEHFENQGIR---SLSINSVNG--QGLNQIVPASKEILQEKFDRMRA---------- 113

Query: 121 GVPNVGKSSIINALRSSHMKKGKAVPILPTLQHISDNMTRYHRTEVYNTTVMVVGVPNVG 180
                              K  K   I                        +++G+PNVG
Sbjct: 114 -------------------KGVKPRAI----------------------RALIIGIPNVG 132

Query: 181 KSSIINALRSSHMKKGKAVPVGPKAGVTRSVMSQVKISEKPLIYILDTPGISLPRIDNLE 240
           KS++IN L      K      G + G+T S    VK+ ++  + +LDTPGI  P+ ++  
Sbjct: 133 KSTLINRLA-----KKNIAKTGDRPGITTS-QQWVKVGKE--LELLDTPGILWPKFEDEL 184

Query: 241 CGMRLAACATLQDHLVGEINIADYILFYLNRTGNYRYVDFFNLDEPSDDIVMLLAKAAIK 300
            G+RLA    ++D ++   ++A + L +L      R  + + LDE  +DI  L      K
Sbjct: 185 VGLRLAVTGAIKDSIINLQDVAVFGLRFLEEHYPERLKERYGLDEIPEDIAELFDAIGEK 244

Query: 301 KKWFKRAFDVSSNSVRMFPDTGEVARIFIEHFRKGSFGSVMLDR 344
           +                  +  +   + I   R   FG +  ++
Sbjct: 245 RGCLMSGGL---------INYDKTTEVIIRDIRTEKFGRLSFEQ 279


>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Length = 262 Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Length = 262 Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Length = 368 Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Length = 369 Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Length = 369 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Length = 413 Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Length = 413 Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Length = 262 Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Length = 423 Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Length = 270 Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Length = 301 Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Length = 436 Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Length = 436 Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Length = 190 Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Length = 439 Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Length = 439 Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Length = 302 Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Length = 357 Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Length = 301 Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Length = 172 Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Length = 301 Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Length = 161 Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Length = 307 Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Length = 358 Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Length = 308 Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Length = 228 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query352
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 100.0
3cnl_A262 YLQF, putative uncharacterized protein; circular p 100.0
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 99.89
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 99.88
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.88
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.87
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.86
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 99.81
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 99.74
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 99.72
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 99.69
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 99.48
4a9a_A 376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 99.4
3iev_A 308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 99.31
1wf3_A 301 GTP-binding protein; GTPase, riken structural geno 99.2
1jal_A 363 YCHF protein; nucleotide-binding fold, structural 99.15
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.15
2ohf_A 396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 99.14
1ega_A 301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 99.05
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 99.04
3lxw_A247 GTPase IMAP family member 1; immunity, structural 99.03
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.02
3iby_A256 Ferrous iron transport protein B; G protein, G dom 99.0
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 98.99
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 98.98
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 98.96
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 98.96
1ni3_A 392 YCHF GTPase, YCHF GTP-binding protein; structural 98.95
1wxq_A 397 GTP-binding protein; structural genomics, riken st 98.95
3lxx_A239 GTPase IMAP family member 4; structural genomics c 98.94
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 98.94
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 98.93
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 98.93
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 98.92
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 98.89
2dby_A 368 GTP-binding protein; GDP, structural genomics, NPP 98.88
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 98.88
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 98.88
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 98.87
2wji_A165 Ferrous iron transport protein B homolog; membrane 98.86
1f5n_A 592 Interferon-induced guanylate-binding protein 1; GB 98.85
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 98.82
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 98.82
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 98.8
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 98.8
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 98.79
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 98.79
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 98.79
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 98.77
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 98.77
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 98.74
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 98.74
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 98.72
1jwy_B 315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 98.72
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 98.71
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 98.7
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 98.69
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 98.69
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 98.67
3sjy_A403 Translation initiation factor 2 subunit gamma; zin 98.64
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 98.64
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 98.6
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 98.59
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 98.58
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 98.58
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 98.57
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 98.57
3t1o_A198 Gliding protein MGLA; G domain containing protein, 98.56
2qpt_A 550 EH domain-containing protein-2; protein-nucleotide 98.56
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 98.55
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 98.55
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 98.55
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 98.54
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 98.54
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 98.54
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 98.53
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 98.53
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 98.53
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 98.53
3r7w_A 307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 98.52
1wb1_A482 Translation elongation factor SELB; selenocysteine 98.52
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 98.51
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 98.51
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 98.51
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 98.51
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 98.51
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 98.5
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 98.49
2x2e_A 353 Dynamin-1; nitration, hydrolase, membrane fission, 98.48
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 98.48
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 98.48
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 98.48
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 98.48
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 98.47
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 98.47
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 98.47
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 98.47
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 98.47
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 98.47
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 98.46
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 98.46
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 98.46
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 98.46
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 98.46
1kk1_A410 EIF2gamma; initiation of translation; HET: GNP; 1. 98.45
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 98.45
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 98.45
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 98.45
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 98.44
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 98.44
2www_A349 Methylmalonic aciduria type A protein, mitochondri 98.44
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 98.43
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 98.43
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 98.43
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 98.43
1s0u_A408 EIF-2-gamma, translation initiation factor 2 gamma 98.43
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 98.42
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 98.42
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 98.42
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 98.42
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 98.42
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 98.41
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 98.41
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 98.41
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 98.41
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 98.41
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 98.41
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 98.41
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 98.4
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 98.4
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 98.4
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 98.39
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 98.39
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 98.39
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 98.39
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 98.39
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 98.39
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 98.39
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 98.39
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 98.39
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 98.39
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 98.39
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 98.39
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 98.39
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 98.38
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 98.38
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 98.38
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 98.38
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 98.38
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 98.38
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 98.38
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 98.38
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 98.38
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 98.38
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 98.37
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 98.37
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 98.37
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 98.37
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 98.37
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 98.37
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 98.37
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 98.37
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 98.36
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 98.36
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 98.36
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 98.36
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 98.36
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 98.36
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 98.36
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 98.35
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 98.35
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 98.34
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 98.34
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 98.34
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 98.34
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 98.34
2ged_A193 SR-beta, signal recognition particle receptor beta 98.34
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 98.34
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 98.34
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 98.34
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 98.33
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 98.33
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 98.33
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 98.33
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 98.33
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 98.33
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 98.33
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 98.33
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 98.33
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 98.32
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 98.32
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 98.32
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 98.32
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 98.32
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 98.32
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 98.32
3qq5_A423 Small GTP-binding protein; hydrogenase, H-cluster, 98.32
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 98.32
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 98.32
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 98.31
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 98.31
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 98.31
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 98.31
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 98.31
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 98.31
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 98.3
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 98.3
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 98.3
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 98.3
2ywe_A 600 GTP-binding protein LEPA; G domain, beta-barrel, f 98.29
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 98.29
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 98.29
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 98.29
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 98.29
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 98.28
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 98.28
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 98.28
3j2k_7 439 ERF3, eukaryotic polypeptide chain release factor 98.28
3o47_A329 ADP-ribosylation factor GTPase-activating protein 98.28
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 98.28
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 98.27
3izq_1 611 HBS1P, elongation factor 1 alpha-like protein; NO- 98.27
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 98.27
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 98.27
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 98.26
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 98.26
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 98.26
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 98.26
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 98.26
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 98.25
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 98.25
3tr5_A528 RF-3, peptide chain release factor 3; protein synt 98.24
3iby_A256 Ferrous iron transport protein B; G protein, G dom 98.23
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 98.23
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 98.23
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 98.23
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 98.23
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 98.23
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 98.23
3j2k_7439 ERF3, eukaryotic polypeptide chain release factor 98.23
3t34_A 360 Dynamin-related protein 1A, linker, dynamin-relat 98.22
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 98.22
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 98.22
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 98.22
2wji_A165 Ferrous iron transport protein B homolog; membrane 98.22
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 98.22
2fh5_B214 SR-beta, signal recognition particle receptor beta 98.21
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 98.21
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 98.21
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 98.21
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 98.21
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 98.21
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 98.21
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 98.21
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 98.21
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 98.19
2elf_A370 Protein translation elongation factor 1A; tRNA, py 98.19
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 98.19
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 98.18
2c78_A405 Elongation factor TU-A; hydrolase, GTPase, transla 98.18
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 98.18
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 98.17
3p26_A 483 Elongation factor 1 alpha-like protein; GTP/GDP bi 98.16
3p26_A483 Elongation factor 1 alpha-like protein; GTP/GDP bi 98.15
1zun_B434 Sulfate adenylate transferase, subunit 1/adenylyls 98.15
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 98.15
3q5d_A 447 Atlastin-1; G protein, GTPase, GDP/GTP binding, hy 98.15
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 98.15
3llu_A196 RAS-related GTP-binding protein C; structural geno 98.14
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 98.14
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 98.14
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 98.13
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 98.13
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 98.13
3mca_A 592 HBS1, elongation factor 1 alpha-like protein; prot 98.13
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 98.12
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 98.12
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 98.12
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 98.11
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 98.11
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 98.11
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 98.1
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 98.09
1d2e_A397 Elongation factor TU (EF-TU); G-protein, beta-barr 98.09
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 98.08
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 98.08
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 97.35
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 98.08
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 98.07
1g7s_A 594 Translation initiation factor IF2/EIF5B; translati 98.07
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 98.07
1nrj_B218 SR-beta, signal recognition particle receptor beta 98.06
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 98.06
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 98.06
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 98.06
3izy_P 537 Translation initiation factor IF-2, mitochondrial; 98.06
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 98.06
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 98.05
3t1o_A198 Gliding protein MGLA; G domain containing protein, 98.04
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 98.04
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 98.03
3tr5_A 528 RF-3, peptide chain release factor 3; protein synt 98.01
3o47_A329 ADP-ribosylation factor GTPase-activating protein 98.01
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 98.0
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 97.99
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 97.98
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 97.98
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 97.98
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 97.97
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 97.97
2qag_A 361 Septin-2, protein NEDD5; cell cycle, cell division 97.96
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 97.96
1zo1_I 501 IF2, translation initiation factor 2; E. coli, rib 97.95
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 97.95
3dpu_A535 RAB family protein; roccor, G-domain, COR, GTP-bin 97.93
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 97.93
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 97.93
1wb1_A 482 Translation elongation factor SELB; selenocysteine 97.93
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 97.16
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 97.92
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 97.92
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 97.92
1jny_A435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 97.91
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 97.91
2c78_A 405 Elongation factor TU-A; hydrolase, GTPase, transla 97.91
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 97.89
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 97.88
3llu_A196 RAS-related GTP-binding protein C; structural geno 97.88
1f60_A 458 Elongation factor EEF1A; protein-protein complex, 97.88
1d2e_A 397 Elongation factor TU (EF-TU); G-protein, beta-barr 97.88
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 97.87
2p67_A 341 LAO/AO transport system kinase; ARGK, structural G 97.86
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 97.86
2h5e_A 529 Peptide chain release factor RF-3; beta barrel, tr 97.85
1zun_B 434 Sulfate adenylate transferase, subunit 1/adenylyls 97.84
3sjy_A 403 Translation initiation factor 2 subunit gamma; zin 97.84
2elf_A 370 Protein translation elongation factor 1A; tRNA, py 97.81
3izy_P 537 Translation initiation factor IF-2, mitochondrial; 97.8
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 97.79
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 97.79
2fh5_B214 SR-beta, signal recognition particle receptor beta 97.78
3izq_1611 HBS1P, elongation factor 1 alpha-like protein; NO- 97.77
1r5b_A467 Eukaryotic peptide chain release factor GTP-bindi 97.76
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 97.75
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 97.75
1kk1_A 410 EIF2gamma; initiation of translation; HET: GNP; 1. 97.74
1jny_A 435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 97.73
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 97.69
1zo1_I501 IF2, translation initiation factor 2; E. coli, rib 97.69
3mca_A592 HBS1, elongation factor 1 alpha-like protein; prot 97.69
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 97.69
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 97.68
1f60_A458 Elongation factor EEF1A; protein-protein complex, 97.68
1s0u_A 408 EIF-2-gamma, translation initiation factor 2 gamma 97.66
2h5e_A529 Peptide chain release factor RF-3; beta barrel, tr 97.66
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 97.64
2www_A349 Methylmalonic aciduria type A protein, mitochondri 97.62
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 97.61
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 97.6
2ywe_A 600 GTP-binding protein LEPA; G domain, beta-barrel, f 97.59
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 97.58
3lxw_A247 GTPase IMAP family member 1; immunity, structural 97.58
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 97.57
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 97.57
3l82_B227 F-box only protein 4; TRFH domain, helix, GTPase d 97.55
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 97.55
1r5b_A 467 Eukaryotic peptide chain release factor GTP-bindi 97.53
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 97.5
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 97.5
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 97.48
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 97.48
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 97.45
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 97.44
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 97.42
3vqt_A548 RF-3, peptide chain release factor 3; translation, 97.42
3lxx_A239 GTPase IMAP family member 4; structural genomics c 97.38
1wxq_A397 GTP-binding protein; structural genomics, riken st 97.36
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 97.33
3j25_A 638 Tetracycline resistance protein TETM; antibiotic r 97.32
1g7s_A 594 Translation initiation factor IF2/EIF5B; translati 97.3
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 97.26
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 97.25
2hf9_A226 Probable hydrogenase nickel incorporation protein 97.21
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 97.16
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 97.13
3vqt_A 548 RF-3, peptide chain release factor 3; translation, 97.08
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 97.08
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 97.07
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 97.06
2hf9_A226 Probable hydrogenase nickel incorporation protein 97.06
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 97.03
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 97.0
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 96.98
3r7w_B 331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 96.96
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 96.94
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 96.88
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 96.87
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 96.83
1ko7_A314 HPR kinase/phosphatase; protein kinase, phosphotra 96.81
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 96.68
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 96.67
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 96.65
4fn5_A 709 EF-G 1, elongation factor G 1; translation, transl 96.63
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 96.56
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 96.56
1nrj_B218 SR-beta, signal recognition particle receptor beta 96.52
3r7w_B331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 96.5
2ged_A193 SR-beta, signal recognition particle receptor beta 96.47
4ido_A 457 Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HE 96.35
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 96.3
2xtz_A354 Guanine nucleotide-binding protein alpha-1 subuni; 96.24
3j25_A 638 Tetracycline resistance protein TETM; antibiotic r 96.16
1azs_C402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 96.01
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; 96.0
4fid_A340 G protein alpha subunit; RAS-like domain, all-heli 95.81
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 95.79
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 95.68
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 95.65
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 95.4
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 95.38
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 95.38
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 95.35
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 95.27
4fn5_A 709 EF-G 1, elongation factor G 1; translation, transl 95.26
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 95.23
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 95.22
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 95.1
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 95.08
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 94.97
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 94.93
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 94.81
1kag_A173 SKI, shikimate kinase I; transferase, structural g 94.75
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 94.71
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 94.69
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 94.68
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 94.66
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 94.54
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 94.54
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 94.53
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 94.47
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 94.28
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 94.18
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 94.18
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 94.14
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 94.1
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 94.08
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 94.06
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 94.02
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 94.01
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 94.0
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 93.97
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 93.96
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 93.95
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 93.95
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 93.93
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 93.91
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 93.91
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 93.91
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 93.9
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 93.89
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 93.88
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 93.83
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 93.81
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 93.78
1sgw_A214 Putative ABC transporter; structural genomics, P p 93.76
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 93.74
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 93.73
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 93.71
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 93.71
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 93.7
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 93.68
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 93.68
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 93.65
3vaa_A199 Shikimate kinase, SK; structural genomics, center 93.65
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 93.6
1b0u_A262 Histidine permease; ABC transporter, transport pro 93.6
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 93.57
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 93.55
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 93.51
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 93.49
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 93.49
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 93.48
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 93.47
1g6h_A257 High-affinity branched-chain amino acid transport 93.46
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 93.44
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 93.44
2eyu_A261 Twitching motility protein PILT; pilus retraction 93.44
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 93.44
2ghi_A260 Transport protein; multidrug resistance protein, M 93.4
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 93.38
2vli_A183 Antibiotic resistance protein; transferase, tunica 93.38
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 93.38
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 93.37
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 93.37
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 93.36
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 93.35
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 93.34
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 93.33
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 93.28
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 93.28
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
Probab=100.00  E-value=5e-47  Score=348.23  Aligned_cols=272  Identities=25%  Similarity=0.454  Sum_probs=221.8

Q ss_pred             ChhHHHHHHHHhhccCEEEEEEcCCCCCCCcCHHHHHHHhCCCCEEEEEEcccCCCccchHHHHHHHHhhcCCCCcEEEe
Q psy15351          1 MGRGLKDIEKHLKNVDIVIEVHDSRMPFTGRNHLLQQSVQNIRPMVLVLNKRDLINSKHESLIEEKVRKEQSHISEVIFT   80 (352)
Q Consensus         1 m~~~~~~~~~~i~~aD~vl~VvDar~p~~~~~~~l~~~l~~~k~~ilVlNK~Dl~~~~~~~~~~~~~~~~~~~~~~v~~i   80 (352)
                      |.++++++++.++++|+|++|+|||+|.++.++.+.+++ .++|.++|+||+||++.+..+.|.+++++.+.+   ++++
T Consensus        10 m~ka~~~~~~~l~~aDvVl~VvDAr~p~~~~~~~l~~~l-~~kp~ilVlNK~DL~~~~~~~~~~~~~~~~g~~---~i~i   85 (282)
T 1puj_A           10 MAKARREVTEKLKLIDIVYELVDARIPMSSRNPMIEDIL-KNKPRIMLLNKADKADAAVTQQWKEHFENQGIR---SLSI   85 (282)
T ss_dssp             TTHHHHHHHHHGGGCSEEEEEEETTSTTTTSCHHHHHHC-SSSCEEEEEECGGGSCHHHHHHHHHHHHTTTCC---EEEC
T ss_pred             HHHHHHHHHHHHhhCCEEEEEEeCCCCCccCCHHHHHHH-CCCCEEEEEECcccCCHHHHHHHHHHHHhcCCc---EEEE
Confidence            789999999999999999999999999999999998888 689999999999999977778899999766765   9999


Q ss_pred             ecCCCCCCCHHHHHHHHHHHhhhccccccccccceeEEEeccCCCCchhHHHHHhhhhcccCCCCCCCcchhhhhccccc
Q psy15351         81 NCRNPNCKGVQKILPTLQHISDNMTRYHRTEVYNTTVMVVGVPNVGKSSIINALRSSHMKKGKAVPILPTLQHISDNMTR  160 (352)
Q Consensus        81 Sa~~~~~~gi~~L~~~i~~~~~~~~~~~~~~~~~~~~~~~g~~nvgksslin~l~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (352)
                      ||.++  .|+++|++.+.+.++....                          ....    +                   
T Consensus        86 SA~~~--~gi~~L~~~i~~~l~~~~~--------------------------~~~~----~-------------------  114 (282)
T 1puj_A           86 NSVNG--QGLNQIVPASKEILQEKFD--------------------------RMRA----K-------------------  114 (282)
T ss_dssp             CTTTC--TTGGGHHHHHHHHHHHHHH--------------------------HHHH----T-------------------
T ss_pred             ECCCc--ccHHHHHHHHHHHHHHHHH--------------------------HHHh----c-------------------
Confidence            99999  9999999998877653210                          0000    0                   


Q ss_pred             cccccCcceEEEEeCCCCCChHHHHHHHhCCCCCCCCceecCCCCCceeEeeeeEEecCCCcEEEEeCCCCCCCCCCCHH
Q psy15351        161 YHRTEVYNTTVMVVGVPNVGKSSIINALRSSHMKKGKAVPVGPKAGVTRSVMSQVKISEKPLIYILDTPGISLPRIDNLE  240 (352)
Q Consensus       161 ~~~~~~~~~~v~i~G~pnvGKStliN~l~~~~~~~~~~~~~~~~pg~T~~~~~~~~~~~~~~~~l~DtPGi~~~~~~~~~  240 (352)
                        ...+.+++++++|.||||||||+|+|.+     ...+.+++.||+|++.+ .+..  +..+.++||||+..+...+.+
T Consensus       115 --~~~~~~~~v~~vG~~nvGKSsliN~l~~-----~~~~~~~~~~g~T~~~~-~~~~--~~~~~l~DtpG~~~~~~~~~~  184 (282)
T 1puj_A          115 --GVKPRAIRALIIGIPNVGKSTLINRLAK-----KNIAKTGDRPGITTSQQ-WVKV--GKELELLDTPGILWPKFEDEL  184 (282)
T ss_dssp             --TCCCCCEEEEEEESTTSSHHHHHHHHHT-----SCCC------------C-CEEE--TTTEEEEECCCCCCSCCCCHH
T ss_pred             --CCCCCCceEEEEecCCCchHHHHHHHhc-----CceeecCCCCCeeeeeE-EEEe--CCCEEEEECcCcCCCCCCCHH
Confidence              0123568999999999999999999997     56688999999999986 3444  347999999999999888878


Q ss_pred             HHHHHHHHhhhhhhccchhhhhHhHHhhhcCCCCCcccccccCCCCCccHHHHHHHHHHHhccccccccccCCcccCCCC
Q psy15351        241 CGMRLAACATLQDHLVGEINIADYILFYLNRTGNYRYVDFFNLDEPSDDIVMLLAKAAIKKKWFKRAFDVSSNSVRMFPD  320 (352)
Q Consensus       241 ~~~~l~~~~~i~~~~~~~~~~~~~il~~~~~~~~~~~~~~~~l~~~~~~~~~~l~~~a~~~g~~~~~~~~~~g~~~~~~d  320 (352)
                      ..+++++++++.+..+++..++.+++..+++..+..+...|+++.+.++..++|+.+|+++|++.++         |.||
T Consensus       185 ~~~~~~~~~~i~~~~~~~~~~~~~~~~~l~~~~~~~l~~~y~~~~~~~~~~~~l~~~a~~~g~~~kg---------g~~d  255 (282)
T 1puj_A          185 VGLRLAVTGAIKDSIINLQDVAVFGLRFLEEHYPERLKERYGLDEIPEDIAELFDAIGEKRGCLMSG---------GLIN  255 (282)
T ss_dssp             HHHHHHHHTSSCTTSSCHHHHHHHHHHHHHHHCHHHHHHHTTCSSCCSSHHHHHHHHHHHHTCBCST---------TCBC
T ss_pred             HHHHHHHhCCcchhhCCHHHHHHHHHHHHHHhChHHHHHHcCCCCCCCCHHHHHHHHHHHhCCcccC---------Cccc
Confidence            8889999999999888988999999988888766667788999766667899999999999999865         6899


Q ss_pred             HHHHHHHHHHHHhCCCCcceecCccc
Q psy15351        321 TGEVARIFIEHFRKGSFGSVMLDRDF  346 (352)
Q Consensus       321 ~~~a~~~~l~~~~~g~l~~~~~~~~~  346 (352)
                      +.+||+.+|+||++|+||+|++|+|.
T Consensus       256 ~~~aa~~~l~d~~~Gklg~~~l~~~~  281 (282)
T 1puj_A          256 YDKTTEVIIRDIRTEKFGRLSFEQPT  281 (282)
T ss_dssp             HHHHHHHHHHHHHTTTTCSCCSCCCC
T ss_pred             HHHHHHHHHHHHHcCCCCceECCCCC
Confidence            99999999999999999999999764



>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens} Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4ido_A Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HET: GDP; 2.09A {Homo sapiens} PDB: 4idn_A* 3q5d_A* 3q5e_A* 4idq_A* 4idp_A* 3qnu_A* 3qof_A* Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Back     alignment and structure
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Back     alignment and structure
>4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 352
d1puja_273 c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subti 3e-21
d1xzpa2160 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotog 1e-06
d2cxxa1184 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyroc 2e-06
d2cxxa1184 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyroc 2e-04
d1tq4a_ 400 c.37.1.8 (A:) Interferon-inducible GTPase {Mouse ( 5e-06
d1tq4a_ 400 c.37.1.8 (A:) Interferon-inducible GTPase {Mouse ( 2e-04
d1u0la2225 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C 5e-06
d1lnza2185 c.37.1.8 (A:158-342) Obg GTP-binding protein middl 5e-05
d1lnza2185 c.37.1.8 (A:158-342) Obg GTP-binding protein middl 0.003
d1udxa2180 c.37.1.8 (A:157-336) Obg GTP-binding protein middl 6e-05
d1udxa2180 c.37.1.8 (A:157-336) Obg GTP-binding protein middl 4e-04
d1h65a_257 c.37.1.8 (A:) Chloroplast protein translocon GTPas 9e-05
d1h65a_257 c.37.1.8 (A:) Chloroplast protein translocon GTPas 1e-04
d1mkya2186 c.37.1.8 (A:173-358) Probable GTPase Der, N-termin 2e-04
d1t9ha2231 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C 2e-04
d1t9ha2231 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C 2e-04
d1mkya1171 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal 2e-04
d1mkya1171 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal 5e-04
d1egaa1179 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain { 8e-04
d1egaa1179 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain { 0.001
d1wf3a1178 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain { 0.002
d1wf3a1178 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain { 0.003
d1nrjb_209 c.37.1.8 (B:) Signal recognition particle receptor 0.002
d1nrjb_209 c.37.1.8 (B:) Signal recognition particle receptor 0.002
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Length = 273 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Probable GTPase YlqF
species: Bacillus subtilis [TaxId: 1423]
 Score = 89.5 bits (221), Expect = 3e-21
 Identities = 61/344 (17%), Positives = 126/344 (36%), Gaps = 74/344 (21%)

Query: 1   MGRGLKDIEKHLKNVDIVIEVHDSRMPFTGRNHLLQQSVQNIRPMVLVLNKRDLINSKHE 60
           M +  +++ + LK +DIV E+ D+                           R  ++S++ 
Sbjct: 2   MAKARREVTEKLKLIDIVYELVDA---------------------------RIPMSSRNP 34

Query: 61  SLIEEKVRKEQSHISEVIFTNCRNPNCKGVQKILPTLQHISDNMTRYHRTEVYNTTVMVV 120
            +IE+ ++ +              P    + K       ++     +   +    ++ + 
Sbjct: 35  -MIEDILKNK--------------PRIMLLNKADKADAAVTQQWKEHFENQ-GIRSLSIN 78

Query: 121 GVPNVGKSSIINALRSSHMKKGKAVPILPTLQHISDNMTRYHRTEVYNTTVMVVGVPNVG 180
            V   G + I+ A +    +K               +  R    +      +++G+PNVG
Sbjct: 79  SVNGQGLNQIVPASKEILQEK--------------FDRMRAKGVKPRAIRALIIGIPNVG 124

Query: 181 KSSIINALRSSHMKKGKAVPVGPKAGVTRSVMSQVKISEKPLIYILDTPGISLPRIDNLE 240
           KS++IN      + K      G + G+T S      +     + +LDTPGI  P+ ++  
Sbjct: 125 KSTLINR-----LAKKNIAKTGDRPGITTSQQ---WVKVGKELELLDTPGILWPKFEDEL 176

Query: 241 CGMRLAACATLQDHLVGEINIADYILFYLNRTGNYRYVDFFNLDEPSDDIVMLLAKAAIK 300
            G+RLA    ++D ++   ++A + L +L      R  + + LDE  +DI  L      K
Sbjct: 177 VGLRLAVTGAIKDSIINLQDVAVFGLRFLEEHYPERLKERYGLDEIPEDIAELFDAIGEK 236

Query: 301 KKWFKRAFDVSSNSVRMFPDTGEVARIFIEHFRKGSFGSVMLDR 344
           +                  +  +   + I   R   FG +  ++
Sbjct: 237 RGCLMSGGL---------INYDKTTEVIIRDIRTEKFGRLSFEQ 271


>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Length = 160 Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Length = 184 Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Length = 184 Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Length = 400 Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Length = 400 Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 225 Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Length = 185 Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Length = 185 Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Length = 180 Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Length = 180 Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 257 Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 257 Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 186 Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Length = 231 Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Length = 231 Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 171 Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 171 Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 178 Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 178 Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 209 Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 209 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query352
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 100.0
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 99.88
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 99.87
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 99.42
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 99.42
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 99.4
d1wxqa1 319 GTP-binding protein PH0525 {Pyrococcus horikoshii 99.37
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 99.31
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 99.23
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 99.22
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 99.22
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 99.17
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 99.14
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 99.08
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 99.06
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 99.04
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 99.04
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 99.03
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 99.01
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 99.0
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 98.93
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 98.91
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 98.88
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 98.87
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 98.83
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 98.81
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 98.79
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 98.75
d1nrjb_209 Signal recognition particle receptor beta-subunit 98.7
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 98.68
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 98.64
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 98.63
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 98.52
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 98.52
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 98.52
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 98.49
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 98.46
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 98.42
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 98.4
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 98.39
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 98.37
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 98.36
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 98.35
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 98.33
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 98.31
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 98.31
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 98.3
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 98.3
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 98.29
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 98.28
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 98.27
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 98.26
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 98.26
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 98.25
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 98.25
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 98.25
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 98.25
d2fh5b1207 Signal recognition particle receptor beta-subunit 98.24
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 98.23
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 98.23
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 98.22
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 98.21
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 98.21
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 98.21
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 98.21
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 98.2
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 98.2
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 98.18
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 98.17
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 98.17
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 98.17
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 98.16
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 98.16
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 98.15
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 98.15
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 98.15
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 98.14
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 98.14
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 98.14
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 98.13
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 98.13
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 98.12
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 98.12
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 98.11
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 98.11
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 98.1
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 98.09
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 98.08
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 98.08
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 98.08
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 98.07
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 98.07
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 98.05
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 98.05
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 98.05
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 98.05
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 98.04
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 98.04
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 98.03
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 98.02
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 98.02
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 98.01
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 98.0
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 98.0
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 98.0
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 98.0
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 97.99
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 97.99
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 97.99
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 97.99
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 97.98
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 97.98
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 97.98
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 97.97
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 97.97
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 97.95
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 97.93
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 97.93
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 97.91
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 97.91
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 97.91
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 97.9
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 97.9
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 97.87
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 97.86
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 97.85
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 97.85
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 97.83
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 97.82
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 97.8
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 97.8
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 97.8
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 97.79
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 97.78
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 97.76
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 97.72
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 97.72
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 97.71
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 97.69
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 97.69
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 97.68
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 97.65
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 97.63
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 97.62
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 97.6
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 97.54
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 97.53
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 97.47
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 97.46
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 97.46
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 97.44
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 97.42
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 97.41
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 97.39
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 97.38
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 97.38
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 97.27
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 97.26
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 97.19
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 97.12
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 97.08
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 97.08
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 97.06
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 97.03
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 97.02
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 96.98
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 96.91
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 96.48
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 96.47
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 96.45
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 96.44
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.4
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 96.36
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 96.26
d2fh5b1207 Signal recognition particle receptor beta-subunit 96.23
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.2
d1n0ua2 341 Elongation factor 2 (eEF-2), N-terminal (G) domain 96.17
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.16
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 95.98
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 95.76
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 95.72
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.62
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 95.53
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 95.46
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 95.36
d1nrjb_209 Signal recognition particle receptor beta-subunit 95.28
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 95.23
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 95.11
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 95.1
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 94.99
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 94.91
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 94.9
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 94.89
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 94.83
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 94.81
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 94.75
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 94.73
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 94.68
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 94.57
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 94.56
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 94.54
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 94.53
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 94.51
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 94.32
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 94.29
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 94.29
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 94.29
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 94.25
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 94.19
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 94.17
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 94.13
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 94.11
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 94.07
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 94.03
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 94.02
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 93.99
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 93.98
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 93.91
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 93.83
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 93.81
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 93.81
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 93.8
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 93.65
d2awna2232 Maltose transport protein MalK, N-terminal domain 93.65
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 93.63
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 93.6
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 93.57
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 93.54
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 93.51
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 93.37
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 93.36
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 93.34
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 93.28
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 93.24
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 93.23
d2hyda1255 Putative multidrug export ATP-binding/permease pro 93.2
d1g2912240 Maltose transport protein MalK, N-terminal domain 93.17
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 93.11
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 93.09
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 93.04
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 92.97
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 92.94
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 92.88
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 92.86
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 92.75
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 92.44
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 92.28
d1vmaa2213 GTPase domain of the signal recognition particle r 92.12
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 91.97
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 91.97
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 91.86
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 91.75
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 91.67
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 91.42
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 91.18
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 90.92
d2qy9a2211 GTPase domain of the signal recognition particle r 90.86
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 90.78
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 90.49
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 90.32
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 90.23
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 90.09
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 89.93
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 89.89
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 89.73
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 89.7
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 89.58
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 89.47
d1okkd2207 GTPase domain of the signal recognition particle r 89.2
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 89.13
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 88.92
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 88.86
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 88.85
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 88.79
d1j8yf2211 GTPase domain of the signal sequence recognition p 88.7
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 88.49
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 88.14
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 87.9
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 87.48
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 87.44
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 87.3
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 86.78
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 86.76
d1tuea_205 Replication protein E1 helicase domain {Human papi 86.67
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 86.62
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 86.62
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 86.51
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 86.5
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 86.38
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 85.54
g1xew.1 329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 85.26
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 85.25
d1ls1a2207 GTPase domain of the signal sequence recognition p 84.97
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 84.72
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 84.7
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 84.49
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 83.65
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 83.54
d1svma_362 Papillomavirus large T antigen helicase domain {Si 83.53
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 83.29
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 82.91
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 82.06
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 81.86
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 81.65
d1osna_ 331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 80.86
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 80.44
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 80.38
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Probable GTPase YlqF
species: Bacillus subtilis [TaxId: 1423]
Probab=100.00  E-value=6.8e-53  Score=383.93  Aligned_cols=271  Identities=25%  Similarity=0.454  Sum_probs=228.2

Q ss_pred             ChhHHHHHHHHhhccCEEEEEEcCCCCCCCcCHHHHHHHhCCCCEEEEEEcccCCCccchHHHHHHHHhhcCCCCcEEEe
Q psy15351          1 MGRGLKDIEKHLKNVDIVIEVHDSRMPFTGRNHLLQQSVQNIRPMVLVLNKRDLINSKHESLIEEKVRKEQSHISEVIFT   80 (352)
Q Consensus         1 m~~~~~~~~~~i~~aD~vl~VvDar~p~~~~~~~l~~~l~~~k~~ilVlNK~Dl~~~~~~~~~~~~~~~~~~~~~~v~~i   80 (352)
                      |+||++++++.++.+|+||+|+|||+|++++++.+++++ .+||+|+|+||+||++++..++|.++|++.+..   ++++
T Consensus         2 m~ka~r~i~~~i~~~DvIl~V~DaR~P~ss~~~~l~~~~-~~Kp~IlVlNK~DLv~~~~~~~w~~~f~~~~~~---~i~i   77 (273)
T d1puja_           2 MAKARREVTEKLKLIDIVYELVDARIPMSSRNPMIEDIL-KNKPRIMLLNKADKADAAVTQQWKEHFENQGIR---SLSI   77 (273)
T ss_dssp             TTHHHHHHHHHGGGCSEEEEEEETTSTTTTSCHHHHHHC-SSSCEEEEEECGGGSCHHHHHHHHHHHHTTTCC---EEEC
T ss_pred             HHHHHHHHHHHHHhCCEEEEEEECCCCCCCCCHHHHHHH-cCCCeEEEEECccCCchHHHHHHHHHHHhcCCc---ccee
Confidence            999999999999999999999999999999999999998 589999999999999999999999999877766   8999


Q ss_pred             ecCCCCCCCHHHHHHHHHHHhhhccccccccccceeEEEeccCCCCchhHHHHHhhhhcccCCCCCCCcchhhhhccccc
Q psy15351         81 NCRNPNCKGVQKILPTLQHISDNMTRYHRTEVYNTTVMVVGVPNVGKSSIINALRSSHMKKGKAVPILPTLQHISDNMTR  160 (352)
Q Consensus        81 Sa~~~~~~gi~~L~~~i~~~~~~~~~~~~~~~~~~~~~~~g~~nvgksslin~l~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (352)
                      |+.++  .|..++.+.+.+++++..                          +...                         
T Consensus        78 sa~~~--~~~~~~~~~~~~~l~~~~--------------------------~~~~-------------------------  104 (273)
T d1puja_          78 NSVNG--QGLNQIVPASKEILQEKF--------------------------DRMR-------------------------  104 (273)
T ss_dssp             CTTTC--TTGGGHHHHHHHHHHHHH--------------------------HHHH-------------------------
T ss_pred             ecccC--CCccccchhhhhhhhhhh--------------------------hhhh-------------------------
Confidence            99999  999998888776665421                          0000                         


Q ss_pred             cccccCcceEEEEeCCCCCChHHHHHHHhCCCCCCCCceecCCCCCceeEeeeeEEecCCCcEEEEeCCCCCCCCCCCHH
Q psy15351        161 YHRTEVYNTTVMVVGVPNVGKSSIINALRSSHMKKGKAVPVGPKAGVTRSVMSQVKISEKPLIYILDTPGISLPRIDNLE  240 (352)
Q Consensus       161 ~~~~~~~~~~v~i~G~pnvGKStliN~l~~~~~~~~~~~~~~~~pg~T~~~~~~~~~~~~~~~~l~DtPGi~~~~~~~~~  240 (352)
                      ........++|+++|+||||||||||+|.+     ++.+.+|+.||+|++.+. +..  ++.++++||||+..|...+.+
T Consensus       105 ~~~~~~~~~~v~vvG~PNvGKSsliN~L~~-----~~~~~~~~~pG~Tr~~~~-i~~--~~~~~l~DTPGi~~p~~~~~~  176 (273)
T d1puja_         105 AKGVKPRAIRALIIGIPNVGKSTLINRLAK-----KNIAKTGDRPGITTSQQW-VKV--GKELELLDTPGILWPKFEDEL  176 (273)
T ss_dssp             HTTCCCCCEEEEEEESTTSSHHHHHHHHHT-----SCCC------------CC-EEE--TTTEEEEECCCCCCSCCCCHH
T ss_pred             hccCCCCceEEEEEecCccchhhhhhhhhc-----cceEEECCcccccccceE-EEC--CCCeEEecCCCccccCCccHH
Confidence            011234679999999999999999999998     678899999999999864 443  457999999999999999999


Q ss_pred             HHHHHHHHhhhhhhccchhhhhHhHHhhhcCCCCCcccccccCCCCCccHHHHHHHHHHHhccccccccccCCcccCCCC
Q psy15351        241 CGMRLAACATLQDHLVGEINIADYILFYLNRTGNYRYVDFFNLDEPSDDIVMLLAKAAIKKKWFKRAFDVSSNSVRMFPD  320 (352)
Q Consensus       241 ~~~~l~~~~~i~~~~~~~~~~~~~il~~~~~~~~~~~~~~~~l~~~~~~~~~~l~~~a~~~g~~~~~~~~~~g~~~~~~d  320 (352)
                      .++++++++++.+...+...++++++..+++.....+...|+++.+.++..++|+++|+++|++.++         |.||
T Consensus       177 ~~~~la~~~~i~~~~~~~~~~~~~ll~~l~~~~~~~l~~~~~~~~~~~d~~~~l~~ia~~~g~~~kg---------g~~D  247 (273)
T d1puja_         177 VGLRLAVTGAIKDSIINLQDVAVFGLRFLEEHYPERLKERYGLDEIPEDIAELFDAIGEKRGCLMSG---------GLIN  247 (273)
T ss_dssp             HHHHHHHHTSSCTTSSCHHHHHHHHHHHHHHHCHHHHHHHTTCSSCCSSHHHHHHHHHHHHTCBCST---------TCBC
T ss_pred             HHhhhhhcCCcchhhcchhhHHHHHHHHHHHhChHhhhHhcCCCCCCCCHHHHHHHHHHHhCCcccC---------CccC
Confidence            9999999999999999999999999999998877777888999988889999999999999998865         6799


Q ss_pred             HHHHHHHHHHHHhCCCCcceecCcc
Q psy15351        321 TGEVARIFIEHFRKGSFGSVMLDRD  345 (352)
Q Consensus       321 ~~~a~~~~l~~~~~g~l~~~~~~~~  345 (352)
                      +++||+.||+||++|+||+++||.|
T Consensus       248 ~~~aa~~~l~d~r~G~lg~~~ld~P  272 (273)
T d1puja_         248 YDKTTEVIIRDIRTEKFGRLSFEQP  272 (273)
T ss_dssp             HHHHHHHHHHHHHTTTTCSCCSCCC
T ss_pred             HHHHHHHHHHHHHcCCCceeeccCC
Confidence            9999999999999999999999976



>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure