Psyllid ID: psy15361

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18
MDCVTRILQYGTTGIFSVKFPDVIPVDKVPAIEACLPPRPNMVKETTFYDILGVKPNCTQDELKKAYRKLALKYHPDKNPNEGEKFKQISMAYEVLSNPEKRELYDQGASCLMAPLGLVSFTEAGYVSRKPKVTIPENGEEVVLETMDPEKERAQNAYRQAHQEDEDQGPSRVQCATN
cHHHHHHHHHHccccccccccccccccccccHHHccccccccccccccEEEEcccccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHcccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccHHHEEEcccccccccccccccccccccccccccccHHHHHHHccHHHHHcccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccHHHHHHHHHHcHHcccccccccccccccccccHHHHHHHHcccccHHHcccccccEEEEEEEcccccccccccccccccc
MDCVTRILQygttgifsvkfpdvipvdkvpaieaclpprpnmvkettfydilgvkpnctqDELKKAYRKLALKyhpdknpnegekFKQISMAYEVlsnpekrelydqgasclmaplglvsfteagyvsrkpkvtipengeevVLETMDPEKERAQNAYRQAhqededqgpsrvqcatn
MDCVTRILQygttgifsvkfpdVIPVDKVPAieaclpprpnMVKETTFYDILGVKPNCTQDELKKAYRKLALkyhpdknpnegekFKQISMAYEVLSNPEKRELYDQGASCLMAPLGLVSFTEAGyvsrkpkvtipengeevVLETMDPEKERAQNAYRQAhqededqgpsrvqcatn
MDCVTRILQYGTTGIFSVKFPDVIPVDKVPAIEACLPPRPNMVKETTFYDILGVKPNCTQDElkkayrklalkyHPDKNPNEGEKFKQISMAYEVLSNPEKRELYDQGASCLMAPLGLVSFTEAGYVSRKPKVTIPENGEEVVLETMDPEKERAQNAYRQAHQEDEDQGPSRVQCATN
**CVTRILQYGTTGIFSVKFPDVIPVDKVPAIEACLPPRPNMVKETTFYDILGVKPNCTQDELKKAYRKLALKY****************MAYEVL******ELYDQGASCLMAPLGLVSFTEAGYVSR*************************************************
***VTRILQYGTTGIFSVKFPDVIPV****************VKETTFYDILGVKPNCTQDELKKAYRKLALKYHPDKNPNEGEKFKQISMAYEVLSNPEKRELYDQGASCL************************ENGEEVVL**********************************
MDCVTRILQYGTTGIFSVKFPDVIPVDKVPAIEACLPPRPNMVKETTFYDILGVKPNCTQDELKKAYRKLALKYHPDKNPNEGEKFKQISMAYEVLSNPEKRELYDQGASCLMAPLGLVSFTEAGYVSRKPKVTIPENGEEVVLETMDP*****************************
MDCVTRILQYGTTGIFSVKFP******KVPAIEACLPPRPNMVKETTFYDILGVKPNCTQDELKKAYRKLALKYHPDKNPNEGEKFKQISMAYEVLSNPEKRELYDQGASCLMAPLGLVSFTEAGYVSRKPKVTIPENGEEVVLETMDPEKERAQNAYRQAHQ***************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDCVTRILQYGTTGIFSVKFPDVIPVDKVPAIEACLPPRPNMVKETTFYDILGVKPNCTQDELKKAYRKLALKYHPDKNPNEGEKFKQISMAYEVLSNPEKRELYDQGASCLMAPLGLVSFTEAGYVSRKPKVTIPENGEEVVLETMDPEKERAQNAYRQAHQEDEDQGPSRVQCATN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query178 2.2.26 [Sep-21-2011]
Q5NVI9 396 DnaJ homolog subfamily A yes N/A 0.382 0.171 0.852 3e-28
P31689 397 DnaJ homolog subfamily A yes N/A 0.382 0.171 0.852 3e-28
Q95JF4 397 DnaJ homolog subfamily A N/A N/A 0.382 0.171 0.852 3e-28
Q5E954 397 DnaJ homolog subfamily A yes N/A 0.382 0.171 0.852 3e-28
P63036 397 DnaJ homolog subfamily A yes N/A 0.382 0.171 0.838 7e-28
P63037 397 DnaJ homolog subfamily A yes N/A 0.382 0.171 0.838 7e-28
Q9JMC3 397 DnaJ homolog subfamily A no N/A 0.264 0.118 0.764 5e-25
Q8WW22 397 DnaJ homolog subfamily A no N/A 0.264 0.118 0.764 6e-25
O60884 412 DnaJ homolog subfamily A no N/A 0.365 0.157 0.738 5e-22
Q9QYJ0 412 DnaJ homolog subfamily A no N/A 0.365 0.157 0.738 5e-22
>sp|Q5NVI9|DNJA1_PONAB DnaJ homolog subfamily A member 1 OS=Pongo abelii GN=DNAJA1 PE=2 SV=1 Back     alignment and function desciption
 Score =  124 bits (311), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 64/68 (94%)

Query: 42  MVKETTFYDILGVKPNCTQDELKKAYRKLALKYHPDKNPNEGEKFKQISMAYEVLSNPEK 101
           MVKETT+YD+LGVKPN TQ+ELKKAYRKLALKYHPDKNPNEGEKFKQIS AYEVLS+ +K
Sbjct: 1   MVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDAKK 60

Query: 102 RELYDQGA 109
           RELYD+G 
Sbjct: 61  RELYDKGG 68
Co-chaperone of Hsc70. Seems to play a role in protein import into mitochondria.
Pongo abelii (taxid: 9601)
>sp|P31689|DNJA1_HUMAN DnaJ homolog subfamily A member 1 OS=Homo sapiens GN=DNAJA1 PE=1 SV=2 Back     alignment and function description
>sp|Q95JF4|DNAJ1_CHLAE DnaJ homolog subfamily A member 1 OS=Chlorocebus aethiops GN=DNAJA1 PE=2 SV=1 Back     alignment and function description
>sp|Q5E954|DNJA1_BOVIN DnaJ homolog subfamily A member 1 OS=Bos taurus GN=DNAJA1 PE=2 SV=2 Back     alignment and function description
>sp|P63036|DNJA1_RAT DnaJ homolog subfamily A member 1 OS=Rattus norvegicus GN=Dnaja1 PE=2 SV=1 Back     alignment and function description
>sp|P63037|DNJA1_MOUSE DnaJ homolog subfamily A member 1 OS=Mus musculus GN=Dnaja1 PE=1 SV=1 Back     alignment and function description
>sp|Q9JMC3|DNJA4_MOUSE DnaJ homolog subfamily A member 4 OS=Mus musculus GN=Dnaja4 PE=2 SV=1 Back     alignment and function description
>sp|Q8WW22|DNJA4_HUMAN DnaJ homolog subfamily A member 4 OS=Homo sapiens GN=DNAJA4 PE=1 SV=1 Back     alignment and function description
>sp|O60884|DNJA2_HUMAN DnaJ homolog subfamily A member 2 OS=Homo sapiens GN=DNAJA2 PE=1 SV=1 Back     alignment and function description
>sp|Q9QYJ0|DNJA2_MOUSE DnaJ homolog subfamily A member 2 OS=Mus musculus GN=Dnaja2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query178
242011850 354 protein tumorous imaginal discs, putativ 0.382 0.192 0.926 1e-29
114053203 401 DnaJ (Hsp40) homolog 2 [Bombyx mori] gi| 0.370 0.164 0.897 9e-29
350425734 398 PREDICTED: dnaJ homolog subfamily A memb 0.376 0.168 0.867 2e-28
340712982 398 PREDICTED: dnaJ homolog subfamily A memb 0.376 0.168 0.867 3e-28
110756003 399 PREDICTED: dnaJ homolog subfamily A memb 0.376 0.167 0.867 3e-28
187105120 402 DnaJ-like [Acyrthosiphon pisum] gi|89574 0.365 0.161 0.882 6e-28
241722212 366 molecular chaperone, putative [Ixodes sc 0.382 0.185 0.867 6e-28
307195605 397 DnaJ-like protein subfamily A member 1 [ 0.376 0.168 0.852 8e-28
332022328 399 DnaJ-like protein subfamily A member 1 [ 0.376 0.167 0.852 9e-28
322778807 398 hypothetical protein SINV_06602 [Solenop 0.376 0.168 0.852 9e-28
>gi|242011850|ref|XP_002426657.1| protein tumorous imaginal discs, putative [Pediculus humanus corporis] gi|212510821|gb|EEB13919.1| protein tumorous imaginal discs, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  134 bits (338), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 63/68 (92%), Positives = 65/68 (95%)

Query: 42  MVKETTFYDILGVKPNCTQDELKKAYRKLALKYHPDKNPNEGEKFKQISMAYEVLSNPEK 101
           MVKETT+YDILGVKPNCT DELKKAYRKLALKYHPDKNPNEGEKFKQIS AYEVLSNP+K
Sbjct: 1   MVKETTYYDILGVKPNCTLDELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSNPDK 60

Query: 102 RELYDQGA 109
           RELYDQG 
Sbjct: 61  RELYDQGG 68

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|114053203|ref|NP_001040292.1| DnaJ (Hsp40) homolog 2 [Bombyx mori] gi|87248655|gb|ABD36380.1| DnaJ homolog subfamily A member 1 [Bombyx mori] gi|253721945|gb|ACT34036.1| DnaJ-2 [Bombyx mori] gi|378465711|gb|AFC01216.1| DnaJ-2 [Bombyx mori] Back     alignment and taxonomy information
>gi|350425734|ref|XP_003494215.1| PREDICTED: dnaJ homolog subfamily A member 1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340712982|ref|XP_003395031.1| PREDICTED: dnaJ homolog subfamily A member 1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|110756003|ref|XP_001119835.1| PREDICTED: dnaJ homolog subfamily A member 1 [Apis mellifera] gi|380021485|ref|XP_003694595.1| PREDICTED: dnaJ homolog subfamily A member 1-like [Apis florea] Back     alignment and taxonomy information
>gi|187105120|ref|NP_001119620.1| DnaJ-like [Acyrthosiphon pisum] gi|89574485|gb|ABD76373.1| DnaJ-lik protein [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|241722212|ref|XP_002413667.1| molecular chaperone, putative [Ixodes scapularis] gi|215507483|gb|EEC16975.1| molecular chaperone, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|307195605|gb|EFN77455.1| DnaJ-like protein subfamily A member 1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332022328|gb|EGI62640.1| DnaJ-like protein subfamily A member 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|322778807|gb|EFZ09223.1| hypothetical protein SINV_06602 [Solenopsis invicta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query178
FB|FBgn0038145 403 Droj2 "DnaJ-like-2" [Drosophil 0.376 0.166 0.641 5.8e-26
UNIPROTKB|Q5E954 397 DNAJA1 "DnaJ homolog subfamily 0.376 0.168 0.686 1.1e-25
UNIPROTKB|E2RM09 397 LOC474739 "Uncharacterized pro 0.376 0.168 0.686 1.1e-25
UNIPROTKB|P31689 397 DNAJA1 "DnaJ homolog subfamily 0.376 0.168 0.686 1.1e-25
UNIPROTKB|F1SE73 397 DNAJA1 "Uncharacterized protei 0.376 0.168 0.686 1.1e-25
MGI|MGI:1270129 397 Dnaja1 "DnaJ (Hsp40) homolog, 0.376 0.168 0.671 2.6e-25
RGD|620942 397 Dnaja1 "DnaJ (Hsp40) homolog, 0.376 0.168 0.671 2.6e-25
UNIPROTKB|F1NLH8 402 DNAJA4 "Uncharacterized protei 0.455 0.201 0.543 2.3e-24
UNIPROTKB|F1PJW4 392 F1PJW4 "Uncharacterized protei 0.370 0.168 0.651 3.2e-24
UNIPROTKB|E2R7K1 391 E2R7K1 "Uncharacterized protei 0.376 0.171 0.686 4.7e-24
FB|FBgn0038145 Droj2 "DnaJ-like-2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 227 (85.0 bits), Expect = 5.8e-26, Sum P(2) = 5.8e-26
 Identities = 43/67 (64%), Positives = 49/67 (73%)

Query:    42 MVKETTFYDILGVKPNCTQDEXXXXXXXXXXXXHPDKNPNEGEKFKQISMAYEVLSNPEK 101
             MVKET +YDILGVKPN T DE            HPDKNPNEGEKFK IS AYEVLS+ +K
Sbjct:     1 MVKETGYYDILGVKPNATPDELKKAYRKLALKYHPDKNPNEGEKFKAISQAYEVLSDADK 60

Query:   102 RELYDQG 108
             R++YD+G
Sbjct:    61 RQVYDEG 67
GO:0009408 "response to heat" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0051082 "unfolded protein binding" evidence=IEA
GO:0006457 "protein folding" evidence=IEA
GO:0031072 "heat shock protein binding" evidence=IEA
GO:0022008 "neurogenesis" evidence=IMP
UNIPROTKB|Q5E954 DNAJA1 "DnaJ homolog subfamily A member 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RM09 LOC474739 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P31689 DNAJA1 "DnaJ homolog subfamily A member 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SE73 DNAJA1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1270129 Dnaja1 "DnaJ (Hsp40) homolog, subfamily A, member 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|620942 Dnaja1 "DnaJ (Hsp40) homolog, subfamily A, member 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NLH8 DNAJA4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1PJW4 F1PJW4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2R7K1 E2R7K1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B9MJZ0DNAJ_CALBDNo assigned EC number0.53240.41570.1907yesN/A
Q5P9E0DNAJ_ANAMMNo assigned EC number0.51940.41570.1952yesN/A
Q54ED3DNJA1_DICDINo assigned EC number0.60970.43250.1677yesN/A
B9KH92DNAJ_ANAMFNo assigned EC number0.51940.41570.1952yesN/A
A4XKA5DNAJ_CALS8No assigned EC number0.53240.41570.1912yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query178
pfam0022663 pfam00226, DnaJ, DnaJ domain 4e-33
COG0484 371 COG0484, DnaJ, DnaJ-class molecular chaperone with 6e-31
TIGR02349 354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 3e-30
PRK10767 371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 9e-29
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 1e-26
PRK14278 378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 7e-26
PRK14291 382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 1e-25
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 2e-25
PRK14281 397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 9e-24
PRK14284 391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 2e-23
PRK14294 366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 3e-23
PRK14293 374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 3e-23
PRK14276 380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 5e-23
PTZ00037 421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 1e-22
PRK14277 386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 2e-22
PRK14289 386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 5e-22
PRK14298 377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 1e-21
PRK14280 376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 2e-21
PRK14297 380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 4e-21
PRK14290 365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 1e-20
PRK14301 373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 2e-20
COG2214237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 6e-20
PRK14283 378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 8e-20
PRK14292 371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 1e-19
PRK14299 291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 2e-19
PRK14279 392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 2e-19
PRK14282 369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 3e-19
PRK14286 372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 3e-18
PRK14295 389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 5e-18
PRK14287 371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 5e-16
PRK10266 306 PRK10266, PRK10266, curved DNA-binding protein Cbp 1e-15
PRK14285 365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 2e-15
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 2e-15
PRK14288 369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 4e-14
PRK14296 372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 7e-14
PRK14300 372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 1e-12
COG5407 610 COG5407, SEC63, Preprotein translocase subunit Sec 2e-10
PRK09430267 PRK09430, djlA, Dna-J like membrane chaperone prot 2e-09
PTZ00341 1136 PTZ00341, PTZ00341, Ring-infected erythrocyte surf 2e-08
COG5269 379 COG5269, ZUO1, Ribosome-associated chaperone zuoti 6e-06
PHA03102153 PHA03102, PHA03102, Small T antigen; Reviewed 1e-04
PHA02624 647 PHA02624, PHA02624, large T antigen; Provisional 5e-04
COG1076174 COG1076, DjlA, DnaJ-domain-containing proteins 1 [ 0.001
PRK01356166 PRK01356, hscB, co-chaperone HscB; Provisional 0.003
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information 
 Score =  112 bits (282), Expect = 4e-33
 Identities = 40/63 (63%), Positives = 51/63 (80%), Gaps = 3/63 (4%)

Query: 47  TFYDILGVKPNCTQDELKKAYRKLALKYHPDKNPNEG---EKFKQISMAYEVLSNPEKRE 103
            +Y+ILGV  + + +E+KKAYRKLALKYHPDKNP +    EKFK+I+ AYEVLS+PEKR 
Sbjct: 1   DYYEILGVPRDASDEEIKKAYRKLALKYHPDKNPGDPAAEEKFKEINEAYEVLSDPEKRA 60

Query: 104 LYD 106
           +YD
Sbjct: 61  IYD 63

DnaJ domains (J-domains) are associated with hsp70 heat-shock system and it is thought that this domain mediates the interaction. DnaJ-domain is therefore part of a chaperone (protein folding) system. The T-antigens, although not in Prosite are confirmed as DnaJ containing domains from literature. Length = 63
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|236512 PRK09430, djlA, Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|222986 PHA03102, PHA03102, Small T antigen; Reviewed Back     alignment and domain information
>gnl|CDD|222912 PHA02624, PHA02624, large T antigen; Provisional Back     alignment and domain information
>gnl|CDD|224002 COG1076, DjlA, DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|167217 PRK01356, hscB, co-chaperone HscB; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 178
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 99.92
KOG0713|consensus 336 99.88
KOG0712|consensus 337 99.86
PRK14296 372 chaperone protein DnaJ; Provisional 99.83
PRK14288 369 chaperone protein DnaJ; Provisional 99.83
PTZ00037 421 DnaJ_C chaperone protein; Provisional 99.82
PRK14286 372 chaperone protein DnaJ; Provisional 99.8
PRK14283 378 chaperone protein DnaJ; Provisional 99.8
PRK14282 369 chaperone protein DnaJ; Provisional 99.8
PRK14287 371 chaperone protein DnaJ; Provisional 99.79
PRK14279 392 chaperone protein DnaJ; Provisional 99.79
PRK14277 386 chaperone protein DnaJ; Provisional 99.79
PRK14298 377 chaperone protein DnaJ; Provisional 99.79
PRK14276 380 chaperone protein DnaJ; Provisional 99.79
PRK14294 366 chaperone protein DnaJ; Provisional 99.78
PRK14291 382 chaperone protein DnaJ; Provisional 99.78
PRK14299 291 chaperone protein DnaJ; Provisional 99.78
PRK14285 365 chaperone protein DnaJ; Provisional 99.78
PRK14280 376 chaperone protein DnaJ; Provisional 99.77
PRK14301 373 chaperone protein DnaJ; Provisional 99.77
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.77
PRK14297 380 chaperone protein DnaJ; Provisional 99.77
KOG0716|consensus 279 99.76
PRK14295 389 chaperone protein DnaJ; Provisional 99.76
PRK10767 371 chaperone protein DnaJ; Provisional 99.76
PRK14278 378 chaperone protein DnaJ; Provisional 99.76
PRK14289 386 chaperone protein DnaJ; Provisional 99.75
PRK14284 391 chaperone protein DnaJ; Provisional 99.75
KOG0718|consensus 546 99.75
PRK14281 397 chaperone protein DnaJ; Provisional 99.74
PRK14290 365 chaperone protein DnaJ; Provisional 99.73
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 99.73
PRK14300 372 chaperone protein DnaJ; Provisional 99.72
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.72
KOG0691|consensus 296 99.72
PRK14292 371 chaperone protein DnaJ; Provisional 99.71
KOG0715|consensus 288 99.71
PRK14293 374 chaperone protein DnaJ; Provisional 99.71
PRK10266 306 curved DNA-binding protein CbpA; Provisional 99.71
KOG0717|consensus 508 99.69
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.68
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.67
PHA03102153 Small T antigen; Reviewed 99.64
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.63
KOG0719|consensus 264 99.63
COG2214237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.61
KOG0721|consensus230 99.59
PRK01356166 hscB co-chaperone HscB; Provisional 99.52
PRK05014171 hscB co-chaperone HscB; Provisional 99.52
PRK00294173 hscB co-chaperone HscB; Provisional 99.5
PRK03578176 hscB co-chaperone HscB; Provisional 99.46
KOG0624|consensus504 99.44
PTZ00100116 DnaJ chaperone protein; Provisional 99.43
KOG0720|consensus 490 99.42
KOG0550|consensus486 99.35
KOG0714|consensus 306 99.33
PHA02624 647 large T antigen; Provisional 99.32
KOG0722|consensus 329 99.32
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.28
PRK01773173 hscB co-chaperone HscB; Provisional 99.22
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 99.06
COG5269 379 ZUO1 Ribosome-associated chaperone zuotin [Transla 99.0
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 98.98
KOG1150|consensus250 98.97
KOG1789|consensus 2235 98.73
KOG0723|consensus112 98.43
KOG0568|consensus 342 98.31
KOG3192|consensus168 97.8
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 96.56
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 96.4
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 96.36
KOG0431|consensus453 96.31
PF1344662 RPT: A repeated domain in UCH-protein 90.81
PF11833194 DUF3353: Protein of unknown function (DUF3353); In 89.3
PTZ00037421 DnaJ_C chaperone protein; Provisional 84.08
KOG0724|consensus 335 82.95
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.92  E-value=3.4e-25  Score=191.48  Aligned_cols=73  Identities=53%  Similarity=0.893  Sum_probs=67.8

Q ss_pred             CCccCchhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCC---ChHHHHHHHHHHHHHcCChhHHHHhccccccccCC
Q psy15361         43 VKETTFYDILGVKPNCTQDELKKAYRKLALKYHPDKNP---NEGEKFKQISMAYEVLSNPEKRELYDQGASCLMAP  115 (178)
Q Consensus        43 ~~~~d~Y~vLgv~~~as~~eIK~aYr~l~~~~HPDk~~---~~~~~f~~I~~Ay~vL~d~~~R~~YD~~~~~~~~~  115 (178)
                      |..+|||+||||+++||.+|||+|||+|+++||||+|+   +++++|++|++||+||+||++|++||+++..++..
T Consensus         1 ~~~~dyYeiLGV~k~As~~EIKkAYRkLA~kyHPD~n~g~~~AeeKFKEI~eAYEVLsD~eKRa~YD~fG~~~~~~   76 (371)
T COG0484           1 MAKRDYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGDKEAEEKFKEINEAYEVLSDPEKRAAYDQFGHAGFKA   76 (371)
T ss_pred             CCccchhhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCCHHHHHHHHHHHHHHHHhCCHHHHHHhhccCcccccc
Confidence            35789999999999999999999999999999999997   35799999999999999999999999999988753

>KOG0713|consensus Back     alignment and domain information
>KOG0712|consensus Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0716|consensus Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0718|consensus Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>KOG0691|consensus Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0715|consensus Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>KOG0717|consensus Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>KOG0719|consensus Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0721|consensus Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>KOG0720|consensus Back     alignment and domain information
>KOG0550|consensus Back     alignment and domain information
>KOG0714|consensus Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>KOG0722|consensus Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>KOG1150|consensus Back     alignment and domain information
>KOG1789|consensus Back     alignment and domain information
>KOG0723|consensus Back     alignment and domain information
>KOG0568|consensus Back     alignment and domain information
>KOG3192|consensus Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0431|consensus Back     alignment and domain information
>PF13446 RPT: A repeated domain in UCH-protein Back     alignment and domain information
>PF11833 DUF3353: Protein of unknown function (DUF3353); InterPro: IPR021788 This family of proteins are functionally uncharacterised Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>KOG0724|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query178
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 7e-22
2och_A73 J-domain Of Dnj-12 From Caenorhabditis Elegans Leng 1e-16
2o37_A92 J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S 7e-13
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 2e-08
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 4e-08
2lgw_A99 Solution Structure Of The J Domain Of Hsj1a Length 7e-08
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 3e-07
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 6e-07
2ctw_A109 Solution Structure Of J-Domain From Mouse Dnaj Subf 7e-07
2cug_A88 Solution Structure Of The J Domain Of The Pseudo Dn 8e-07
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 1e-06
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 1e-06
2dn9_A79 Solution Structure Of J-Domain From The Dnaj Homolo 2e-06
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 3e-06
2ctr_A88 Solution Structure Of J-Domain From Human Dnaj Subf 4e-06
2yua_A99 Solution Structure Of The Dnaj Domain From Human Wi 9e-06
2kqx_A73 Nmr Structure Of The J-Domain (Residues 2-72) In Th 8e-05
3apo_A 780 Crystal Structure Of Full-Length Erdj5 Length = 780 8e-05
3apq_A210 Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt 1e-04
2y4u_A450 Crystal Structure Of Human P58(Ipk) In Space Group 6e-04
2y4t_A450 Crystal Structure Of The Human Co-Chaperone P58(Ipk 8e-04
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure 
Iteration: 1

 Score = 99.8 bits (247), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 46/68 (67%), Positives = 52/68 (76%)
Query: 42  MVKETTFYDILGVKPNCTQDEXXXXXXXXXXXXHPDKNPNEGEKFKQISMAYEVLSNPEK 101
           MVKETT+YD+LGVKPN TQ+E            HPDKNPNEGEKFKQIS AYEVLS+ +K
Sbjct: 2   MVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDAKK 61
Query: 102 RELYDQGA 109
           RELYD+G 
Sbjct: 62  RELYDKGG 69
>pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure
>pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 Back     alignment and structure
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure
>pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 Back     alignment and structure
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure
>pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 Back     alignment and structure
>pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 Back     alignment and structure
>pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure
>pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 Back     alignment and structure
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure
>pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 Back     alignment and structure
>pdb|2YUA|A Chain A, Solution Structure Of The Dnaj Domain From Human Williams- Beuren Syndrome Chromosome Region 18 Protein Length = 99 Back     alignment and structure
>pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 Back     alignment and structure
>pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 Back     alignment and structure
>pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 Back     alignment and structure
>pdb|2Y4U|A Chain A, Crystal Structure Of Human P58(Ipk) In Space Group P312 Length = 450 Back     alignment and structure
>pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query178
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 2e-42
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 1e-41
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 1e-34
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 2e-33
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 3e-33
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 3e-33
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 4e-33
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 1e-32
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 1e-32
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 3e-32
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 3e-32
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 6e-32
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 1e-31
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 1e-31
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 2e-31
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 3e-31
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 3e-31
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 7e-31
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 8e-31
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 1e-29
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 1e-29
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 1e-28
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 2e-26
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-23
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 2e-22
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 3e-19
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 9e-18
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 1e-16
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 5e-16
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 3e-15
2guz_A71 Mitochondrial import inner membrane translocase su 3e-14
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 2e-12
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 7e-11
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 3e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
 Score =  135 bits (342), Expect = 2e-42
 Identities = 47/67 (70%), Positives = 60/67 (89%)

Query: 42  MVKETTFYDILGVKPNCTQDELKKAYRKLALKYHPDKNPNEGEKFKQISMAYEVLSNPEK 101
           MVKET +YD+LGVKP+ + +ELKKAYRK+ALK+HPDKNP+  E+FKQIS AYEVLS+ +K
Sbjct: 4   MVKETGYYDVLGVKPDASDNELKKAYRKMALKFHPDKNPDGAEQFKQISQAYEVLSDEKK 63

Query: 102 RELYDQG 108
           R++YDQG
Sbjct: 64  RQIYDQG 70
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query178
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.88
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.88
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.86
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.85
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.85
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.85
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.85
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.84
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.84
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.83
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.83
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.83
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.82
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.82
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.81
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.79
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.76
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.76
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.75
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.73
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.73
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.72
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.7
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.69
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.69
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 99.69
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.68
2guz_A71 Mitochondrial import inner membrane translocase su 99.65
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.65
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.63
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.61
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.6
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.58
2guz_B65 Mitochondrial import inner membrane translocase su 99.06
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.03
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 90.77
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
Probab=99.88  E-value=7.8e-23  Score=138.65  Aligned_cols=70  Identities=67%  Similarity=1.128  Sum_probs=63.9

Q ss_pred             CCCCccCchhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCChHHHHHHHHHHHHHcCChhHHHHhccccc
Q psy15361         41 NMVKETTFYDILGVKPNCTQDELKKAYRKLALKYHPDKNPNEGEKFKQISMAYEVLSNPEKRELYDQGAS  110 (178)
Q Consensus        41 ~~~~~~d~Y~vLgv~~~as~~eIK~aYr~l~~~~HPDk~~~~~~~f~~I~~Ay~vL~d~~~R~~YD~~~~  110 (178)
                      .|+...+||+||||+++++.++||++|+++++++|||+++++.+.|+.|++||++|+||.+|..||.+|.
T Consensus         3 ~m~~~~~~y~iLgl~~~a~~~eIk~ayr~l~~~~HPD~~~~~~~~f~~i~~Ay~~L~d~~~R~~YD~~g~   72 (73)
T 2och_A            3 AMVKETGYYDVLGVKPDASDNELKKAYRKMALKFHPDKNPDGAEQFKQISQAYEVLSDEKKRQIYDQGGE   72 (73)
T ss_dssp             ---CCCCHHHHHTCCTTCCHHHHHHHHHHHHHHTCTTTCTTCHHHHHHHHHHHHHHTSHHHHHHHHHTC-
T ss_pred             cccCCCCHHHHcCCCCCCCHHHHHHHHHHHHHHHCcCCCcCHHHHHHHHHHHHHHHCCHHHHHHHHhcCC
Confidence            4677889999999999999999999999999999999998888999999999999999999999998775
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 178
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 2e-20
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 6e-20
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 7e-19
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 8e-19
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 3e-18
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 8e-18
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 3e-16
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 2e-13
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK)
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 78.6 bits (193), Expect = 2e-20
 Identities = 24/69 (34%), Positives = 36/69 (52%), Gaps = 9/69 (13%)

Query: 48  FYDILGVKPNCTQDELKKAYRKLALKYHPDKNPNEGEK---------FKQISMAYEVLSN 98
           +Y ILG  P+    +LK+ Y+KL L YHPDK   +            F +I  A+++L N
Sbjct: 18  WYSILGADPSANMSDLKQKYQKLILLYHPDKQSADVPAGTMEECMQKFIEIDQAWKILGN 77

Query: 99  PEKRELYDQ 107
            E ++ YD 
Sbjct: 78  EETKKKYDL 86
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query178
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.88
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.82
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.81
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.76
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.71
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.62
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.6
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

Probab=99.88  E-value=2.1e-23  Score=141.08  Aligned_cols=69  Identities=45%  Similarity=0.832  Sum_probs=63.3

Q ss_pred             ccCchhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCC---hHHHHHHHHHHHHHcCChhHHHHhcccccccc
Q psy15361         45 ETTFYDILGVKPNCTQDELKKAYRKLALKYHPDKNPN---EGEKFKQISMAYEVLSNPEKRELYDQGASCLM  113 (178)
Q Consensus        45 ~~d~Y~vLgv~~~as~~eIK~aYr~l~~~~HPDk~~~---~~~~f~~I~~Ay~vL~d~~~R~~YD~~~~~~~  113 (178)
                      .+|||+||||++++|.++||+||+++++++|||++++   ..+.|..|++||+||+||.+|..||++|..++
T Consensus         2 k~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~~~   73 (75)
T d1xbla_           2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAAF   73 (75)
T ss_dssp             CCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTTCHHHHHHHHHHHHHHHTTSSHHHHHHHHHTTSSC
T ss_pred             CCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCChHHHHHHHHHHHHHHhcCCHHHHHHHHHhCcccc
Confidence            4699999999999999999999999999999999854   35779999999999999999999999887654
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure