Psyllid ID: psy15462
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 71 | ||||||
| 210622381 | 343 | hypothetical protein CLOHIR_01082 [Clost | 0.915 | 0.189 | 0.630 | 6e-18 | |
| 383620064 | 337 | threonine aldolase [Halobiforma lacisals | 1.0 | 0.210 | 0.56 | 2e-17 | |
| 448375471 | 338 | threonine aldolase [Halovivax asiaticus | 0.845 | 0.177 | 0.666 | 4e-17 | |
| 91084465 | 380 | PREDICTED: similar to l-allo-threonine a | 0.929 | 0.173 | 0.636 | 4e-17 | |
| 270012324 | 286 | hypothetical protein TcasGA2_TC006461 [T | 0.929 | 0.230 | 0.636 | 5e-17 | |
| 332373700 | 378 | unknown [Dendroctonus ponderosae] | 0.845 | 0.158 | 0.666 | 1e-16 | |
| 390933899 | 345 | aromatic amino acid beta-eliminating lya | 0.845 | 0.173 | 0.65 | 1e-16 | |
| 336252767 | 337 | Threonine aldolase [Halopiger xanaduensi | 1.0 | 0.210 | 0.533 | 1e-16 | |
| 302389238 | 347 | L-threonine aldolase [Thermosediminibact | 0.845 | 0.172 | 0.633 | 1e-16 | |
| 333896042 | 345 | tjhreonine aldolase [Thermoanaerobacteri | 0.845 | 0.173 | 0.633 | 2e-16 |
| >gi|210622381|ref|ZP_03293134.1| hypothetical protein CLOHIR_01082 [Clostridium hiranonis DSM 13275] gi|210154263|gb|EEA85269.1| hypothetical protein CLOHIR_01082 [Clostridium hiranonis DSM 13275] | Back alignment and taxonomy information |
|---|
Score = 94.7 bits (234), Expect = 6e-18, Method: Composition-based stats.
Identities = 41/65 (63%), Positives = 54/65 (83%)
Query: 7 LKARCQEHNIPVHMDGARVFNAASYLGLPLAEVCASVDTVMFCLSKGLGAPVGSILAGPE 66
+K ++HN+PVH+DGAR+FNAA LG+ + E+ A D+VMFCLSKGLGAPVGSI+AG +
Sbjct: 155 IKDVAEKHNLPVHLDGARIFNAAEALGVDVKEITACCDSVMFCLSKGLGAPVGSIVAGSK 214
Query: 67 EFIQK 71
EFI+K
Sbjct: 215 EFIEK 219
|
Source: Clostridium hiranonis DSM 13275 Species: [Clostridium] hiranonis Genus: Family: Peptostreptococcaceae Order: Clostridiales Class: Clostridia Phylum: Firmicutes Superkingdom: Bacteria |
| >gi|383620064|ref|ZP_09946470.1| threonine aldolase [Halobiforma lacisalsi AJ5] gi|448696240|ref|ZP_21697801.1| threonine aldolase [Halobiforma lacisalsi AJ5] gi|445783928|gb|EMA34752.1| threonine aldolase [Halobiforma lacisalsi AJ5] | Back alignment and taxonomy information |
|---|
| >gi|448375471|ref|ZP_21558948.1| threonine aldolase [Halovivax asiaticus JCM 14624] gi|445658742|gb|ELZ11558.1| threonine aldolase [Halovivax asiaticus JCM 14624] | Back alignment and taxonomy information |
|---|
| >gi|91084465|ref|XP_970449.1| PREDICTED: similar to l-allo-threonine aldolase [Tribolium castaneum] gi|270008687|gb|EFA05135.1| hypothetical protein TcasGA2_TC015250 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|270012324|gb|EFA08772.1| hypothetical protein TcasGA2_TC006461 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|332373700|gb|AEE61991.1| unknown [Dendroctonus ponderosae] | Back alignment and taxonomy information |
|---|
| >gi|390933899|ref|YP_006391404.1| aromatic amino acid beta-eliminating lyase/threonine aldolase [Thermoanaerobacterium saccharolyticum JW/SL-YS485] gi|389569400|gb|AFK85805.1| aromatic amino acid beta-eliminating lyase/threonine aldolase [Thermoanaerobacterium saccharolyticum JW/SL-YS485] | Back alignment and taxonomy information |
|---|
| >gi|336252767|ref|YP_004595874.1| Threonine aldolase [Halopiger xanaduensis SH-6] gi|335336756|gb|AEH35995.1| Threonine aldolase [Halopiger xanaduensis SH-6] | Back alignment and taxonomy information |
|---|
| >gi|302389238|ref|YP_003825059.1| L-threonine aldolase [Thermosediminibacter oceani DSM 16646] gi|302199866|gb|ADL07436.1| L-threonine aldolase [Thermosediminibacter oceani DSM 16646] | Back alignment and taxonomy information |
|---|
| >gi|333896042|ref|YP_004469916.1| tjhreonine aldolase [Thermoanaerobacterium xylanolyticum LX-11] gi|333111307|gb|AEF16244.1| Threonine aldolase [Thermoanaerobacterium xylanolyticum LX-11] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 71 | ||||||
| TIGR_CMR|CHY_0904 | 344 | CHY_0904 "low-specificity L-th | 0.929 | 0.191 | 0.545 | 3.6e-16 | |
| TIGR_CMR|GSU_3162 | 348 | GSU_3162 "L-allo-threonine ald | 0.971 | 0.198 | 0.535 | 2.4e-15 | |
| CGD|CAL0003813 | 373 | GLY1 [Candida albicans (taxid: | 0.859 | 0.163 | 0.508 | 4e-13 | |
| UNIPROTKB|Q59NC4 | 373 | GLY1 "Putative uncharacterized | 0.859 | 0.163 | 0.508 | 4e-13 | |
| TAIR|locus:2025645 | 358 | THA1 "threonine aldolase 1" [A | 0.845 | 0.167 | 0.5 | 5.9e-13 | |
| TAIR|locus:2100860 | 355 | THA2 "threonine aldolase 2" [A | 0.845 | 0.169 | 0.483 | 7.4e-13 | |
| CGD|CAL0001235 | 369 | orf19.6305 [Candida albicans ( | 0.859 | 0.165 | 0.475 | 1.4e-12 | |
| UNIPROTKB|Q59N07 | 369 | GLY12 "Putative uncharacterize | 0.859 | 0.165 | 0.475 | 1.4e-12 | |
| FB|FBgn0039094 | 383 | CG10184 [Drosophila melanogast | 0.788 | 0.146 | 0.571 | 3.3e-12 | |
| UNIPROTKB|Q4K842 | 334 | PFL_4507 "L-allo-threonine ald | 0.929 | 0.197 | 0.5 | 3.7e-12 |
| TIGR_CMR|CHY_0904 CHY_0904 "low-specificity L-threonine aldolase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
Score = 204 (76.9 bits), Expect = 3.6e-16, P = 3.6e-16
Identities = 36/66 (54%), Positives = 49/66 (74%)
Query: 6 QLKARCQEHNIPVHMDGARVFNAASYLGLPLAEVCASVDTVMFCLSKGLGAPVGSILAGP 65
+++ + H + +H+DGAR+FNAA YLG+ E+ D+VMFCLSKGL APVGSILAG
Sbjct: 153 KIREIAESHGLKIHLDGARIFNAAIYLGVDAREIARYADSVMFCLSKGLSAPVGSILAGS 212
Query: 66 EEFIQK 71
EF++K
Sbjct: 213 REFVEK 218
|
|
| TIGR_CMR|GSU_3162 GSU_3162 "L-allo-threonine aldolase" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0003813 GLY1 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q59NC4 GLY1 "Putative uncharacterized protein GLY11" [Candida albicans SC5314 (taxid:237561)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2025645 THA1 "threonine aldolase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2100860 THA2 "threonine aldolase 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0001235 orf19.6305 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q59N07 GLY12 "Putative uncharacterized protein GLY12" [Candida albicans SC5314 (taxid:237561)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0039094 CG10184 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q4K842 PFL_4507 "L-allo-threonine aldolase" [Pseudomonas protegens Pf-5 (taxid:220664)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 71 | |||
| pfam01212 | 288 | pfam01212, Beta_elim_lyase, Beta-eliminating lyase | 6e-28 | |
| cd06502 | 338 | cd06502, TA_like, Low-specificity threonine aldola | 2e-26 | |
| COG2008 | 342 | COG2008, GLY1, Threonine aldolase [Amino acid tran | 2e-25 | |
| PLN02721 | 353 | PLN02721, PLN02721, threonine aldolase | 7e-21 | |
| PRK10534 | 333 | PRK10534, PRK10534, L-threonine aldolase; Provisio | 2e-20 | |
| cd01494 | 170 | cd01494, AAT_I, Aspartate aminotransferase (AAT) s | 2e-04 | |
| TIGR00474 | 454 | TIGR00474, selA, seryl-tRNA(sec) selenium transfer | 0.001 |
| >gnl|CDD|216367 pfam01212, Beta_elim_lyase, Beta-eliminating lyase | Back alignment and domain information |
|---|
Score = 100 bits (252), Expect = 6e-28
Identities = 34/66 (51%), Positives = 49/66 (74%)
Query: 6 QLKARCQEHNIPVHMDGARVFNAASYLGLPLAEVCASVDTVMFCLSKGLGAPVGSILAGP 65
+++A +EH IP+H+DGAR+ NAA LG+ + E+ + D+V LSKGLGAPVGS+LAG
Sbjct: 153 EIRAIAREHGIPLHLDGARLANAAVALGVIVKEITSYADSVSMSLSKGLGAPVGSVLAGS 212
Query: 66 EEFIQK 71
++FI
Sbjct: 213 DDFIAY 218
|
Length = 288 |
| >gnl|CDD|99748 cd06502, TA_like, Low-specificity threonine aldolase (TA) | Back alignment and domain information |
|---|
| >gnl|CDD|224919 COG2008, GLY1, Threonine aldolase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|178323 PLN02721, PLN02721, threonine aldolase | Back alignment and domain information |
|---|
| >gnl|CDD|236710 PRK10534, PRK10534, L-threonine aldolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|99742 cd01494, AAT_I, Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes | Back alignment and domain information |
|---|
| >gnl|CDD|232992 TIGR00474, selA, seryl-tRNA(sec) selenium transferase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 71 | |||
| KOG1368|consensus | 384 | 99.9 | ||
| COG2008 | 342 | GLY1 Threonine aldolase [Amino acid transport and | 99.89 | |
| PF01212 | 290 | Beta_elim_lyase: Beta-eliminating lyase; InterPro: | 99.89 | |
| TIGR02617 | 467 | tnaA_trp_ase tryptophanase, leader peptide-associa | 99.84 | |
| PF03841 | 367 | SelA: L-seryl-tRNA selenium transferase; InterPro: | 99.66 | |
| TIGR02618 | 450 | tyr_phenol_ly tyrosine phenol-lyase. This model de | 99.65 | |
| PRK13237 | 460 | tyrosine phenol-lyase; Provisional | 99.54 | |
| COG1921 | 395 | SelA Selenocysteine synthase [seryl-tRNASer seleni | 99.52 | |
| COG0520 | 405 | csdA Selenocysteine lyase/Cysteine desulfurase [Po | 99.44 | |
| PRK04311 | 464 | selenocysteine synthase; Provisional | 99.42 | |
| TIGR00474 | 454 | selA seryl-tRNA(sec) selenium transferase. In bact | 99.42 | |
| cd00617 | 431 | Tnase_like Tryptophanase family (Tnase). This fami | 99.39 | |
| PLN02590 | 539 | probable tyrosine decarboxylase | 99.39 | |
| PLN02721 | 353 | threonine aldolase | 99.37 | |
| PF00282 | 373 | Pyridoxal_deC: Pyridoxal-dependent decarboxylase c | 99.35 | |
| PLN03032 | 374 | serine decarboxylase; Provisional | 99.34 | |
| TIGR03799 | 522 | NOD_PanD_pyr putative pyridoxal-dependent aspartat | 99.34 | |
| TIGR01437 | 363 | selA_rel uncharacterized pyridoxal phosphate-depen | 99.31 | |
| PRK13238 | 460 | tnaA tryptophanase/L-cysteine desulfhydrase, PLP-d | 99.31 | |
| PRK02769 | 380 | histidine decarboxylase; Provisional | 99.3 | |
| PLN02880 | 490 | tyrosine decarboxylase | 99.3 | |
| cd06502 | 338 | TA_like Low-specificity threonine aldolase (TA). T | 99.3 | |
| COG3033 | 471 | TnaA Tryptophanase [Amino acid transport and metab | 99.21 | |
| COG0076 | 460 | GadB Glutamate decarboxylase and related PLP-depen | 99.2 | |
| PTZ00094 | 452 | serine hydroxymethyltransferase; Provisional | 99.18 | |
| TIGR01788 | 431 | Glu-decarb-GAD glutamate decarboxylase. This model | 99.18 | |
| COG1104 | 386 | NifS Cysteine sulfinate desulfinase/cysteine desul | 99.15 | |
| PLN02263 | 470 | serine decarboxylase | 99.13 | |
| PLN02651 | 364 | cysteine desulfurase | 99.12 | |
| PLN03226 | 475 | serine hydroxymethyltransferase; Provisional | 99.12 | |
| cd01494 | 170 | AAT_I Aspartate aminotransferase (AAT) superfamily | 99.08 | |
| cd06453 | 373 | SufS_like Cysteine desulfurase (SufS)-like. This f | 99.06 | |
| PRK09331 | 387 | Sep-tRNA:Cys-tRNA synthetase; Provisional | 99.03 | |
| TIGR03531 | 444 | selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium tr | 99.02 | |
| KOG1549|consensus | 428 | 99.01 | ||
| PRK13034 | 416 | serine hydroxymethyltransferase; Reviewed | 99.0 | |
| PRK10534 | 333 | L-threonine aldolase; Provisional | 99.0 | |
| PRK13580 | 493 | serine hydroxymethyltransferase; Provisional | 98.99 | |
| TIGR03235 | 353 | DNA_S_dndA cysteine desulfurase DndA. This model d | 98.98 | |
| TIGR02326 | 363 | transamin_PhnW 2-aminoethylphosphonate--pyruvate t | 98.98 | |
| TIGR03812 | 373 | tyr_de_CO2_Arch tyrosine decarboxylase MnfA. Membe | 98.97 | |
| PRK05968 | 389 | hypothetical protein; Provisional | 98.97 | |
| PF00266 | 371 | Aminotran_5: Aminotransferase class-V; InterPro: I | 98.96 | |
| TIGR01814 | 406 | kynureninase kynureninase. This model describes ky | 98.95 | |
| cd06452 | 361 | SepCysS Sep-tRNA:Cys-tRNA synthase. This family be | 98.92 | |
| PRK06767 | 386 | methionine gamma-lyase; Provisional | 98.92 | |
| TIGR01979 | 403 | sufS cysteine desulfurases, SufS subfamily. This m | 98.92 | |
| TIGR02006 | 402 | IscS cysteine desulfurase IscS. This model represe | 98.92 | |
| TIGR01328 | 391 | met_gam_lyase methionine gamma-lyase. This model d | 98.92 | |
| PRK05613 | 437 | O-acetylhomoserine aminocarboxypropyltransferase; | 98.92 | |
| TIGR01977 | 376 | am_tr_V_EF2568 cysteine desulfurase family protein | 98.91 | |
| cd06451 | 356 | AGAT_like Alanine-glyoxylate aminotransferase (AGA | 98.91 | |
| TIGR03811 | 608 | tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcu | 98.9 | |
| TIGR01976 | 397 | am_tr_V_VC1184 cysteine desulfurase family protein | 98.9 | |
| TIGR01822 | 393 | 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A lig | 98.9 | |
| PRK13520 | 371 | L-tyrosine decarboxylase; Provisional | 98.89 | |
| cd06450 | 345 | DOPA_deC_like DOPA decarboxylase family. This fami | 98.89 | |
| PLN02271 | 586 | serine hydroxymethyltransferase | 98.88 | |
| cd00613 | 398 | GDC-P Glycine cleavage system P-protein, alpha- an | 98.88 | |
| PRK00011 | 416 | glyA serine hydroxymethyltransferase; Reviewed | 98.88 | |
| cd00378 | 402 | SHMT Serine-glycine hydroxymethyltransferase (SHMT | 98.87 | |
| PRK04366 | 481 | glycine dehydrogenase subunit 2; Validated | 98.87 | |
| TIGR03392 | 398 | FeS_syn_CsdA cysteine desulfurase, catalytic subun | 98.86 | |
| TIGR03301 | 355 | PhnW-AepZ 2-aminoethylphosphonate aminotransferase | 98.85 | |
| PRK08574 | 385 | cystathionine gamma-synthase; Provisional | 98.85 | |
| cd00614 | 369 | CGS_like CGS_like: Cystathionine gamma-synthase is | 98.84 | |
| PRK07504 | 398 | O-succinylhomoserine sulfhydrylase; Reviewed | 98.84 | |
| TIGR01324 | 377 | cysta_beta_ly_B cystathionine beta-lyase, bacteria | 98.84 | |
| PRK10874 | 401 | cysteine sulfinate desulfinase; Provisional | 98.83 | |
| TIGR03403 | 382 | nifS_epsilon cysteine desulfurase, NifS family, ep | 98.83 | |
| PRK09295 | 406 | bifunctional cysteine desulfurase/selenocysteine l | 98.83 | |
| PLN02855 | 424 | Bifunctional selenocysteine lyase/cysteine desulfu | 98.81 | |
| TIGR01325 | 380 | O_suc_HS_sulf O-succinylhomoserine sulfhydrylase. | 98.81 | |
| PRK03080 | 378 | phosphoserine aminotransferase; Provisional | 98.81 | |
| PRK13479 | 368 | 2-aminoethylphosphonate--pyruvate transaminase; Pr | 98.8 | |
| PRK07050 | 394 | cystathionine beta-lyase; Provisional | 98.8 | |
| PLN02724 | 805 | Molybdenum cofactor sulfurase | 98.8 | |
| PLN02409 | 401 | serine--glyoxylate aminotransaminase | 98.79 | |
| TIGR03402 | 379 | FeS_nifS cysteine desulfurase NifS. Members of thi | 98.79 | |
| PRK08134 | 433 | O-acetylhomoserine aminocarboxypropyltransferase; | 98.78 | |
| PRK07503 | 403 | methionine gamma-lyase; Provisional | 98.78 | |
| PRK14012 | 404 | cysteine desulfurase; Provisional | 98.78 | |
| PRK08249 | 398 | cystathionine gamma-synthase; Provisional | 98.76 | |
| PRK07811 | 388 | cystathionine gamma-synthase; Provisional | 98.75 | |
| PRK09028 | 394 | cystathionine beta-lyase; Provisional | 98.75 | |
| PRK08133 | 390 | O-succinylhomoserine sulfhydrylase; Validated | 98.74 | |
| TIGR01329 | 378 | cysta_beta_ly_E cystathionine beta-lyase, eukaryot | 98.74 | |
| cd00615 | 294 | Orn_deC_like Ornithine decarboxylase family. This | 98.74 | |
| PLN03227 | 392 | serine palmitoyltransferase-like protein; Provisio | 98.73 | |
| PRK07810 | 403 | O-succinylhomoserine sulfhydrylase; Provisional | 98.73 | |
| PLN02414 | 993 | glycine dehydrogenase (decarboxylating) | 98.73 | |
| cd06454 | 349 | KBL_like KBL_like; this family belongs to the pyri | 98.72 | |
| PRK07269 | 364 | cystathionine gamma-synthase; Reviewed | 98.71 | |
| PRK08114 | 395 | cystathionine beta-lyase; Provisional | 98.7 | |
| KOG0629|consensus | 510 | 98.69 | ||
| PRK06939 | 397 | 2-amino-3-ketobutyrate coenzyme A ligase; Provisio | 98.68 | |
| PRK07812 | 436 | O-acetylhomoserine aminocarboxypropyltransferase; | 98.67 | |
| PRK06176 | 380 | cystathionine gamma-synthase/cystathionine beta-ly | 98.66 | |
| PRK07671 | 377 | cystathionine beta-lyase; Provisional | 98.66 | |
| TIGR02539 | 370 | SepCysS Sep-tRNA:Cys-tRNA synthase. Aminoacylation | 98.65 | |
| PRK06460 | 376 | hypothetical protein; Provisional | 98.65 | |
| PRK05994 | 427 | O-acetylhomoserine aminocarboxypropyltransferase; | 98.65 | |
| PLN02242 | 418 | methionine gamma-lyase | 98.64 | |
| PRK07179 | 407 | hypothetical protein; Provisional | 98.63 | |
| PLN02509 | 464 | cystathionine beta-lyase | 98.62 | |
| PF00464 | 399 | SHMT: Serine hydroxymethyltransferase; InterPro: I | 98.61 | |
| COG3977 | 417 | Alanine-alpha-ketoisovalerate (or valine-pyruvate) | 98.6 | |
| PRK05367 | 954 | glycine dehydrogenase; Provisional | 98.6 | |
| PRK08248 | 431 | O-acetylhomoserine aminocarboxypropyltransferase; | 98.59 | |
| PRK02948 | 381 | cysteine desulfurase; Provisional | 98.59 | |
| TIGR01326 | 418 | OAH_OAS_sulfhy OAH/OAS sulfhydrylase. This model d | 98.58 | |
| PRK11658 | 379 | UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate amin | 98.57 | |
| PRK08776 | 405 | cystathionine gamma-synthase; Provisional | 98.57 | |
| PRK06084 | 425 | O-acetylhomoserine aminocarboxypropyltransferase; | 98.56 | |
| PRK07582 | 366 | cystathionine gamma-lyase; Validated | 98.56 | |
| PRK06234 | 400 | methionine gamma-lyase; Provisional | 98.56 | |
| PRK12566 | 954 | glycine dehydrogenase; Provisional | 98.53 | |
| TIGR03588 | 380 | PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-amin | 98.52 | |
| PRK08861 | 388 | cystathionine gamma-synthase; Provisional | 98.52 | |
| cd00616 | 352 | AHBA_syn 3-amino-5-hydroxybenzoic acid synthase fa | 98.5 | |
| COG2873 | 426 | MET17 O-acetylhomoserine sulfhydrylase [Amino acid | 98.49 | |
| PRK08064 | 390 | cystathionine beta-lyase; Provisional | 98.47 | |
| PRK08045 | 386 | cystathionine gamma-synthase; Provisional | 98.46 | |
| PLN02483 | 489 | serine palmitoyltransferase | 98.46 | |
| PRK08247 | 366 | cystathionine gamma-synthase; Reviewed | 98.45 | |
| TIGR00461 | 939 | gcvP glycine dehydrogenase (decarboxylating). This | 98.44 | |
| PRK05367 | 954 | glycine dehydrogenase; Provisional | 98.42 | |
| TIGR03576 | 346 | pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 | 98.4 | |
| PRK05939 | 397 | hypothetical protein; Provisional | 98.38 | |
| TIGR00858 | 360 | bioF 8-amino-7-oxononanoate synthase. This model r | 98.37 | |
| COG0112 | 413 | GlyA Glycine/serine hydroxymethyltransferase [Amin | 98.36 | |
| KOG0628|consensus | 511 | 98.35 | ||
| cd00609 | 350 | AAT_like Aspartate aminotransferase family. This f | 98.34 | |
| TIGR02080 | 382 | O_succ_thio_ly O-succinylhomoserine (thiol)-lyase. | 98.32 | |
| PRK06434 | 384 | cystathionine gamma-lyase; Validated | 98.29 | |
| PRK09064 | 407 | 5-aminolevulinate synthase; Validated | 98.27 | |
| TIGR01366 | 361 | serC_3 phosphoserine aminotransferase, putative. T | 98.26 | |
| PLN02414 | 993 | glycine dehydrogenase (decarboxylating) | 98.26 | |
| TIGR01825 | 385 | gly_Cac_T_rel pyridoxal phosphate-dependent acyltr | 98.25 | |
| PRK06702 | 432 | O-acetylhomoserine aminocarboxypropyltransferase; | 98.25 | |
| PRK05958 | 385 | 8-amino-7-oxononanoate synthase; Reviewed | 98.24 | |
| PRK05967 | 395 | cystathionine beta-lyase; Provisional | 98.24 | |
| TIGR01821 | 402 | 5aminolev_synth 5-aminolevulinic acid synthase. Th | 98.21 | |
| PLN02822 | 481 | serine palmitoyltransferase | 98.19 | |
| PRK13392 | 410 | 5-aminolevulinate synthase; Provisional | 98.18 | |
| PF01053 | 386 | Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent | 98.17 | |
| PRK05937 | 370 | 8-amino-7-oxononanoate synthase; Provisional | 98.16 | |
| PRK06225 | 380 | aspartate aminotransferase; Provisional | 98.1 | |
| PRK00451 | 447 | glycine dehydrogenase subunit 1; Validated | 98.1 | |
| TIGR02379 | 376 | ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase | 98.05 | |
| KOG0053|consensus | 409 | 98.04 | ||
| PRK13393 | 406 | 5-aminolevulinate synthase; Provisional | 98.02 | |
| cd00611 | 355 | PSAT_like Phosphoserine aminotransferase (PSAT) fa | 97.98 | |
| PRK11706 | 375 | TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisio | 97.97 | |
| PF01276 | 417 | OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; | 97.9 | |
| TIGR01364 | 349 | serC_1 phosphoserine aminotransferase. This model | 97.9 | |
| PF01041 | 363 | DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransfe | 97.84 | |
| COG0626 | 396 | MetC Cystathionine beta-lyases/cystathionine gamma | 97.8 | |
| PRK05355 | 360 | 3-phosphoserine/phosphohydroxythreonine aminotrans | 97.78 | |
| PRK05764 | 393 | aspartate aminotransferase; Provisional | 97.77 | |
| PRK07777 | 387 | aminotransferase; Validated | 97.76 | |
| PRK12414 | 384 | putative aminotransferase; Provisional | 97.75 | |
| TIGR01140 | 330 | L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxy | 97.74 | |
| PRK07337 | 388 | aminotransferase; Validated | 97.71 | |
| cd00610 | 413 | OAT_like Acetyl ornithine aminotransferase family. | 97.7 | |
| PRK08361 | 391 | aspartate aminotransferase; Provisional | 97.68 | |
| PRK07049 | 427 | methionine gamma-lyase; Validated | 97.68 | |
| PRK08175 | 395 | aminotransferase; Validated | 97.67 | |
| PRK08912 | 387 | hypothetical protein; Provisional | 97.66 | |
| PLN02482 | 474 | glutamate-1-semialdehyde 2,1-aminomutase | 97.66 | |
| PLN02955 | 476 | 8-amino-7-oxononanoate synthase | 97.66 | |
| PF00155 | 363 | Aminotran_1_2: Aminotransferase class I and II 1-a | 97.65 | |
| COG0156 | 388 | BioF 7-keto-8-aminopelargonate synthetase and rela | 97.65 | |
| PRK09276 | 385 | LL-diaminopimelate aminotransferase; Provisional | 97.64 | |
| PRK07550 | 386 | hypothetical protein; Provisional | 97.64 | |
| PRK06108 | 382 | aspartate aminotransferase; Provisional | 97.63 | |
| PRK07309 | 391 | aromatic amino acid aminotransferase; Validated | 97.62 | |
| TIGR03540 | 383 | DapC_direct LL-diaminopimelate aminotransferase. T | 97.62 | |
| TIGR03539 | 357 | DapC_actino succinyldiaminopimelate transaminase. | 97.62 | |
| PRK09082 | 386 | methionine aminotransferase; Validated | 97.61 | |
| COG0399 | 374 | WecE Predicted pyridoxal phosphate-dependent enzym | 97.61 | |
| TIGR03537 | 350 | DapC succinyldiaminopimelate transaminase. Note: t | 97.59 | |
| PRK07568 | 397 | aspartate aminotransferase; Provisional | 97.59 | |
| PRK00854 | 401 | rocD ornithine--oxo-acid transaminase; Reviewed | 97.58 | |
| PRK05942 | 394 | aspartate aminotransferase; Provisional | 97.56 | |
| PRK08960 | 387 | hypothetical protein; Provisional | 97.55 | |
| PRK15029 | 755 | arginine decarboxylase; Provisional | 97.55 | |
| PRK04073 | 396 | rocD ornithine--oxo-acid transaminase; Provisional | 97.54 | |
| PRK05957 | 389 | aspartate aminotransferase; Provisional | 97.52 | |
| PRK07865 | 364 | N-succinyldiaminopimelate aminotransferase; Review | 97.51 | |
| PRK07324 | 373 | transaminase; Validated | 97.5 | |
| PTZ00125 | 400 | ornithine aminotransferase-like protein; Provision | 97.49 | |
| PRK15407 | 438 | lipopolysaccharide biosynthesis protein RfbH; Prov | 97.49 | |
| PRK03244 | 398 | argD acetylornithine aminotransferase; Provisional | 97.49 | |
| COG1103 | 382 | Archaea-specific pyridoxal phosphate-dependent enz | 97.49 | |
| PF00202 | 339 | Aminotran_3: Aminotransferase class-III; InterPro: | 97.44 | |
| PRK09148 | 405 | aminotransferase; Validated | 97.43 | |
| PRK08056 | 356 | threonine-phosphate decarboxylase; Provisional | 97.41 | |
| PRK02936 | 377 | argD acetylornithine aminotransferase; Provisional | 97.39 | |
| PLN00175 | 413 | aminotransferase family protein; Provisional | 97.39 | |
| PRK07683 | 387 | aminotransferase A; Validated | 97.36 | |
| PRK06207 | 405 | aspartate aminotransferase; Provisional | 97.33 | |
| PLN02760 | 504 | 4-aminobutyrate:pyruvate transaminase | 97.33 | |
| PRK07682 | 378 | hypothetical protein; Validated | 97.33 | |
| PRK07366 | 388 | succinyldiaminopimelate transaminase; Validated | 97.33 | |
| PRK03715 | 395 | argD acetylornithine transaminase protein; Provisi | 97.32 | |
| PRK07681 | 399 | aspartate aminotransferase; Provisional | 97.31 | |
| COG1003 | 496 | GcvP Glycine cleavage system protein P (pyridoxal- | 97.3 | |
| PRK08068 | 389 | transaminase; Reviewed | 97.29 | |
| TIGR00707 | 379 | argD acetylornithine and succinylornithine aminotr | 97.29 | |
| PRK12389 | 428 | glutamate-1-semialdehyde aminotransferase; Provisi | 97.29 | |
| PRK05964 | 423 | adenosylmethionine--8-amino-7-oxononanoate transam | 97.27 | |
| PRK08363 | 398 | alanine aminotransferase; Validated | 97.26 | |
| COG0436 | 393 | Aspartate/tyrosine/aromatic aminotransferase [Amin | 97.25 | |
| PRK08636 | 403 | aspartate aminotransferase; Provisional | 97.24 | |
| PLN02624 | 474 | ornithine-delta-aminotransferase | 97.23 | |
| PRK07505 | 402 | hypothetical protein; Provisional | 97.22 | |
| PRK00950 | 361 | histidinol-phosphate aminotransferase; Validated | 97.21 | |
| PRK06290 | 410 | aspartate aminotransferase; Provisional | 97.21 | |
| PF02347 | 429 | GDC-P: Glycine cleavage system P-protein; InterPro | 97.16 | |
| PRK07036 | 466 | hypothetical protein; Provisional | 97.16 | |
| TIGR01885 | 401 | Orn_aminotrans ornithine aminotransferase. This mo | 97.15 | |
| PRK02627 | 396 | acetylornithine aminotransferase; Provisional | 97.13 | |
| PRK09264 | 425 | diaminobutyrate--2-oxoglutarate aminotransferase; | 97.11 | |
| PRK12403 | 460 | putative aminotransferase; Provisional | 97.1 | |
| KOG1359|consensus | 417 | 97.09 | ||
| COG0075 | 383 | Serine-pyruvate aminotransferase/archaeal aspartat | 97.09 | |
| PRK07590 | 409 | L,L-diaminopimelate aminotransferase; Validated | 97.09 | |
| PRK06541 | 460 | hypothetical protein; Provisional | 97.09 | |
| PRK06062 | 451 | hypothetical protein; Provisional | 97.05 | |
| PF05889 | 389 | SLA_LP_auto_ag: Soluble liver antigen/liver pancre | 97.05 | |
| TIGR02407 | 412 | ectoine_ectB diaminobutyrate--2-oxoglutarate amino | 97.05 | |
| PRK06348 | 384 | aspartate aminotransferase; Provisional | 97.04 | |
| TIGR03542 | 402 | DAPAT_plant LL-diaminopimelate aminotransferase. T | 96.99 | |
| TIGR01141 | 346 | hisC histidinol-phosphate aminotransferase. Histid | 96.96 | |
| PRK07480 | 456 | putative aminotransferase; Validated | 96.96 | |
| PRK06836 | 394 | aspartate aminotransferase; Provisional | 96.96 | |
| PRK06107 | 402 | aspartate aminotransferase; Provisional | 96.93 | |
| PRK05093 | 403 | argD bifunctional N-succinyldiaminopimelate-aminot | 96.93 | |
| KOG2467|consensus | 477 | 96.9 | ||
| PRK06425 | 332 | histidinol-phosphate aminotransferase; Validated | 96.88 | |
| PLN02376 | 496 | 1-aminocyclopropane-1-carboxylate synthase | 96.88 | |
| PRK07481 | 449 | hypothetical protein; Provisional | 96.87 | |
| PRK13360 | 442 | omega amino acid--pyruvate transaminase; Provision | 96.87 | |
| PRK00615 | 433 | glutamate-1-semialdehyde aminotransferase; Provisi | 96.84 | |
| PRK01278 | 389 | argD acetylornithine transaminase protein; Provisi | 96.81 | |
| PLN02656 | 409 | tyrosine transaminase | 96.79 | |
| TIGR01264 | 401 | tyr_amTase_E tyrosine aminotransferase, eukaryotic | 96.78 | |
| PRK06358 | 354 | threonine-phosphate decarboxylase; Provisional | 96.78 | |
| PRK08593 | 445 | 4-aminobutyrate aminotransferase; Provisional | 96.77 | |
| TIGR03246 | 397 | arg_catab_astC succinylornithine transaminase fami | 96.77 | |
| COG0160 | 447 | GabT 4-aminobutyrate aminotransferase and related | 96.76 | |
| PRK07482 | 461 | hypothetical protein; Provisional | 96.76 | |
| PRK09440 | 416 | avtA valine--pyruvate transaminase; Provisional | 96.76 | |
| PRK06209 | 431 | glutamate-1-semialdehyde 2,1-aminomutase; Provisio | 96.75 | |
| PRK13578 | 720 | ornithine decarboxylase; Provisional | 96.74 | |
| KOG1383|consensus | 491 | 96.74 | ||
| PRK09792 | 421 | 4-aminobutyrate transaminase; Provisional | 96.73 | |
| PRK08360 | 443 | 4-aminobutyrate aminotransferase; Provisional | 96.73 | |
| PRK04260 | 375 | acetylornithine aminotransferase; Provisional | 96.73 | |
| PRK00062 | 426 | glutamate-1-semialdehyde aminotransferase; Provisi | 96.73 | |
| PRK09221 | 445 | beta alanine--pyruvate transaminase; Provisional | 96.72 | |
| TIGR01265 | 403 | tyr_nico_aTase tyrosine/nicotianamine aminotransfe | 96.72 | |
| PRK09147 | 396 | succinyldiaminopimelate transaminase; Provisional | 96.7 | |
| PRK03321 | 352 | putative aminotransferase; Provisional | 96.7 | |
| TIGR00709 | 442 | dat 2,4-diaminobutyrate 4-transaminases. This fami | 96.68 | |
| PRK04612 | 408 | argD acetylornithine transaminase protein; Provisi | 96.65 | |
| PRK13355 | 517 | bifunctional HTH-domain containing protein/aminotr | 96.64 | |
| PRK05965 | 459 | hypothetical protein; Provisional | 96.64 | |
| TIGR00713 | 423 | hemL glutamate-1-semialdehyde-2,1-aminomutase. Thi | 96.63 | |
| PRK11522 | 459 | putrescine--2-oxoglutarate aminotransferase; Provi | 96.6 | |
| PLN02452 | 365 | phosphoserine transaminase | 96.58 | |
| PRK04013 | 364 | argD acetylornithine/acetyl-lysine aminotransferas | 96.58 | |
| PRK09265 | 404 | aminotransferase AlaT; Validated | 96.57 | |
| TIGR03538 | 393 | DapC_gpp succinyldiaminopimelate transaminase. Thi | 96.56 | |
| PRK06943 | 453 | adenosylmethionine--8-amino-7-oxononanoate transam | 96.55 | |
| COG0001 | 432 | HemL Glutamate-1-semialdehyde aminotransferase [Co | 96.52 | |
| PTZ00376 | 404 | aspartate aminotransferase; Provisional | 96.51 | |
| PTZ00433 | 412 | tyrosine aminotransferase; Provisional | 96.51 | |
| PLN00145 | 430 | tyrosine/nicotianamine aminotransferase; Provision | 96.51 | |
| TIGR00700 | 420 | GABAtrnsam 4-aminobutyrate aminotransferase, proka | 96.49 | |
| TIGR00461 | 939 | gcvP glycine dehydrogenase (decarboxylating). This | 96.46 | |
| PRK05630 | 422 | adenosylmethionine--8-amino-7-oxononanoate transam | 96.45 | |
| PRK06917 | 447 | hypothetical protein; Provisional | 96.41 | |
| PRK05839 | 374 | hypothetical protein; Provisional | 96.41 | |
| PRK08742 | 472 | adenosylmethionine--8-amino-7-oxononanoate transam | 96.4 | |
| PRK06082 | 459 | 4-aminobutyrate aminotransferase; Provisional | 96.4 | |
| PRK07678 | 451 | aminotransferase; Validated | 96.39 | |
| PRK05769 | 441 | 4-aminobutyrate aminotransferase; Provisional | 96.39 | |
| TIGR03372 | 442 | putres_am_tran putrescine aminotransferase. Member | 96.38 | |
| PRK06938 | 464 | diaminobutyrate--2-oxoglutarate aminotransferase; | 96.34 | |
| PRK06918 | 451 | 4-aminobutyrate aminotransferase; Reviewed | 96.32 | |
| PLN00143 | 409 | tyrosine/nicotianamine aminotransferase; Provision | 96.32 | |
| PLN02368 | 407 | alanine transaminase | 96.31 | |
| PLN00144 | 382 | acetylornithine transaminase | 96.3 | |
| PRK12381 | 406 | bifunctional succinylornithine transaminase/acetyl | 96.25 | |
| PRK05664 | 330 | threonine-phosphate decarboxylase; Reviewed | 96.2 | |
| PLN02187 | 462 | rooty/superroot1 | 96.18 | |
| PRK06058 | 443 | 4-aminobutyrate aminotransferase; Provisional | 96.17 | |
| PLN02397 | 423 | aspartate transaminase | 96.17 | |
| PLN02231 | 534 | alanine transaminase | 96.16 | |
| PRK07046 | 453 | aminotransferase; Validated | 96.16 | |
| PRK06777 | 421 | 4-aminobutyrate aminotransferase; Provisional | 96.13 | |
| PRK08117 | 433 | 4-aminobutyrate aminotransferase; Provisional | 96.13 | |
| PLN02974 | 817 | adenosylmethionine-8-amino-7-oxononanoate transami | 96.13 | |
| PLN02450 | 468 | 1-aminocyclopropane-1-carboxylate synthase | 96.12 | |
| PRK08297 | 443 | L-lysine aminotransferase; Provisional | 96.1 | |
| PRK07483 | 443 | hypothetical protein; Provisional | 96.07 | |
| PRK05387 | 353 | histidinol-phosphate aminotransferase; Provisional | 96.01 | |
| TIGR03251 | 431 | LAT_fam L-lysine 6-transaminase. Characterized mem | 95.99 | |
| PRK03158 | 359 | histidinol-phosphate aminotransferase; Provisional | 95.95 | |
| PTZ00377 | 481 | alanine aminotransferase; Provisional | 95.93 | |
| PRK07495 | 425 | 4-aminobutyrate aminotransferase; Provisional | 95.92 | |
| PRK06855 | 433 | aminotransferase; Validated | 95.9 | |
| PRK09105 | 370 | putative aminotransferase; Provisional | 95.89 | |
| PLN02607 | 447 | 1-aminocyclopropane-1-carboxylate synthase | 95.86 | |
| PRK07030 | 466 | adenosylmethionine--8-amino-7-oxononanoate transam | 95.85 | |
| PRK06931 | 459 | diaminobutyrate--2-oxoglutarate aminotransferase; | 95.83 | |
| PRK02731 | 367 | histidinol-phosphate aminotransferase; Validated | 95.83 | |
| PRK08153 | 369 | histidinol-phosphate aminotransferase; Provisional | 95.8 | |
| PRK14807 | 351 | histidinol-phosphate aminotransferase; Provisional | 95.77 | |
| PF06838 | 403 | Met_gamma_lyase: Methionine gamma-lyase ; InterPro | 95.74 | |
| PRK14809 | 357 | histidinol-phosphate aminotransferase; Provisional | 95.69 | |
| PRK06105 | 460 | aminotransferase; Provisional | 95.66 | |
| PRK03317 | 368 | histidinol-phosphate aminotransferase; Provisional | 95.63 | |
| PRK08088 | 425 | 4-aminobutyrate aminotransferase; Validated | 95.58 | |
| PRK06916 | 460 | adenosylmethionine--8-amino-7-oxononanoate transam | 95.54 | |
| PRK07908 | 349 | hypothetical protein; Provisional | 95.49 | |
| KOG1357|consensus | 519 | 95.45 | ||
| COG4992 | 404 | ArgD Ornithine/acetylornithine aminotransferase [A | 95.45 | |
| PRK15481 | 431 | transcriptional regulatory protein PtsJ; Provision | 95.32 | |
| PRK05639 | 457 | 4-aminobutyrate aminotransferase; Provisional | 95.28 | |
| TIGR00508 | 427 | bioA adenosylmethionine-8-amino-7-oxononanoate tra | 95.24 | |
| KOG1360|consensus | 570 | 95.17 | ||
| PRK06148 | 1013 | hypothetical protein; Provisional | 95.11 | |
| PRK04781 | 364 | histidinol-phosphate aminotransferase; Provisional | 95.09 | |
| KOG3843|consensus | 432 | 95.07 | ||
| KOG0257|consensus | 420 | 95.0 | ||
| PRK06959 | 339 | putative threonine-phosphate decarboxylase; Provis | 94.95 | |
| KOG1401|consensus | 433 | 94.81 | ||
| PRK03967 | 337 | histidinol-phosphate aminotransferase; Provisional | 94.79 | |
| COG1168 | 388 | MalY Bifunctional PLP-dependent enzyme with beta-c | 94.75 | |
| PRK09257 | 396 | aromatic amino acid aminotransferase; Provisional | 94.73 | |
| TIGR01365 | 374 | serC_2 phosphoserine aminotransferase, Methanosarc | 94.71 | |
| PRK12462 | 364 | phosphoserine aminotransferase; Provisional | 94.61 | |
| PRK07986 | 428 | adenosylmethionine--8-amino-7-oxononanoate transam | 94.6 | |
| TIGR03801 | 521 | asp_4_decarbox aspartate 4-decarboxylase. This enz | 94.51 | |
| PRK08354 | 311 | putative aminotransferase; Provisional | 94.5 | |
| PRK06149 | 972 | hypothetical protein; Provisional | 94.5 | |
| PRK06173 | 429 | adenosylmethionine--8-amino-7-oxononanoate transam | 94.33 | |
| PRK09275 | 527 | aspartate aminotransferase; Provisional | 94.23 | |
| KOG0256|consensus | 471 | 94.11 | ||
| KOG2040|consensus | 1001 | 93.94 | ||
| PRK04635 | 354 | histidinol-phosphate aminotransferase; Provisional | 93.85 | |
| PRK01688 | 351 | histidinol-phosphate aminotransferase; Provisional | 93.72 | |
| PRK12566 | 954 | glycine dehydrogenase; Provisional | 93.64 | |
| PRK05166 | 371 | histidinol-phosphate aminotransferase; Provisional | 93.39 | |
| PRK14808 | 335 | histidinol-phosphate aminotransferase; Provisional | 92.95 | |
| KOG2862|consensus | 385 | 92.78 | ||
| PRK02610 | 374 | histidinol-phosphate aminotransferase; Provisional | 92.55 | |
| PRK07392 | 360 | threonine-phosphate decarboxylase; Validated | 92.39 | |
| PRK15399 | 713 | lysine decarboxylase LdcC; Provisional | 92.19 | |
| PRK08637 | 388 | hypothetical protein; Provisional | 92.07 | |
| PLN03026 | 380 | histidinol-phosphate aminotransferase; Provisional | 91.96 | |
| PLN02672 | 1082 | methionine S-methyltransferase | 91.74 | |
| PRK04870 | 356 | histidinol-phosphate aminotransferase; Provisional | 91.74 | |
| PRK01533 | 366 | histidinol-phosphate aminotransferase; Validated | 91.36 | |
| COG4100 | 416 | Cystathionine beta-lyase family protein involved i | 90.89 | |
| COG1167 | 459 | ARO8 Transcriptional regulators containing a DNA-b | 90.73 | |
| PF00128 | 316 | Alpha-amylase: Alpha amylase, catalytic domain; In | 90.69 | |
| COG1982 | 557 | LdcC Arginine/lysine/ornithine decarboxylases [Ami | 89.57 | |
| smart00642 | 166 | Aamy Alpha-amylase domain. | 89.54 | |
| COG3844 | 407 | Kynureninase [Amino acid transport and metabolism] | 89.39 | |
| PRK15400 | 714 | lysine decarboxylase CadA; Provisional | 89.11 | |
| KOG3974|consensus | 306 | 87.97 | ||
| TIGR00699 | 464 | GABAtrns_euk 4-aminobutyrate aminotransferase, euk | 86.25 | |
| TIGR00789 | 82 | flhB_rel flhB C-terminus-related protein. This mod | 85.61 | |
| COG0403 | 450 | GcvP Glycine cleavage system protein P (pyridoxal- | 85.54 | |
| COG0161 | 449 | BioA Adenosylmethionine-8-amino-7-oxononanoate ami | 85.5 | |
| KOG1405|consensus | 484 | 85.48 | ||
| cd00287 | 196 | ribokinase_pfkB_like ribokinase/pfkB superfamily: | 84.41 | |
| PRK09441 | 479 | cytoplasmic alpha-amylase; Reviewed | 84.02 | |
| PRK10785 | 598 | maltodextrin glucosidase; Provisional | 81.91 | |
| KOG1404|consensus | 442 | 80.99 | ||
| PLN00196 | 428 | alpha-amylase; Provisional | 80.85 | |
| COG0079 | 356 | HisC Histidinol-phosphate/aromatic aminotransferas | 80.56 |
| >KOG1368|consensus | Back alignment and domain information |
|---|
Probab=99.90 E-value=6.6e-25 Score=153.59 Aligned_cols=71 Identities=48% Similarity=0.911 Sum_probs=68.6
Q ss_pred CCcHHHHHHHHHhcCCcEEEecccchHHhhhCCCCHHHHhcCCcEEEEcCCCCCccceeEEEEeccccccC
Q psy15462 1 MSIDPQLKARCQEHNIPVHMDGARVFNAASYLGLPLAEVCASVDTVMFCLSKGLGAPVGSILAGPEEFIQK 71 (71)
Q Consensus 1 ~~~l~~i~~~a~~~gi~l~~DgAr~~~~~~~~~~~~~~~~~~~D~v~~s~~K~lg~p~gg~l~g~~~~i~~ 71 (71)
++++.++.++|++||+++|+||||+||++.+.|+|+++|++.+|+|++|+||++|+|.|++|||+++||++
T Consensus 174 le~~~~v~~lak~~glkLH~DGARi~NAavasgV~vk~i~~~fDSVsiCLSKglgAPVGSViVG~k~FI~k 244 (384)
T KOG1368|consen 174 LEELDRVKALAKRHGLKLHMDGARIFNAAVASGVPVKKICSAFDSVSICLSKGLGAPVGSVIVGSKDFIDK 244 (384)
T ss_pred HHHHHHHHHHHhccCCeeecchhhhhhHHHHcCCCHHHHHHhhhhhhhhhhccCCCCcccEEEccHHHHHH
Confidence 46889999999999999999999999999999999999999999999999999999999999999999974
|
|
| >COG2008 GLY1 Threonine aldolase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF01212 Beta_elim_lyase: Beta-eliminating lyase; InterPro: IPR001597 This domain is found in many tryptophanases (tryptophan indole-lyase, TNase), tyrosine phenol-lyases (TPL) and threonine aldolases | Back alignment and domain information |
|---|
| >TIGR02617 tnaA_trp_ase tryptophanase, leader peptide-associated | Back alignment and domain information |
|---|
| >PF03841 SelA: L-seryl-tRNA selenium transferase; InterPro: IPR018319 In prokaryotes, the incorporation of selenocysteine as the 21st amino acid, encoded by TGA, requires several elements: SelC is the tRNA itself, SelD acts as a donor of reduced selenium, SelA modifies a serine residue on SelC into selenocysteine, and SelB is a selenocysteine-specific translation elongation factor | Back alignment and domain information |
|---|
| >TIGR02618 tyr_phenol_ly tyrosine phenol-lyase | Back alignment and domain information |
|---|
| >PRK13237 tyrosine phenol-lyase; Provisional | Back alignment and domain information |
|---|
| >COG1921 SelA Selenocysteine synthase [seryl-tRNASer selenium transferase] [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG0520 csdA Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK04311 selenocysteine synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR00474 selA seryl-tRNA(sec) selenium transferase | Back alignment and domain information |
|---|
| >cd00617 Tnase_like Tryptophanase family (Tnase) | Back alignment and domain information |
|---|
| >PLN02590 probable tyrosine decarboxylase | Back alignment and domain information |
|---|
| >PLN02721 threonine aldolase | Back alignment and domain information |
|---|
| >PF00282 Pyridoxal_deC: Pyridoxal-dependent decarboxylase conserved domain; InterPro: IPR002129 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) | Back alignment and domain information |
|---|
| >PLN03032 serine decarboxylase; Provisional | Back alignment and domain information |
|---|
| >TIGR03799 NOD_PanD_pyr putative pyridoxal-dependent aspartate 1-decarboxylase | Back alignment and domain information |
|---|
| >TIGR01437 selA_rel uncharacterized pyridoxal phosphate-dependent enzyme | Back alignment and domain information |
|---|
| >PRK13238 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-dependent; Provisional | Back alignment and domain information |
|---|
| >PRK02769 histidine decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PLN02880 tyrosine decarboxylase | Back alignment and domain information |
|---|
| >cd06502 TA_like Low-specificity threonine aldolase (TA) | Back alignment and domain information |
|---|
| >COG3033 TnaA Tryptophanase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG0076 GadB Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00094 serine hydroxymethyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01788 Glu-decarb-GAD glutamate decarboxylase | Back alignment and domain information |
|---|
| >COG1104 NifS Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02263 serine decarboxylase | Back alignment and domain information |
|---|
| >PLN02651 cysteine desulfurase | Back alignment and domain information |
|---|
| >PLN03226 serine hydroxymethyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd01494 AAT_I Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes | Back alignment and domain information |
|---|
| >cd06453 SufS_like Cysteine desulfurase (SufS)-like | Back alignment and domain information |
|---|
| >PRK09331 Sep-tRNA:Cys-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR03531 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium transferase | Back alignment and domain information |
|---|
| >KOG1549|consensus | Back alignment and domain information |
|---|
| >PRK13034 serine hydroxymethyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK10534 L-threonine aldolase; Provisional | Back alignment and domain information |
|---|
| >PRK13580 serine hydroxymethyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03235 DNA_S_dndA cysteine desulfurase DndA | Back alignment and domain information |
|---|
| >TIGR02326 transamin_PhnW 2-aminoethylphosphonate--pyruvate transaminase | Back alignment and domain information |
|---|
| >TIGR03812 tyr_de_CO2_Arch tyrosine decarboxylase MnfA | Back alignment and domain information |
|---|
| >PRK05968 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF00266 Aminotran_5: Aminotransferase class-V; InterPro: IPR000192 Aminotransferases share certain mechanistic features with other pyridoxal- phosphate dependent enzymes, such as the covalent binding of the pyridoxal- phosphate group to a lysine residue | Back alignment and domain information |
|---|
| >TIGR01814 kynureninase kynureninase | Back alignment and domain information |
|---|
| >cd06452 SepCysS Sep-tRNA:Cys-tRNA synthase | Back alignment and domain information |
|---|
| >PRK06767 methionine gamma-lyase; Provisional | Back alignment and domain information |
|---|
| >TIGR01979 sufS cysteine desulfurases, SufS subfamily | Back alignment and domain information |
|---|
| >TIGR02006 IscS cysteine desulfurase IscS | Back alignment and domain information |
|---|
| >TIGR01328 met_gam_lyase methionine gamma-lyase | Back alignment and domain information |
|---|
| >PRK05613 O-acetylhomoserine aminocarboxypropyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR01977 am_tr_V_EF2568 cysteine desulfurase family protein | Back alignment and domain information |
|---|
| >cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family | Back alignment and domain information |
|---|
| >TIGR03811 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcus type | Back alignment and domain information |
|---|
| >TIGR01976 am_tr_V_VC1184 cysteine desulfurase family protein, VC1184 subfamily | Back alignment and domain information |
|---|
| >TIGR01822 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase | Back alignment and domain information |
|---|
| >PRK13520 L-tyrosine decarboxylase; Provisional | Back alignment and domain information |
|---|
| >cd06450 DOPA_deC_like DOPA decarboxylase family | Back alignment and domain information |
|---|
| >PLN02271 serine hydroxymethyltransferase | Back alignment and domain information |
|---|
| >cd00613 GDC-P Glycine cleavage system P-protein, alpha- and beta-subunits | Back alignment and domain information |
|---|
| >PRK00011 glyA serine hydroxymethyltransferase; Reviewed | Back alignment and domain information |
|---|
| >cd00378 SHMT Serine-glycine hydroxymethyltransferase (SHMT) | Back alignment and domain information |
|---|
| >PRK04366 glycine dehydrogenase subunit 2; Validated | Back alignment and domain information |
|---|
| >TIGR03392 FeS_syn_CsdA cysteine desulfurase, catalytic subunit CsdA | Back alignment and domain information |
|---|
| >TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase | Back alignment and domain information |
|---|
| >PRK08574 cystathionine gamma-synthase; Provisional | Back alignment and domain information |
|---|
| >cd00614 CGS_like CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis | Back alignment and domain information |
|---|
| >PRK07504 O-succinylhomoserine sulfhydrylase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01324 cysta_beta_ly_B cystathionine beta-lyase, bacterial | Back alignment and domain information |
|---|
| >PRK10874 cysteine sulfinate desulfinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03403 nifS_epsilon cysteine desulfurase, NifS family, epsilon proteobacteria type | Back alignment and domain information |
|---|
| >PRK09295 bifunctional cysteine desulfurase/selenocysteine lyase; Validated | Back alignment and domain information |
|---|
| >PLN02855 Bifunctional selenocysteine lyase/cysteine desulfurase | Back alignment and domain information |
|---|
| >TIGR01325 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase | Back alignment and domain information |
|---|
| >PRK03080 phosphoserine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13479 2-aminoethylphosphonate--pyruvate transaminase; Provisional | Back alignment and domain information |
|---|
| >PRK07050 cystathionine beta-lyase; Provisional | Back alignment and domain information |
|---|
| >PLN02724 Molybdenum cofactor sulfurase | Back alignment and domain information |
|---|
| >PLN02409 serine--glyoxylate aminotransaminase | Back alignment and domain information |
|---|
| >TIGR03402 FeS_nifS cysteine desulfurase NifS | Back alignment and domain information |
|---|
| >PRK08134 O-acetylhomoserine aminocarboxypropyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK07503 methionine gamma-lyase; Provisional | Back alignment and domain information |
|---|
| >PRK14012 cysteine desulfurase; Provisional | Back alignment and domain information |
|---|
| >PRK08249 cystathionine gamma-synthase; Provisional | Back alignment and domain information |
|---|
| >PRK07811 cystathionine gamma-synthase; Provisional | Back alignment and domain information |
|---|
| >PRK09028 cystathionine beta-lyase; Provisional | Back alignment and domain information |
|---|
| >PRK08133 O-succinylhomoserine sulfhydrylase; Validated | Back alignment and domain information |
|---|
| >TIGR01329 cysta_beta_ly_E cystathionine beta-lyase, eukaryotic | Back alignment and domain information |
|---|
| >cd00615 Orn_deC_like Ornithine decarboxylase family | Back alignment and domain information |
|---|
| >PLN03227 serine palmitoyltransferase-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK07810 O-succinylhomoserine sulfhydrylase; Provisional | Back alignment and domain information |
|---|
| >PLN02414 glycine dehydrogenase (decarboxylating) | Back alignment and domain information |
|---|
| >cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) | Back alignment and domain information |
|---|
| >PRK07269 cystathionine gamma-synthase; Reviewed | Back alignment and domain information |
|---|
| >PRK08114 cystathionine beta-lyase; Provisional | Back alignment and domain information |
|---|
| >KOG0629|consensus | Back alignment and domain information |
|---|
| >PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional | Back alignment and domain information |
|---|
| >PRK07812 O-acetylhomoserine aminocarboxypropyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK06176 cystathionine gamma-synthase/cystathionine beta-lyase; Validated | Back alignment and domain information |
|---|
| >PRK07671 cystathionine beta-lyase; Provisional | Back alignment and domain information |
|---|
| >TIGR02539 SepCysS Sep-tRNA:Cys-tRNA synthase | Back alignment and domain information |
|---|
| >PRK06460 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05994 O-acetylhomoserine aminocarboxypropyltransferase; Validated | Back alignment and domain information |
|---|
| >PLN02242 methionine gamma-lyase | Back alignment and domain information |
|---|
| >PRK07179 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02509 cystathionine beta-lyase | Back alignment and domain information |
|---|
| >PF00464 SHMT: Serine hydroxymethyltransferase; InterPro: IPR001085 Synonym(s): Serine hydroxymethyltransferase, Serine aldolase, Threonine aldolase Serine hydroxymethyltransferase (SHMT) is a pyridoxal phosphate (PLP) dependent enzyme and belongs to the aspartate aminotransferase superfamily (fold type I) [] | Back alignment and domain information |
|---|
| >COG3977 Alanine-alpha-ketoisovalerate (or valine-pyruvate) aminotransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05367 glycine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08248 O-acetylhomoserine aminocarboxypropyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK02948 cysteine desulfurase; Provisional | Back alignment and domain information |
|---|
| >TIGR01326 OAH_OAS_sulfhy OAH/OAS sulfhydrylase | Back alignment and domain information |
|---|
| >PRK11658 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08776 cystathionine gamma-synthase; Provisional | Back alignment and domain information |
|---|
| >PRK06084 O-acetylhomoserine aminocarboxypropyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK07582 cystathionine gamma-lyase; Validated | Back alignment and domain information |
|---|
| >PRK06234 methionine gamma-lyase; Provisional | Back alignment and domain information |
|---|
| >PRK12566 glycine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03588 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase | Back alignment and domain information |
|---|
| >PRK08861 cystathionine gamma-synthase; Provisional | Back alignment and domain information |
|---|
| >cd00616 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn) | Back alignment and domain information |
|---|
| >COG2873 MET17 O-acetylhomoserine sulfhydrylase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08064 cystathionine beta-lyase; Provisional | Back alignment and domain information |
|---|
| >PRK08045 cystathionine gamma-synthase; Provisional | Back alignment and domain information |
|---|
| >PLN02483 serine palmitoyltransferase | Back alignment and domain information |
|---|
| >PRK08247 cystathionine gamma-synthase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00461 gcvP glycine dehydrogenase (decarboxylating) | Back alignment and domain information |
|---|
| >PRK05367 glycine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03576 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 family | Back alignment and domain information |
|---|
| >PRK05939 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00858 bioF 8-amino-7-oxononanoate synthase | Back alignment and domain information |
|---|
| >COG0112 GlyA Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0628|consensus | Back alignment and domain information |
|---|
| >cd00609 AAT_like Aspartate aminotransferase family | Back alignment and domain information |
|---|
| >TIGR02080 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase | Back alignment and domain information |
|---|
| >PRK06434 cystathionine gamma-lyase; Validated | Back alignment and domain information |
|---|
| >PRK09064 5-aminolevulinate synthase; Validated | Back alignment and domain information |
|---|
| >TIGR01366 serC_3 phosphoserine aminotransferase, putative | Back alignment and domain information |
|---|
| >PLN02414 glycine dehydrogenase (decarboxylating) | Back alignment and domain information |
|---|
| >TIGR01825 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransferase, putative | Back alignment and domain information |
|---|
| >PRK06702 O-acetylhomoserine aminocarboxypropyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK05958 8-amino-7-oxononanoate synthase; Reviewed | Back alignment and domain information |
|---|
| >PRK05967 cystathionine beta-lyase; Provisional | Back alignment and domain information |
|---|
| >TIGR01821 5aminolev_synth 5-aminolevulinic acid synthase | Back alignment and domain information |
|---|
| >PLN02822 serine palmitoyltransferase | Back alignment and domain information |
|---|
| >PRK13392 5-aminolevulinate synthase; Provisional | Back alignment and domain information |
|---|
| >PF01053 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent enzyme; InterPro: IPR000277 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) | Back alignment and domain information |
|---|
| >PRK05937 8-amino-7-oxononanoate synthase; Provisional | Back alignment and domain information |
|---|
| >PRK06225 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00451 glycine dehydrogenase subunit 1; Validated | Back alignment and domain information |
|---|
| >TIGR02379 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase | Back alignment and domain information |
|---|
| >KOG0053|consensus | Back alignment and domain information |
|---|
| >PRK13393 5-aminolevulinate synthase; Provisional | Back alignment and domain information |
|---|
| >cd00611 PSAT_like Phosphoserine aminotransferase (PSAT) family | Back alignment and domain information |
|---|
| >PRK11706 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisional | Back alignment and domain information |
|---|
| >PF01276 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; InterPro: IPR000310 Pyridoxal-dependent decarboxylases are bacterial proteins acting on ornithine, lysine, arginine and related substrates [] | Back alignment and domain information |
|---|
| >TIGR01364 serC_1 phosphoserine aminotransferase | Back alignment and domain information |
|---|
| >PF01041 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransferase family; InterPro: IPR000653 This entry represents a family that are probably all pyridoxal-phosphate-dependent aminotransferase enzymes with a variety of molecular functions | Back alignment and domain information |
|---|
| >COG0626 MetC Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05355 3-phosphoserine/phosphohydroxythreonine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05764 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07777 aminotransferase; Validated | Back alignment and domain information |
|---|
| >PRK12414 putative aminotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01140 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxylase | Back alignment and domain information |
|---|
| >PRK07337 aminotransferase; Validated | Back alignment and domain information |
|---|
| >cd00610 OAT_like Acetyl ornithine aminotransferase family | Back alignment and domain information |
|---|
| >PRK08361 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07049 methionine gamma-lyase; Validated | Back alignment and domain information |
|---|
| >PRK08175 aminotransferase; Validated | Back alignment and domain information |
|---|
| >PRK08912 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02482 glutamate-1-semialdehyde 2,1-aminomutase | Back alignment and domain information |
|---|
| >PLN02955 8-amino-7-oxononanoate synthase | Back alignment and domain information |
|---|
| >PF00155 Aminotran_1_2: Aminotransferase class I and II 1-aminocyclopropane-1-carboxylate synthase signature aspartate aminotransferase signature; InterPro: IPR004839 Aminotransferases share certain mechanistic features with other pyridoxal-phosphate dependent enzymes, such as the covalent binding of the pyridoxal-phosphate group to a lysine residue | Back alignment and domain information |
|---|
| >COG0156 BioF 7-keto-8-aminopelargonate synthetase and related enzymes [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK09276 LL-diaminopimelate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07550 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06108 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07309 aromatic amino acid aminotransferase; Validated | Back alignment and domain information |
|---|
| >TIGR03540 DapC_direct LL-diaminopimelate aminotransferase | Back alignment and domain information |
|---|
| >TIGR03539 DapC_actino succinyldiaminopimelate transaminase | Back alignment and domain information |
|---|
| >PRK09082 methionine aminotransferase; Validated | Back alignment and domain information |
|---|
| >COG0399 WecE Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR03537 DapC succinyldiaminopimelate transaminase | Back alignment and domain information |
|---|
| >PRK07568 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00854 rocD ornithine--oxo-acid transaminase; Reviewed | Back alignment and domain information |
|---|
| >PRK05942 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08960 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK15029 arginine decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PRK04073 rocD ornithine--oxo-acid transaminase; Provisional | Back alignment and domain information |
|---|
| >PRK05957 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07865 N-succinyldiaminopimelate aminotransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK07324 transaminase; Validated | Back alignment and domain information |
|---|
| >PTZ00125 ornithine aminotransferase-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK15407 lipopolysaccharide biosynthesis protein RfbH; Provisional | Back alignment and domain information |
|---|
| >PRK03244 argD acetylornithine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >COG1103 Archaea-specific pyridoxal phosphate-dependent enzymes [General function prediction only] | Back alignment and domain information |
|---|
| >PF00202 Aminotran_3: Aminotransferase class-III; InterPro: IPR005814 Aminotransferases share certain mechanistic features with other pyridoxalphosphate-dependent enzymes, such as the covalent binding of the pyridoxalphosphate group to a lysine residue | Back alignment and domain information |
|---|
| >PRK09148 aminotransferase; Validated | Back alignment and domain information |
|---|
| >PRK08056 threonine-phosphate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PRK02936 argD acetylornithine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PLN00175 aminotransferase family protein; Provisional | Back alignment and domain information |
|---|
| >PRK07683 aminotransferase A; Validated | Back alignment and domain information |
|---|
| >PRK06207 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02760 4-aminobutyrate:pyruvate transaminase | Back alignment and domain information |
|---|
| >PRK07682 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK07366 succinyldiaminopimelate transaminase; Validated | Back alignment and domain information |
|---|
| >PRK03715 argD acetylornithine transaminase protein; Provisional | Back alignment and domain information |
|---|
| >PRK07681 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >COG1003 GcvP Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08068 transaminase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00707 argD acetylornithine and succinylornithine aminotransferases | Back alignment and domain information |
|---|
| >PRK12389 glutamate-1-semialdehyde aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05964 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional | Back alignment and domain information |
|---|
| >PRK08363 alanine aminotransferase; Validated | Back alignment and domain information |
|---|
| >COG0436 Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08636 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02624 ornithine-delta-aminotransferase | Back alignment and domain information |
|---|
| >PRK07505 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK00950 histidinol-phosphate aminotransferase; Validated | Back alignment and domain information |
|---|
| >PRK06290 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PF02347 GDC-P: Glycine cleavage system P-protein; InterPro: IPR020580 This family consists of glycine cleavage system P-proteins (1 | Back alignment and domain information |
|---|
| >PRK07036 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01885 Orn_aminotrans ornithine aminotransferase | Back alignment and domain information |
|---|
| >PRK02627 acetylornithine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09264 diaminobutyrate--2-oxoglutarate aminotransferase; Validated | Back alignment and domain information |
|---|
| >PRK12403 putative aminotransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1359|consensus | Back alignment and domain information |
|---|
| >COG0075 Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07590 L,L-diaminopimelate aminotransferase; Validated | Back alignment and domain information |
|---|
| >PRK06541 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06062 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF05889 SLA_LP_auto_ag: Soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen); InterPro: IPR008829 This family consists of several eukaryotic and archaeal proteins which are related to the Homo sapiens soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen) | Back alignment and domain information |
|---|
| >TIGR02407 ectoine_ectB diaminobutyrate--2-oxoglutarate aminotransferase | Back alignment and domain information |
|---|
| >PRK06348 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03542 DAPAT_plant LL-diaminopimelate aminotransferase | Back alignment and domain information |
|---|
| >TIGR01141 hisC histidinol-phosphate aminotransferase | Back alignment and domain information |
|---|
| >PRK07480 putative aminotransferase; Validated | Back alignment and domain information |
|---|
| >PRK06836 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06107 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05093 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Reviewed | Back alignment and domain information |
|---|
| >KOG2467|consensus | Back alignment and domain information |
|---|
| >PRK06425 histidinol-phosphate aminotransferase; Validated | Back alignment and domain information |
|---|
| >PLN02376 1-aminocyclopropane-1-carboxylate synthase | Back alignment and domain information |
|---|
| >PRK07481 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13360 omega amino acid--pyruvate transaminase; Provisional | Back alignment and domain information |
|---|
| >PRK00615 glutamate-1-semialdehyde aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK01278 argD acetylornithine transaminase protein; Provisional | Back alignment and domain information |
|---|
| >PLN02656 tyrosine transaminase | Back alignment and domain information |
|---|
| >TIGR01264 tyr_amTase_E tyrosine aminotransferase, eukaryotic | Back alignment and domain information |
|---|
| >PRK06358 threonine-phosphate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PRK08593 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03246 arg_catab_astC succinylornithine transaminase family | Back alignment and domain information |
|---|
| >COG0160 GabT 4-aminobutyrate aminotransferase and related aminotransferases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07482 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK09440 avtA valine--pyruvate transaminase; Provisional | Back alignment and domain information |
|---|
| >PRK06209 glutamate-1-semialdehyde 2,1-aminomutase; Provisional | Back alignment and domain information |
|---|
| >PRK13578 ornithine decarboxylase; Provisional | Back alignment and domain information |
|---|
| >KOG1383|consensus | Back alignment and domain information |
|---|
| >PRK09792 4-aminobutyrate transaminase; Provisional | Back alignment and domain information |
|---|
| >PRK08360 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK04260 acetylornithine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00062 glutamate-1-semialdehyde aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09221 beta alanine--pyruvate transaminase; Provisional | Back alignment and domain information |
|---|
| >TIGR01265 tyr_nico_aTase tyrosine/nicotianamine aminotransferases | Back alignment and domain information |
|---|
| >PRK09147 succinyldiaminopimelate transaminase; Provisional | Back alignment and domain information |
|---|
| >PRK03321 putative aminotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00709 dat 2,4-diaminobutyrate 4-transaminases | Back alignment and domain information |
|---|
| >PRK04612 argD acetylornithine transaminase protein; Provisional | Back alignment and domain information |
|---|
| >PRK13355 bifunctional HTH-domain containing protein/aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05965 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00713 hemL glutamate-1-semialdehyde-2,1-aminomutase | Back alignment and domain information |
|---|
| >PRK11522 putrescine--2-oxoglutarate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02452 phosphoserine transaminase | Back alignment and domain information |
|---|
| >PRK04013 argD acetylornithine/acetyl-lysine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09265 aminotransferase AlaT; Validated | Back alignment and domain information |
|---|
| >TIGR03538 DapC_gpp succinyldiaminopimelate transaminase | Back alignment and domain information |
|---|
| >PRK06943 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional | Back alignment and domain information |
|---|
| >COG0001 HemL Glutamate-1-semialdehyde aminotransferase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PTZ00376 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PTZ00433 tyrosine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PLN00145 tyrosine/nicotianamine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00700 GABAtrnsam 4-aminobutyrate aminotransferase, prokaryotic type | Back alignment and domain information |
|---|
| >TIGR00461 gcvP glycine dehydrogenase (decarboxylating) | Back alignment and domain information |
|---|
| >PRK05630 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional | Back alignment and domain information |
|---|
| >PRK06917 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05839 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08742 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional | Back alignment and domain information |
|---|
| >PRK06082 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07678 aminotransferase; Validated | Back alignment and domain information |
|---|
| >PRK05769 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03372 putres_am_tran putrescine aminotransferase | Back alignment and domain information |
|---|
| >PRK06938 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06918 4-aminobutyrate aminotransferase; Reviewed | Back alignment and domain information |
|---|
| >PLN00143 tyrosine/nicotianamine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02368 alanine transaminase | Back alignment and domain information |
|---|
| >PLN00144 acetylornithine transaminase | Back alignment and domain information |
|---|
| >PRK12381 bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional | Back alignment and domain information |
|---|
| >PRK05664 threonine-phosphate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >PLN02187 rooty/superroot1 | Back alignment and domain information |
|---|
| >PRK06058 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02397 aspartate transaminase | Back alignment and domain information |
|---|
| >PLN02231 alanine transaminase | Back alignment and domain information |
|---|
| >PRK07046 aminotransferase; Validated | Back alignment and domain information |
|---|
| >PRK06777 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08117 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02974 adenosylmethionine-8-amino-7-oxononanoate transaminase | Back alignment and domain information |
|---|
| >PLN02450 1-aminocyclopropane-1-carboxylate synthase | Back alignment and domain information |
|---|
| >PRK08297 L-lysine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07483 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05387 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03251 LAT_fam L-lysine 6-transaminase | Back alignment and domain information |
|---|
| >PRK03158 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PTZ00377 alanine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07495 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06855 aminotransferase; Validated | Back alignment and domain information |
|---|
| >PRK09105 putative aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02607 1-aminocyclopropane-1-carboxylate synthase | Back alignment and domain information |
|---|
| >PRK07030 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional | Back alignment and domain information |
|---|
| >PRK06931 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK02731 histidinol-phosphate aminotransferase; Validated | Back alignment and domain information |
|---|
| >PRK08153 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14807 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PF06838 Met_gamma_lyase: Methionine gamma-lyase ; InterPro: IPR009651 This family represents the aluminium resistance protein, which confers resistance to aluminium in bacteria [] | Back alignment and domain information |
|---|
| >PRK14809 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06105 aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK03317 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08088 4-aminobutyrate aminotransferase; Validated | Back alignment and domain information |
|---|
| >PRK06916 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional | Back alignment and domain information |
|---|
| >PRK07908 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1357|consensus | Back alignment and domain information |
|---|
| >COG4992 ArgD Ornithine/acetylornithine aminotransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15481 transcriptional regulatory protein PtsJ; Provisional | Back alignment and domain information |
|---|
| >PRK05639 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00508 bioA adenosylmethionine-8-amino-7-oxononanoate transaminase | Back alignment and domain information |
|---|
| >KOG1360|consensus | Back alignment and domain information |
|---|
| >PRK06148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK04781 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >KOG3843|consensus | Back alignment and domain information |
|---|
| >KOG0257|consensus | Back alignment and domain information |
|---|
| >PRK06959 putative threonine-phosphate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >KOG1401|consensus | Back alignment and domain information |
|---|
| >PRK03967 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >COG1168 MalY Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09257 aromatic amino acid aminotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01365 serC_2 phosphoserine aminotransferase, Methanosarcina type | Back alignment and domain information |
|---|
| >PRK12462 phosphoserine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07986 adenosylmethionine--8-amino-7-oxononanoate transaminase; Validated | Back alignment and domain information |
|---|
| >TIGR03801 asp_4_decarbox aspartate 4-decarboxylase | Back alignment and domain information |
|---|
| >PRK08354 putative aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06149 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06173 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional | Back alignment and domain information |
|---|
| >PRK09275 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >KOG0256|consensus | Back alignment and domain information |
|---|
| >KOG2040|consensus | Back alignment and domain information |
|---|
| >PRK04635 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK01688 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK12566 glycine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05166 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14808 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >KOG2862|consensus | Back alignment and domain information |
|---|
| >PRK02610 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07392 threonine-phosphate decarboxylase; Validated | Back alignment and domain information |
|---|
| >PRK15399 lysine decarboxylase LdcC; Provisional | Back alignment and domain information |
|---|
| >PRK08637 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN03026 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02672 methionine S-methyltransferase | Back alignment and domain information |
|---|
| >PRK04870 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK01533 histidinol-phosphate aminotransferase; Validated | Back alignment and domain information |
|---|
| >COG4100 Cystathionine beta-lyase family protein involved in aluminum resistance [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1167 ARO8 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF00128 Alpha-amylase: Alpha amylase, catalytic domain; InterPro: IPR006047 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >COG1982 LdcC Arginine/lysine/ornithine decarboxylases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >smart00642 Aamy Alpha-amylase domain | Back alignment and domain information |
|---|
| >COG3844 Kynureninase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15400 lysine decarboxylase CadA; Provisional | Back alignment and domain information |
|---|
| >KOG3974|consensus | Back alignment and domain information |
|---|
| >TIGR00699 GABAtrns_euk 4-aminobutyrate aminotransferase, eukaryotic type | Back alignment and domain information |
|---|
| >TIGR00789 flhB_rel flhB C-terminus-related protein | Back alignment and domain information |
|---|
| >COG0403 GcvP Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG0161 BioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >KOG1405|consensus | Back alignment and domain information |
|---|
| >cd00287 ribokinase_pfkB_like ribokinase/pfkB superfamily: Kinases that accept a wide variety of substrates, including carbohydrates and aromatic small molecules, all are phosphorylated at a hydroxyl group | Back alignment and domain information |
|---|
| >PRK09441 cytoplasmic alpha-amylase; Reviewed | Back alignment and domain information |
|---|
| >PRK10785 maltodextrin glucosidase; Provisional | Back alignment and domain information |
|---|
| >KOG1404|consensus | Back alignment and domain information |
|---|
| >PLN00196 alpha-amylase; Provisional | Back alignment and domain information |
|---|
| >COG0079 HisC Histidinol-phosphate/aromatic aminotransferase and cobyric acid decarboxylase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 71 | ||||
| 2fm1_A | 355 | Crystal Structure Of L-allo-threonine Aldolase (tm1 | 1e-14 | ||
| 1jg8_A | 347 | Crystal Structure Of Threonine Aldolase (Low-Specif | 2e-14 | ||
| 1lw4_A | 347 | X-Ray Structure Of L-Threonine Aldolase (Low-Specif | 7e-14 | ||
| 3lws_A | 357 | Crystal Structure Of Putative Aromatic Amino Acid B | 7e-08 |
| >pdb|2FM1|A Chain A, Crystal Structure Of L-allo-threonine Aldolase (tm1744) From Thermotoga Maritima At 2.25 A Resolution Length = 355 | Back alignment and structure |
|
| >pdb|1JG8|A Chain A, Crystal Structure Of Threonine Aldolase (Low-Specificity) Length = 347 | Back alignment and structure |
| >pdb|1LW4|A Chain A, X-Ray Structure Of L-Threonine Aldolase (Low-Specificity) In Complex With L-Allo-Threonine Length = 347 | Back alignment and structure |
| >pdb|3LWS|A Chain A, Crystal Structure Of Putative Aromatic Amino Acid Beta- Eliminating LyaseTHREONINE ALDOLASE. (YP_001813866.1) FROM Exiguobacterium Sp. 255-15 At 2.00 A Resolution Length = 357 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 71 | |||
| 3lws_A | 357 | Aromatic amino acid beta-eliminating lyase/threoni | 1e-34 | |
| 3pj0_A | 359 | LMO0305 protein; structural genomics, joint center | 7e-34 | |
| 1jg8_A | 347 | L-ALLO-threonine aldolase; glycine biosynthesis, p | 2e-28 | |
| 1v72_A | 356 | Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2 | 7e-26 | |
| 1svv_A | 359 | Threonine aldolase; structural genomics, structura | 3e-24 | |
| 2oqx_A | 467 | Tryptophanase; lyase, pyridoxal phosphate, tryptop | 1e-16 | |
| 1ax4_A | 467 | Tryptophanase; tryptophan biosynthesis, tryptophan | 2e-11 | |
| 2ez2_A | 456 | Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend | 1e-09 | |
| 2z67_A | 456 | O-phosphoseryl-tRNA(SEC) selenium transferase; sel | 6e-06 |
| >3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} Length = 357 | Back alignment and structure |
|---|
Score = 118 bits (299), Expect = 1e-34
Identities = 25/66 (37%), Positives = 34/66 (51%)
Query: 6 QLKARCQEHNIPVHMDGARVFNAASYLGLPLAEVCASVDTVMFCLSKGLGAPVGSILAGP 65
+ C+E I +H+DGAR+F Y AE+ D++ KGLG G+ILAGP
Sbjct: 160 TISRYCRERGIRLHLDGARLFEMLPYYEKTAAEIAGLFDSIYISFYKGLGGIAGAILAGP 219
Query: 66 EEFIQK 71
F Q
Sbjct: 220 AAFCQT 225
|
| >3pj0_A LMO0305 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, lyase; HET: LLP MSE; 1.80A {Listeria monocytogenes} Length = 359 | Back alignment and structure |
|---|
| >1jg8_A L-ALLO-threonine aldolase; glycine biosynthesis, pyridoxal-5'- phosphate, calcium binding site, structural genomics, PSI; HET: LLP; 1.80A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1lw4_A* 1lw5_A* 1m6s_A* 2fm1_A* Length = 347 | Back alignment and structure |
|---|
| >1v72_A Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2.05A {Pseudomonas putida} SCOP: c.67.1.1 Length = 356 | Back alignment and structure |
|---|
| >1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic proto SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} SCOP: c.67.1.1 Length = 359 | Back alignment and structure |
|---|
| >2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* Length = 467 | Back alignment and structure |
|---|
| >1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Length = 467 | Back alignment and structure |
|---|
| >2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* Length = 456 | Back alignment and structure |
|---|
| >2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Length = 456 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 71 | |||
| 3pj0_A | 359 | LMO0305 protein; structural genomics, joint center | 99.43 | |
| 3lws_A | 357 | Aromatic amino acid beta-eliminating lyase/threoni | 99.41 | |
| 2oqx_A | 467 | Tryptophanase; lyase, pyridoxal phosphate, tryptop | 99.39 | |
| 1jg8_A | 347 | L-ALLO-threonine aldolase; glycine biosynthesis, p | 99.35 | |
| 1ax4_A | 467 | Tryptophanase; tryptophan biosynthesis, tryptophan | 99.32 | |
| 3k40_A | 475 | Aromatic-L-amino-acid decarboxylase; PLP dependent | 99.27 | |
| 4e1o_A | 481 | HDC, histidine decarboxylase; lyase; HET: PLP PVH; | 99.25 | |
| 1v72_A | 356 | Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2 | 99.22 | |
| 2a7v_A | 490 | Serine hydroxymethyltransferase; structural genomi | 99.21 | |
| 3bc8_A | 450 | O-phosphoseryl-tRNA(SEC) selenium transferase; dis | 99.18 | |
| 3vp6_A | 511 | Glutamate decarboxylase 1; catalytic loop SWAP, ly | 99.17 | |
| 2jis_A | 515 | Cysteine sulfinic acid decarboxylase; pyridoxal ph | 99.15 | |
| 2okj_A | 504 | Glutamate decarboxylase 1; PLP-dependent decarboxy | 99.12 | |
| 2qma_A | 497 | Diaminobutyrate-pyruvate transaminase and L-2,4- d | 99.12 | |
| 1js3_A | 486 | DDC;, DOPA decarboxylase; carbidopa, parkinson'S d | 99.04 | |
| 3hl2_A | 501 | O-phosphoseryl-tRNA(SEC) selenium transferase; sel | 98.98 | |
| 3ke3_A | 379 | Putative serine-pyruvate aminotransferase; structu | 98.98 | |
| 1rv3_A | 483 | Serine hydroxymethyltransferase, cytosolic; one-ca | 98.97 | |
| 2vi8_A | 405 | Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, | 98.97 | |
| 1m32_A | 366 | 2-aminoethylphosphonate-pyruvate aminotransferase; | 98.96 | |
| 3e9k_A | 465 | Kynureninase; kynurenine-L-hydrolase, kynurenine h | 98.96 | |
| 2z67_A | 456 | O-phosphoseryl-tRNA(SEC) selenium transferase; sel | 98.96 | |
| 2fq6_A | 415 | Cystathionine beta-lyase; protein-inhibitor comple | 98.95 | |
| 3h7f_A | 447 | Serine hydroxymethyltransferase 1; cytoplasm, one- | 98.95 | |
| 3hbx_A | 502 | GAD 1, glutamate decarboxylase 1; calmodulin-bindi | 98.94 | |
| 3hvy_A | 427 | Cystathionine beta-lyase family protein, YNBB B.S | 98.93 | |
| 1svv_A | 359 | Threonine aldolase; structural genomics, structura | 98.93 | |
| 3tqx_A | 399 | 2-amino-3-ketobutyrate coenzyme A ligase; energy m | 98.92 | |
| 2dr1_A | 386 | PH1308 protein, 386AA long hypothetical serine ami | 98.91 | |
| 3i16_A | 427 | Aluminum resistance protein; YP_878183.1, carbon-s | 98.91 | |
| 1qgn_A | 445 | Protein (cystathionine gamma-synthase); methionine | 98.9 | |
| 3jzl_A | 409 | Putative cystathionine beta-lyase involved in ALU | 98.89 | |
| 2ez2_A | 456 | Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend | 98.89 | |
| 1qz9_A | 416 | Kynureninase; kynurenine, tryptophan, PLP, vitamin | 98.88 | |
| 2yrr_A | 353 | Aminotransferase, class V; structural genomics, NP | 98.88 | |
| 3n0l_A | 417 | Serine hydroxymethyltransferase; alpha beta class, | 98.87 | |
| 1wyu_B | 474 | Glycine dehydrogenase subunit 2 (P-protein); alpha | 98.86 | |
| 2z9v_A | 392 | Aspartate aminotransferase; pyridoxamine, pyruvate | 98.86 | |
| 2e7j_A | 371 | SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st | 98.85 | |
| 2bkw_A | 385 | Alanine-glyoxylate aminotransferase 1; analine-gly | 98.84 | |
| 3gbx_A | 420 | Serine hydroxymethyltransferase; structural genomi | 98.84 | |
| 3qhx_A | 392 | Cystathionine gamma-synthase METB (CGS); structura | 98.83 | |
| 3cai_A | 406 | Possible aminotransferase; RV3778C; 1.80A {Mycobac | 98.82 | |
| 3ecd_A | 425 | Serine hydroxymethyltransferase 2; ssgcid, decode, | 98.82 | |
| 2w8t_A | 427 | SPT, serine palmitoyltransferase; HET: LLP; 1.25A | 98.82 | |
| 3zrp_A | 384 | Serine-pyruvate aminotransferase (AGXT); HET: PLP; | 98.82 | |
| 2dkj_A | 407 | Serine hydroxymethyltransferase; PLP dependent enz | 98.82 | |
| 2ctz_A | 421 | O-acetyl-L-homoserine sulfhydrylase; crystal, O-ac | 98.81 | |
| 1iug_A | 352 | Putative aspartate aminotransferase; wild type, py | 98.81 | |
| 1t3i_A | 420 | Probable cysteine desulfurase; PLP-binding enzyme, | 98.8 | |
| 3ffr_A | 362 | Phosphoserine aminotransferase SERC; structural ge | 98.8 | |
| 3f9t_A | 397 | TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L | 98.8 | |
| 1gc0_A | 398 | Methionine gamma-lyase; pyridoxal-5'-phosphate; HE | 98.8 | |
| 2cb1_A | 412 | O-acetyl homoserine sulfhydrylase; PLP enzyme, lya | 98.79 | |
| 1fc4_A | 401 | 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino | 98.79 | |
| 3f0h_A | 376 | Aminotransferase; RER070207000802, structural geno | 98.79 | |
| 3isl_A | 416 | Purine catabolism protein PUCG; pyridoxalphosphate | 98.78 | |
| 1bs0_A | 384 | Protein (8-amino-7-oxonanoate synthase); PLP-depen | 98.78 | |
| 3acz_A | 389 | Methionine gamma-lyase; L-methionine; HET: LLP; 1. | 98.78 | |
| 2huf_A | 393 | Alanine glyoxylate aminotransferase; alpha and bet | 98.78 | |
| 2rfv_A | 398 | Methionine gamma-lyase; pyridoxal-5'-phosphate, PL | 98.77 | |
| 3ht4_A | 431 | Aluminum resistance protein; lyase, putative cysta | 98.76 | |
| 3ri6_A | 430 | O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate | 98.76 | |
| 1kmj_A | 406 | Selenocysteine lyase; persulfide perselenide NIFS | 98.76 | |
| 1cs1_A | 386 | CGS, protein (cystathionine gamma-synthase); lyase | 98.75 | |
| 2dgk_A | 452 | GAD-beta, GADB, glutamate decarboxylase beta; gadb | 98.75 | |
| 3nnk_A | 411 | Ureidoglycine-glyoxylate aminotransferase; PLP-dep | 98.74 | |
| 3a2b_A | 398 | Serine palmitoyltransferase; vitamin B6-dependent | 98.74 | |
| 2aeu_A | 374 | Hypothetical protein MJ0158; selenocysteine syntha | 98.74 | |
| 1elu_A | 390 | L-cysteine/L-cystine C-S lyase; FES cluster biosyn | 98.73 | |
| 3kki_A | 409 | CAI-1 autoinducer synthase; quorum sensing, CQSA, | 98.73 | |
| 1pff_A | 331 | Methionine gamma-lyase; homocysteine; 2.50A {Trich | 98.71 | |
| 3kgw_A | 393 | Alanine-glyoxylate aminotransferase; AAH25799.1, p | 98.7 | |
| 1vjo_A | 393 | Alanine--glyoxylate aminotransferase; 17130350, AL | 98.7 | |
| 3ndn_A | 414 | O-succinylhomoserine sulfhydrylase; seattle struct | 98.7 | |
| 3lvm_A | 423 | Cysteine desulfurase; structural genomics, montrea | 98.67 | |
| 3nmy_A | 400 | Xometc, cystathionine gamma-lyase-like protein; Cy | 98.66 | |
| 1n8p_A | 393 | Cystathionine gamma-lyase; three open alpha/beta s | 98.65 | |
| 2x3l_A | 446 | ORN/Lys/Arg decarboxylase family protein; lyase; H | 98.65 | |
| 1ibj_A | 464 | CBL, cystathionine beta-lyase; PLP-dependent enzym | 98.64 | |
| 3mc6_A | 497 | Sphingosine-1-phosphate lyase; carboxy-lyase activ | 98.63 | |
| 1e5e_A | 404 | MGL, methionine gamma-lyase; methionine biosynthes | 98.62 | |
| 1o4s_A | 389 | Aspartate aminotransferase; TM1255, structural gen | 98.61 | |
| 1o69_A | 394 | Aminotransferase; structural genomics, unknown fun | 98.61 | |
| 3frk_A | 373 | QDTB; aminotransferase, sugar-modification, natura | 98.61 | |
| 1v2d_A | 381 | Glutamine aminotransferase; PLP, riken structural | 98.6 | |
| 1wyu_A | 438 | Glycine dehydrogenase (decarboxylating) subunit 1; | 98.6 | |
| 1b9h_A | 388 | AHBA synthase, protein (3-amino-5-hydroxybenzoic a | 98.6 | |
| 3mad_A | 514 | Sphingosine-1-phosphate lyase; carboxy-lyase activ | 98.6 | |
| 3cog_A | 403 | Cystathionine gamma-lyase; CTH, PLP, propargylglyc | 98.58 | |
| 2c81_A | 418 | Glutamine-2-deoxy-scyllo-inosose aminotransferase; | 98.58 | |
| 3uwc_A | 374 | Nucleotide-sugar aminotransferase; lipopolysacchar | 98.57 | |
| 1eg5_A | 384 | Aminotransferase; PLP-dependent enzymes, iron-sulf | 98.57 | |
| 3nyt_A | 367 | Aminotransferase WBPE; PLP binding, nucleotide-sug | 98.56 | |
| 2po3_A | 424 | 4-dehydrase; external aldimine, PLP, aminotransfer | 98.54 | |
| 1mdo_A | 393 | ARNB aminotransferase; type 1 aminotransferase fol | 98.53 | |
| 4hvk_A | 382 | Probable cysteine desulfurase 2; transferase and I | 98.53 | |
| 1gd9_A | 389 | Aspartate aminotransferase; pyridoxal enzyme, temp | 98.51 | |
| 2ch1_A | 396 | 3-hydroxykynurenine transaminase; PLP-enzyme, kynu | 98.51 | |
| 3ou5_A | 490 | Serine hydroxymethyltransferase, mitochondrial; st | 98.5 | |
| 2eh6_A | 375 | Acoat, acetylornithine aminotransferase; ARGD, str | 98.48 | |
| 3a9z_A | 432 | Selenocysteine lyase; PLP, cytoplasm, pyridoxal ph | 98.48 | |
| 3vax_A | 400 | Putative uncharacterized protein DNDA; desulfurase | 98.47 | |
| 2oga_A | 399 | Transaminase; PLP-dependent enzyme, desosamine, de | 98.45 | |
| 2gb3_A | 409 | Aspartate aminotransferase; TM1698, structural gen | 98.44 | |
| 1xi9_A | 406 | Putative transaminase; alanine aminotransferase, s | 98.44 | |
| 1iay_A | 428 | ACC synthase 2, 1-aminocyclopropane-1-carboxylate | 98.44 | |
| 2vyc_A | 755 | Biodegradative arginine decarboxylase; pyridoxal p | 98.43 | |
| 4eb5_A | 382 | Probable cysteine desulfurase 2; scaffold, transfe | 98.41 | |
| 2fnu_A | 375 | Aminotransferase; protein-product complex, structu | 98.41 | |
| 1j32_A | 388 | Aspartate aminotransferase; HET: PLP; 2.10A {Phorm | 98.41 | |
| 2bwn_A | 401 | 5-aminolevulinate synthase; tetrapyrrole biosynthe | 98.41 | |
| 1u08_A | 386 | Hypothetical aminotransferase YBDL; alpha beta pro | 98.4 | |
| 3dr4_A | 391 | Putative perosamine synthetase; deoxysugar, pyrido | 98.4 | |
| 3ruy_A | 392 | Ornithine aminotransferase; structural genomics, c | 98.38 | |
| 1lc5_A | 364 | COBD, L-threonine-O-3-phosphate decarboxylase; PLP | 98.37 | |
| 2o0r_A | 411 | RV0858C (N-succinyldiaminopimelate aminotransfera; | 98.34 | |
| 3ezs_A | 376 | Aminotransferase ASPB; NP_207418.1, structural gen | 98.34 | |
| 4adb_A | 406 | Succinylornithine transaminase; transferase, PLP e | 98.34 | |
| 3ju7_A | 377 | Putative PLP-dependent aminotransferase; NP_978343 | 98.32 | |
| 2x5d_A | 412 | Probable aminotransferase; HET: LLP PLP; 2.25A {Ps | 98.32 | |
| 1vef_A | 395 | Acetylornithine/acetyl-lysine aminotransferase; PL | 98.31 | |
| 3nra_A | 407 | Aspartate aminotransferase; structural genomics, j | 98.3 | |
| 2z61_A | 370 | Probable aspartate aminotransferase 2; amino acid | 98.29 | |
| 3dzz_A | 391 | Putative pyridoxal 5'-phosphate-dependent C-S LYA; | 98.27 | |
| 1yiz_A | 429 | Kynurenine aminotransferase; glutamine transaminas | 98.26 | |
| 1c4k_A | 730 | Protein (ornithine decarboxylase); lyase; HET: PLP | 98.26 | |
| 2o1b_A | 404 | Aminotransferase, class I; aminotrasferase; HET: P | 98.25 | |
| 3ftb_A | 361 | Histidinol-phosphate aminotransferase; structural | 98.24 | |
| 1vp4_A | 425 | Aminotransferase, putative; structural genomics, j | 98.23 | |
| 3g0t_A | 437 | Putative aminotransferase; NP_905498.1, putative a | 98.22 | |
| 2zc0_A | 407 | Alanine glyoxylate transaminase; alanine:glyoxylat | 98.2 | |
| 3qm2_A | 386 | Phosphoserine aminotransferase; structural genomic | 98.2 | |
| 2c0r_A | 362 | PSAT, phosphoserine aminotransferase; pyridoxal-5' | 98.2 | |
| 3bb8_A | 437 | CDP-4-keto-6-deoxy-D-glucose-3-dehydrase; aspartat | 98.19 | |
| 3h14_A | 391 | Aminotransferase, classes I and II; YP_167802.1, S | 98.18 | |
| 2dou_A | 376 | Probable N-succinyldiaminopimelate aminotransfera; | 98.17 | |
| 3op7_A | 375 | Aminotransferase class I and II; PLP-dependent tra | 98.17 | |
| 1sff_A | 426 | 4-aminobutyrate aminotransferase; enzyme complexes | 98.16 | |
| 1b5p_A | 385 | Protein (aspartate aminotransferase); pyridoxal en | 98.15 | |
| 3b8x_A | 390 | WBDK, pyridoxamine 5-phosphate-dependent dehydrase | 98.14 | |
| 3b46_A | 447 | Aminotransferase BNA3; kynurenine aminotransferase | 98.12 | |
| 4e77_A | 429 | Glutamate-1-semialdehyde 2,1-aminomutase; structur | 98.1 | |
| 3qgu_A | 449 | LL-diaminopimelate aminotransferase; L-lysine, pyr | 98.1 | |
| 3e77_A | 377 | Phosphoserine aminotransferase; SERC, PLP, structu | 98.09 | |
| 2zyj_A | 397 | Alpha-aminodipate aminotransferase; alpha-aminoadi | 98.09 | |
| 3fdb_A | 377 | Beta C-S lyase, putative PLP-dependent beta-cystat | 98.09 | |
| 2oat_A | 439 | Ornithine aminotransferase; 5-fluoromethylornithin | 98.08 | |
| 3jtx_A | 396 | Aminotransferase; NP_283882.1, structural genomics | 98.08 | |
| 1z7d_A | 433 | Ornithine aminotransferase; structural genomics co | 98.07 | |
| 4dq6_A | 391 | Putative pyridoxal phosphate-dependent transferas; | 98.05 | |
| 3k28_A | 429 | Glutamate-1-semialdehyde 2,1-aminomutase 2; biosyn | 98.02 | |
| 2ord_A | 397 | Acoat, acetylornithine aminotransferase; TM1785, a | 98.02 | |
| 3asa_A | 400 | LL-diaminopimelate aminotransferase; PLP dependent | 98.01 | |
| 3l44_A | 434 | Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha | 98.01 | |
| 2epj_A | 434 | Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy | 98.01 | |
| 2cjg_A | 449 | L-lysine-epsilon aminotransferase; internal aldimi | 98.0 | |
| 3if2_A | 444 | Aminotransferase; YP_265399.1, structura genomics, | 97.99 | |
| 3kax_A | 383 | Aminotransferase, classes I and II; PLP, C-S lyase | 97.99 | |
| 3ei9_A | 432 | LL-diaminopimelate aminotransferase; lysine biosyn | 97.99 | |
| 2pb2_A | 420 | Acetylornithine/succinyldiaminopimelate aminotran; | 97.99 | |
| 1d2f_A | 390 | MALY protein; aminotransferase fold, large PLP-bin | 97.99 | |
| 1s0a_A | 429 | Adenosylmethionine-8-amino-7-oxononanoate aminotra | 97.99 | |
| 3piu_A | 435 | 1-aminocyclopropane-1-carboxylate synthase; fruit | 97.98 | |
| 1c7n_A | 399 | Cystalysin; transferase, aminotransferase, pyridox | 97.97 | |
| 3aow_A | 448 | Putative uncharacterized protein PH0207; protein-P | 97.97 | |
| 1ajs_A | 412 | Aspartate aminotransferase; PIG, in the presence o | 97.97 | |
| 3fq8_A | 427 | Glutamate-1-semialdehyde 2,1-aminomutase; drug res | 97.96 | |
| 3e2y_A | 410 | Kynurenine-oxoglutarate transaminase 3; alpha beta | 97.93 | |
| 2r2n_A | 425 | Kynurenine/alpha-aminoadipate aminotransferase mit | 97.92 | |
| 3m5u_A | 361 | Phosphoserine aminotransferase; alpha-beta half sa | 97.91 | |
| 2fyf_A | 398 | PSAT, phosphoserine aminotransferase; PLP-dependen | 97.91 | |
| 3tfu_A | 457 | Adenosylmethionine-8-amino-7-oxononanoate aminotr; | 97.9 | |
| 3ly1_A | 354 | Putative histidinol-phosphate aminotransferase; st | 97.9 | |
| 2cy8_A | 453 | D-phgat, D-phenylglycine aminotransferase; structu | 97.89 | |
| 3g7q_A | 417 | Valine-pyruvate aminotransferase; NP_462565.1, str | 97.89 | |
| 3fvs_A | 422 | Kynurenine--oxoglutarate transaminase 1; alpha bet | 97.87 | |
| 1w23_A | 360 | Phosphoserine aminotransferase; pyridoxal-5'-phosp | 97.85 | |
| 3l8a_A | 421 | METC, putative aminotransferase, probable beta-cys | 97.83 | |
| 3i4j_A | 430 | Aminotransferase, class III; structural GENOMICS,N | 97.83 | |
| 3a8u_X | 449 | Omega-amino acid--pyruvate aminotransferase; large | 97.82 | |
| 3cq5_A | 369 | Histidinol-phosphate aminotransferase; PLP, PMP, a | 97.82 | |
| 2eo5_A | 419 | 419AA long hypothetical aminotransferase; PLP enzy | 97.81 | |
| 1bw0_A | 416 | TAT, protein (tyrosine aminotransferase); tyrosine | 97.8 | |
| 1zod_A | 433 | DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, | 97.8 | |
| 3dyd_A | 427 | Tyrosine aminotransferase; PLP, SGC, structural ge | 97.79 | |
| 3hdo_A | 360 | Histidinol-phosphate aminotransferase; PSI-II, his | 97.79 | |
| 3ele_A | 398 | Amino transferase; RER070207001803, structural gen | 97.78 | |
| 1fg7_A | 356 | Histidinol phosphate aminotransferase; HISC, histi | 97.78 | |
| 3f6t_A | 533 | Aspartate aminotransferase; YP_194538.1, STRU geno | 97.78 | |
| 2ay1_A | 394 | Aroat, aromatic amino acid aminotransferase; HET: | 97.77 | |
| 3b1d_A | 392 | Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococ | 96.96 | |
| 2q7w_A | 396 | Aspartate aminotransferase; mechanism-based inhibi | 97.75 | |
| 4eu1_A | 409 | Mitochondrial aspartate aminotransferase; ssgcid, | 97.74 | |
| 2zy4_A | 546 | L-aspartate beta-decarboxylase; pyridoxal 5'-phosp | 97.72 | |
| 2x5f_A | 430 | Aspartate_tyrosine_phenylalanine pyridoxal-5' phos | 97.71 | |
| 3euc_A | 367 | Histidinol-phosphate aminotransferase 2; YP_297314 | 97.71 | |
| 3rq1_A | 418 | Aminotransferase class I and II; structural genomi | 97.69 | |
| 3dod_A | 448 | Adenosylmethionine-8-amino-7-oxononanoate aminotr; | 97.69 | |
| 3n5m_A | 452 | Adenosylmethionine-8-amino-7-oxononanoate aminotr; | 97.68 | |
| 3get_A | 365 | Histidinol-phosphate aminotransferase; NP_281508.1 | 97.68 | |
| 4ffc_A | 453 | 4-aminobutyrate aminotransferase (GABT); structura | 97.67 | |
| 4a6r_A | 459 | Omega transaminase; transferase, PLP-binding enzym | 97.66 | |
| 1yaa_A | 412 | Aspartate aminotransferase; HET: PLP; 2.05A {Sacch | 97.65 | |
| 3dxv_A | 439 | Alpha-amino-epsilon-caprolactam racemase; fold-TYP | 97.64 | |
| 3oks_A | 451 | 4-aminobutyrate transaminase; ssgcid, transferase, | 97.64 | |
| 3gju_A | 460 | Putative aminotransferase; pyridoxal phosphate, PL | 97.63 | |
| 3i5t_A | 476 | Aminotransferase; pyridoxal 5'-phosphate, PSI-2, N | 97.63 | |
| 3tcm_A | 500 | Alanine aminotransferase 2; pyridoxal phosphate (P | 97.62 | |
| 1ohv_A | 472 | 4-aminobutyrate aminotransferase; PLP-dependent en | 97.6 | |
| 3ffh_A | 363 | Histidinol-phosphate aminotransferase; APC88260, l | 97.58 | |
| 3hmu_A | 472 | Aminotransferase, class III; structural genomics, | 97.58 | |
| 3nx3_A | 395 | Acoat, acetylornithine aminotransferase; csgid, st | 97.58 | |
| 3t18_A | 413 | Aminotransferase class I and II; PSI-biology, MCSG | 97.57 | |
| 3ez1_A | 423 | Aminotransferase MOCR family; YP_604413.1, struct | 97.57 | |
| 3ppl_A | 427 | Aspartate aminotransferase; dimer, PLP-dependent t | 97.57 | |
| 3fsl_A | 397 | Aromatic-amino-acid aminotransferase; tyrosine ami | 97.55 | |
| 4f4e_A | 420 | Aromatic-amino-acid aminotransferase; ssgcid, stru | 97.55 | |
| 4ao9_A | 454 | Beta-phenylalanine aminotransferase; HET: PLP; 1.5 | 97.53 | |
| 3d6k_A | 422 | Putative aminotransferase; APC82464, corynebacteri | 97.49 | |
| 2e7u_A | 424 | Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy | 97.46 | |
| 7aat_A | 401 | Aspartate aminotransferase; transferase(aminotrans | 97.39 | |
| 3meb_A | 448 | Aspartate aminotransferase; pyridoxal PHOS transfe | 97.33 | |
| 3ihj_A | 498 | Alanine aminotransferase 2; helix, structural geno | 97.26 | |
| 3p1t_A | 337 | Putative histidinol-phosphate aminotransferase; PL | 97.2 | |
| 2yky_A | 465 | Beta-transaminase; transferase; HET: PLP SFE; 1.69 | 96.2 | |
| 4atq_A | 456 | 4-aminobutyrate transaminase; transferase; HET: PL | 97.12 | |
| 3n75_A | 715 | LDC, lysine decarboxylase, inducible; pyridoxal-5' | 97.1 | |
| 4e3q_A | 473 | Pyruvate transaminase; aminotransferase, transfera | 97.07 | |
| 1uu1_A | 335 | Histidinol-phosphate aminotransferase; histidine b | 96.96 | |
| 3fkd_A | 350 | L-threonine-O-3-phosphate decarboxylase; structura | 96.63 | |
| 4a0g_A | 831 | Adenosylmethionine-8-amino-7-oxononanoate aminotra | 95.88 | |
| 3k7y_A | 405 | Aspartate aminotransferase; aminotrans pyridoxal p | 95.84 | |
| 4h51_A | 420 | Aspartate aminotransferase; ssgcid, structural gen | 94.46 | |
| 3bwn_A | 391 | AT1G70560, L-tryptophan aminotransferase; auxin sy | 93.22 | |
| 4gqr_A | 496 | Pancreatic alpha-amylase; glycosyl hydrolase, diab | 89.33 | |
| 3bzy_B | 83 | ESCU; auto cleavage protein, flagella, intein, T3S | 88.81 | |
| 1g94_A | 448 | Alpha-amylase; beta-alpha-8-barrel, 3 domain struc | 86.27 | |
| 3t7y_A | 97 | YOP proteins translocation protein U; structural g | 86.02 | |
| 1ud2_A | 480 | Amylase, alpha-amylase; calcium-free, alkaline, hy | 85.88 | |
| 3bh4_A | 483 | Alpha-amylase; calcium, carbohydrate metabolism, g | 85.86 | |
| 2vt1_B | 93 | Surface presentation of antigens protein SPAS; spe | 85.62 | |
| 4aie_A | 549 | Glucan 1,6-alpha-glucosidase; hydrolase, glycoside | 85.5 | |
| 1wpc_A | 485 | Glucan 1,4-alpha-maltohexaosidase; maltohexaose-pr | 85.47 | |
| 1lwj_A | 441 | 4-alpha-glucanotransferase; alpha-amylase family, | 85.45 | |
| 1u83_A | 276 | Phosphosulfolactate synthase; structural genomics, | 85.35 | |
| 1hvx_A | 515 | Alpha-amylase; hydrolase, glycosyltransferase, the | 85.3 | |
| 2guy_A | 478 | Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; | 85.28 | |
| 3c01_E | 98 | Surface presentation of antigens protein SPAS; aut | 84.99 | |
| 1mxg_A | 435 | Alpha amylase; hyperthermostable, family 13 glycos | 84.96 | |
| 1wza_A | 488 | Alpha-amylase A; hydrolase, halophilic, thermophil | 84.92 | |
| 2wc7_A | 488 | Alpha amylase, catalytic region; CD/PUL-hydrolyzin | 84.53 | |
| 1ht6_A | 405 | AMY1, alpha-amylase isozyme 1; barley, beta-alpha- | 84.45 | |
| 2z1k_A | 475 | (NEO)pullulanase; hydrolase, structural genomics, | 84.41 | |
| 1jae_A | 471 | Alpha-amylase; glycosidase, carbohydrate metabolis | 84.33 | |
| 1ua7_A | 422 | Alpha-amylase; beta-alpha-barrels, acarbose, greek | 84.19 | |
| 1gcy_A | 527 | Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b | 84.03 | |
| 2aaa_A | 484 | Alpha-amylase; glycosidase; 2.10A {Aspergillus nig | 84.02 | |
| 2dh2_A | 424 | 4F2 cell-surface antigen heavy chain; TIM-barrel, | 83.76 | |
| 3dhu_A | 449 | Alpha-amylase; structural genomics, hydrolase, gly | 83.34 | |
| 1cyg_A | 680 | Cyclodextrin glucanotransferase; glycosyltransfera | 82.53 | |
| 1d3c_A | 686 | Cyclodextrin glycosyltransferase; alpha-amylase, p | 82.24 | |
| 1qho_A | 686 | Alpha-amylase; glycoside hydrolase, starch degrada | 81.96 | |
| 3bmv_A | 683 | Cyclomaltodextrin glucanotransferase; glycosidase, | 81.94 | |
| 1m53_A | 570 | Isomaltulose synthase; klebsiella SP. LX3, sucrose | 81.75 | |
| 1qwg_A | 251 | PSL synthase;, (2R)-phospho-3-sulfolactate synthas | 81.63 | |
| 1zja_A | 557 | Trehalulose synthase; sucrose isomerase, alpha-amy | 81.61 | |
| 1uok_A | 558 | Oligo-1,6-glucosidase; sugar degradation, hydrolas | 81.15 | |
| 1j0h_A | 588 | Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 | 81.08 | |
| 4aef_A | 645 | Neopullulanase (alpha-amylase II); hydrolase, ther | 80.9 | |
| 1wzl_A | 585 | Alpha-amylase II; pullulan, GH-13, alpha-amylase f | 80.43 | |
| 2zic_A | 543 | Dextran glucosidase; TIM barrel, (beta/alpha)8-bar | 80.34 | |
| 3bc9_A | 599 | AMYB, alpha amylase, catalytic region; acarbose, t | 80.16 | |
| 2ze0_A | 555 | Alpha-glucosidase; TIM barrel, glucoside hydrolase | 80.04 | |
| 3edf_A | 601 | FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin c | 80.02 | |
| 3b1s_B | 87 | Flagellar biosynthetic protein FLHB; type III secr | 80.81 |
| >3pj0_A LMO0305 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, lyase; HET: LLP MSE; 1.80A {Listeria monocytogenes} | Back alignment and structure |
|---|
Probab=99.43 E-value=1.2e-13 Score=92.37 Aligned_cols=69 Identities=33% Similarity=0.687 Sum_probs=60.3
Q ss_pred CcHHHHHHHHHhcCCcEEEecccchHHhhhCCCCHHHHhcCCcEEEEcCCCCCccceeEEEEecccccc
Q psy15462 2 SIDPQLKARCQEHNIPVHMDGARVFNAASYLGLPLAEVCASVDTVMFCLSKGLGAPVGSILAGPEEFIQ 70 (71)
Q Consensus 2 ~~l~~i~~~a~~~gi~l~~DgAr~~~~~~~~~~~~~~~~~~~D~v~~s~~K~lg~p~gg~l~g~~~~i~ 70 (71)
+++++|.++|++||+++|+|+++.+......+.++.++..++|++++|+||++++|.|+++++++++++
T Consensus 158 ~~l~~l~~~~~~~~~~li~D~a~~~~~~~~~~~~~~~~~~~~d~~~~s~sK~~~~~~gg~~~~~~~l~~ 226 (359)
T 3pj0_A 158 EELEKISEYCHEQGISLHLDGARLWEITPFYQKSAEEICALFDSVYVSFYKGIGGIAGAILAGNDDFVQ 226 (359)
T ss_dssp HHHHHHHHHHHHHTCEEEEEETTCGGGHHHHTCCHHHHHTTCSEEEEESSSTTCCSSCEEEEECHHHHH
T ss_pred HHHHHHHHHHHHcCCEEEEECcchhcchhhhCCCHHHhhccCCEEEEeccccCCCcceEEEECCHHHHH
Confidence 457888999999999999999988766555677888887889999999999999999999999998875
|
| >3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} | Back alignment and structure |
|---|
| >2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* | Back alignment and structure |
|---|
| >1jg8_A L-ALLO-threonine aldolase; glycine biosynthesis, pyridoxal-5'- phosphate, calcium binding site, structural genomics, PSI; HET: LLP; 1.80A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1lw4_A* 1lw5_A* 1m6s_A* 2fm1_A* | Back alignment and structure |
|---|
| >1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 | Back alignment and structure |
|---|
| >3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} SCOP: c.67.1.6 | Back alignment and structure |
|---|
| >4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1v72_A Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2.05A {Pseudomonas putida} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >2a7v_A Serine hydroxymethyltransferase; structural genomics, structural genomics consortium, SGC; 2.04A {Homo sapiens} PDB: 3ou5_A | Back alignment and structure |
|---|
| >3bc8_A O-phosphoseryl-tRNA(SEC) selenium transferase; disorder-order transition, phosphate-loop, pyridoxal phospha selenocysteine synthase (SECS, sepsecs); HET: LLP; 1.65A {Mus musculus} SCOP: c.67.1.9 PDB: 3bca_A* 3bcb_A* | Back alignment and structure |
|---|
| >3vp6_A Glutamate decarboxylase 1; catalytic loop SWAP, lyase; HET: LLP HLD; 2.10A {Homo sapiens} PDB: 2okj_A* 2okk_A* | Back alignment and structure |
|---|
| >2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} | Back alignment and structure |
|---|
| >2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* | Back alignment and structure |
|---|
| >2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* | Back alignment and structure |
|---|
| >3hl2_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine, sepsecs, protein-RNA complex, alternative splicing, cytoplasm, protein biosynthesis, pyridoxal phosphate, selenium; HET: PLR SEP; 2.81A {Homo sapiens} | Back alignment and structure |
|---|
| >3ke3_A Putative serine-pyruvate aminotransferase; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP; 2.20A {Psychrobacter arcticus 273-4} | Back alignment and structure |
|---|
| >1rv3_A Serine hydroxymethyltransferase, cytosolic; one-carbon metabolism; HET: GLY PLP; 2.40A {Oryctolagus cuniculus} SCOP: c.67.1.4 PDB: 1rv4_A* 1rvu_A* 1rvy_A* 1ls3_A* 1cj0_A* 1bj4_A* 1eji_A* | Back alignment and structure |
|---|
| >2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 2w7f_A* 2w7d_A* 2w7e_A* 2w7g_A* 2w7h_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* ... | Back alignment and structure |
|---|
| >1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* | Back alignment and structure |
|---|
| >2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 | Back alignment and structure |
|---|
| >2fq6_A Cystathionine beta-lyase; protein-inhibitor complex, PLP cofactor covalently bound to inhibitor; HET: P3F; 1.78A {Escherichia coli} SCOP: c.67.1.3 PDB: 2gqn_A* 1cl1_A* 1cl2_A* | Back alignment and structure |
|---|
| >3h7f_A Serine hydroxymethyltransferase 1; cytoplasm, one-carbon metabolism, pyridoxal phosphate, structural genomics; HET: LLP; 1.50A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3hvy_A Cystathionine beta-lyase family protein, YNBB B.S ortholog; NP_348457.1, putative cystathionine beta-lyase involved in A resistance; HET: LLP MSE; 2.00A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic proto SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3i16_A Aluminum resistance protein; YP_878183.1, carbon-sulfur lyase involved in aluminum resist structural genomics; HET: MSE TLA PLP; 2.00A {Clostridium novyi} PDB: 3gwp_A* | Back alignment and structure |
|---|
| >1qgn_A Protein (cystathionine gamma-synthase); methionine biosynthesis, pyridoxal 5'-phosphate, gamma-famil; HET: PLP; 2.90A {Nicotiana tabacum} SCOP: c.67.1.3 PDB: 1i41_A* 1i48_A* 1i43_A* | Back alignment and structure |
|---|
| >3jzl_A Putative cystathionine beta-lyase involved in ALU resistance; putative cystathionine beta-lyase involved in aluminum resis structural genomics; HET: LLP; 1.91A {Listeria monocytogenes str} PDB: 3fd0_A* | Back alignment and structure |
|---|
| >2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* | Back alignment and structure |
|---|
| >1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* | Back alignment and structure |
|---|
| >3n0l_A Serine hydroxymethyltransferase; alpha beta class, 3-layer(ABA) sandwich, CSGI transferase, structural genomics; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.67.1.0 | Back alignment and structure |
|---|
| >1wyu_B Glycine dehydrogenase subunit 2 (P-protein); alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_B* 1wyv_B* | Back alignment and structure |
|---|
| >2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* | Back alignment and structure |
|---|
| >2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* | Back alignment and structure |
|---|
| >2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >3gbx_A Serine hydroxymethyltransferase; structural genomics, IDP01011, serine hydroxymethyltransfera salmonella typhimurium.; HET: MSE; 1.80A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1dfo_A* 3g8m_A* 1eqb_A* | Back alignment and structure |
|---|
| >3qhx_A Cystathionine gamma-synthase METB (CGS); structural genomics, seattle structural genomics center for infectious disease, ssgcid, CGS_LIKE; HET: LLP EPE; 1.65A {Mycobacterium ulcerans} SCOP: c.67.1.0 PDB: 3qi6_A* | Back alignment and structure |
|---|
| >3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3ecd_A Serine hydroxymethyltransferase 2; ssgcid, decode, bupsa00008A, one-carbon metabolism, pyridoxa phosphate, structural genomics; 1.60A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >2w8t_A SPT, serine palmitoyltransferase; HET: LLP; 1.25A {Sphingomonas paucimobilis} PDB: 2w8u_A* 2w8w_A* 2xbn_A* 2w8j_A* 2w8v_A* 2jg2_A* 2jgt_A 2x8u_A* | Back alignment and structure |
|---|
| >3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* | Back alignment and structure |
|---|
| >2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics; HET: PLP; 1.15A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2ctz_A O-acetyl-L-homoserine sulfhydrylase; crystal, O-acetyl homoserine sulfhydrase, structural genomic structural genomics/proteomics initiative; HET: PLP; 2.60A {Thermus thermophilus} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >3ffr_A Phosphoserine aminotransferase SERC; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1gc0_A Methionine gamma-lyase; pyridoxal-5'-phosphate; HET: LLP; 1.70A {Pseudomonas putida} SCOP: c.67.1.3 PDB: 1gc2_A* 1pg8_A* 1ukj_A* 2o7c_A* | Back alignment and structure |
|---|
| >2cb1_A O-acetyl homoserine sulfhydrylase; PLP enzyme, lyase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: LLP; 2.0A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1fc4_A 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino-3-ketobutyrate COA ligase, pyridoxal phosphate, COEN transferase, structural genomics; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.4 | Back alignment and structure |
|---|
| >3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} | Back alignment and structure |
|---|
| >3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1bs0_A Protein (8-amino-7-oxonanoate synthase); PLP-dependent acyl-COA synthase, biotin biosynthesis, 8-AMIN oxonanoate synthase; 1.65A {Escherichia coli} SCOP: c.67.1.4 PDB: 2g6w_A* 1dje_A* 1dj9_A* | Back alignment and structure |
|---|
| >3acz_A Methionine gamma-lyase; L-methionine; HET: LLP; 1.97A {Entamoeba histolytica} PDB: 3aej_A* 3ael_A* 3aem_A* 3aen_A* 3aeo_A* 3aep_A* | Back alignment and structure |
|---|
| >2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* | Back alignment and structure |
|---|
| >2rfv_A Methionine gamma-lyase; pyridoxal-5'-phosphate, PLP-dependent enzyme; HET: LLP; 1.35A {Citrobacter freundii} PDB: 1y4i_A* 3jwa_A* 3jw9_A* 3jwb_A* 3mkj_A* | Back alignment and structure |
|---|
| >3ht4_A Aluminum resistance protein; lyase, putative cystathionine BEAT-lyase, aluminium resistance protein, Q81A77_baccr, NESG, BCR213; 2.90A {Bacillus cereus atcc 14579} | Back alignment and structure |
|---|
| >3ri6_A O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate, gamma-elimination, direct sulfhydrylation, CY metabolism, protein thiocarboxylate, TR; 2.20A {Wolinella succinogenes} | Back alignment and structure |
|---|
| >1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* | Back alignment and structure |
|---|
| >1cs1_A CGS, protein (cystathionine gamma-synthase); lyase, LLP-dependent enzymes, methionine biosynthesis; HET: LLP DHD; 1.50A {Escherichia coli} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* | Back alignment and structure |
|---|
| >3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} | Back alignment and structure |
|---|
| >3a2b_A Serine palmitoyltransferase; vitamin B6-dependent enzyme fold type I, acyltransferase, PY phosphate; HET: PLP; 2.30A {Sphingobacterium multivorum} | Back alignment and structure |
|---|
| >2aeu_A Hypothetical protein MJ0158; selenocysteine synthase, PLP, pyridoxal phosphate, HOMO- oligomerization, unknown function; 1.70A {Methanocaldococcus jannaschii} SCOP: c.67.1.8 PDB: 2aev_A* | Back alignment and structure |
|---|
| >1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* | Back alignment and structure |
|---|
| >3kki_A CAI-1 autoinducer synthase; quorum sensing, CQSA, P virulence, acyltransferase, aminotransferase, pyridoxal PHO transferase; HET: PLP; 1.80A {Vibrio cholerae} PDB: 3hqt_A* 2wk9_A* 2wk8_A* 2wka_A* 2wk7_A | Back alignment and structure |
|---|
| >1pff_A Methionine gamma-lyase; homocysteine; 2.50A {Trichomonas vaginalis} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} SCOP: c.67.1.3 PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* | Back alignment and structure |
|---|
| >1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >3ndn_A O-succinylhomoserine sulfhydrylase; seattle structural genomics center for infectious disease, S mycobacterium, PLP, schiff base; HET: LLP; 1.85A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* | Back alignment and structure |
|---|
| >3nmy_A Xometc, cystathionine gamma-lyase-like protein; Cys-Met metabolism PLP-dependent enzyme family, CYST gamma lyase, pyridoxal-phosphate; HET: PLP; 2.07A {Xanthomonas oryzae PV} SCOP: c.67.1.0 PDB: 3e6g_A* 3nnp_A* | Back alignment and structure |
|---|
| >1n8p_A Cystathionine gamma-lyase; three open alpha/beta structures; HET: PLP; 2.60A {Saccharomyces cerevisiae} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >2x3l_A ORN/Lys/Arg decarboxylase family protein; lyase; HET: LLP; 2.00A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1ibj_A CBL, cystathionine beta-lyase; PLP-dependent enzyme, methionine biosynthesis, transsulfurat lyase; HET: PLP; 2.30A {Arabidopsis thaliana} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1e5e_A MGL, methionine gamma-lyase; methionine biosynthesis, PLP-dependent enzymes, C-S gamma lyase; HET: PPJ; 2.18A {Trichomonas vaginalis} SCOP: c.67.1.3 PDB: 1e5f_A* | Back alignment and structure |
|---|
| >1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >1o69_A Aminotransferase; structural genomics, unknown function; HET: X04; 1.84A {Campylobacter jejuni} SCOP: c.67.1.4 PDB: 1o62_A 1o61_A* | Back alignment and structure |
|---|
| >3frk_A QDTB; aminotransferase, sugar-modification, natural porduct; HET: TQP; 2.15A {Thermoanaerobacteriumthermosaccharolyticum} | Back alignment and structure |
|---|
| >1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* | Back alignment and structure |
|---|
| >1wyu_A Glycine dehydrogenase (decarboxylating) subunit 1; alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_A* 1wyv_A* | Back alignment and structure |
|---|
| >1b9h_A AHBA synthase, protein (3-amino-5-hydroxybenzoic acid synthase); rifamycin biosynthesis (RIFD gene); HET: PLP; 2.00A {Amycolatopsis mediterranei} SCOP: c.67.1.4 PDB: 1b9i_A* | Back alignment and structure |
|---|
| >3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* | Back alignment and structure |
|---|
| >3cog_A Cystathionine gamma-lyase; CTH, PLP, propargylglycine, SGC, inhibitor, structural genom stockholm, structural genomics consortium; HET: PLP; 2.00A {Homo sapiens} PDB: 2nmp_A* 3elp_B | Back alignment and structure |
|---|
| >2c81_A Glutamine-2-deoxy-scyllo-inosose aminotransferase; SMAT, butirosin, aminoglycoside antibiotics; HET: PMP; 1.7A {Bacillus circulans} PDB: 2c7t_A* | Back alignment and structure |
|---|
| >3uwc_A Nucleotide-sugar aminotransferase; lipopolysaccharide biosynthesis; HET: MSE PMP; 1.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* | Back alignment and structure |
|---|
| >3nyt_A Aminotransferase WBPE; PLP binding, nucleotide-sugar binding; HET: ULP; 1.30A {Pseudomonas aeruginosa} PDB: 3nys_A* 3nyu_A* 3nu8_A* 3nu7_A* 3nub_A* | Back alignment and structure |
|---|
| >2po3_A 4-dehydrase; external aldimine, PLP, aminotransferase, TDP-sugar; HET: T4K; 2.10A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >1mdo_A ARNB aminotransferase; type 1 aminotransferase fold; HET: MSE PMP; 1.70A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1mdx_A* 1mdz_A* | Back alignment and structure |
|---|
| >4hvk_A Probable cysteine desulfurase 2; transferase and ISCS, transferase; HET: PMP PG4; 1.43A {Archaeoglobus fulgidus} PDB: 4eb7_A* 4eb5_A* | Back alignment and structure |
|---|
| >1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* | Back alignment and structure |
|---|
| >2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* | Back alignment and structure |
|---|
| >3ou5_A Serine hydroxymethyltransferase, mitochondrial; structural genomics, STRU genomics consortium, SGC; 2.04A {Homo sapiens} | Back alignment and structure |
|---|
| >2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3a9z_A Selenocysteine lyase; PLP, cytoplasm, pyridoxal phosphate, transferase; HET: PLP SLP; 1.55A {Rattus norvegicus} PDB: 3a9x_A* 3a9y_A* 3gzd_A* 3gzc_A* 2hdy_A* | Back alignment and structure |
|---|
| >3vax_A Putative uncharacterized protein DNDA; desulfurase, transferase; HET: PLP; 2.40A {Streptomyces lividans} | Back alignment and structure |
|---|
| >2oga_A Transaminase; PLP-dependent enzyme, desosamine, deoxysugars, antibiotics, hydrolase; HET: PGU; 2.05A {Streptomyces venezuelae} PDB: 2oge_A* | Back alignment and structure |
|---|
| >2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI structure initiative, joint center for structural genomics; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, LYA; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A* | Back alignment and structure |
|---|
| >2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} | Back alignment and structure |
|---|
| >4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* | Back alignment and structure |
|---|
| >2fnu_A Aminotransferase; protein-product complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PMP UD1; 1.50A {Helicobacter pylori} SCOP: c.67.1.4 PDB: 2fni_A* 2fn6_A* | Back alignment and structure |
|---|
| >1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >2bwn_A 5-aminolevulinate synthase; tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal PHOS dependent, transferase, acyltransferase; HET: LLP; 2.1A {Rhodobacter capsulatus} SCOP: c.67.1.4 PDB: 2bwo_A* 2bwp_A* | Back alignment and structure |
|---|
| >1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >3dr4_A Putative perosamine synthetase; deoxysugar, pyridoxal phosphate, aspartate aminotransferase, O-antigen; HET: G4M; 1.60A {Caulobacter crescentus} PDB: 3dr7_A* 3bn1_A* | Back alignment and structure |
|---|
| >3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} SCOP: c.67.1.0 | Back alignment and structure |
|---|
| >1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase cobalamin, lyase; 1.46A {Salmonella enterica} SCOP: c.67.1.1 PDB: 1lc7_A* 1lc8_A* 1lkc_A* | Back alignment and structure |
|---|
| >2o0r_A RV0858C (N-succinyldiaminopimelate aminotransfera; PLP-binding enzyme, lysine biosynthesis, aminotransferase, S genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 2.19A {Helicobacter pylori 26695} SCOP: c.67.1.0 | Back alignment and structure |
|---|
| >4adb_A Succinylornithine transaminase; transferase, PLP enzymes, aminotransferase; HET: PLP; 2.20A {Escherichia coli} PDB: 4adc_A* 4add_A* 4ade_A | Back alignment and structure |
|---|
| >3ju7_A Putative PLP-dependent aminotransferase; NP_978343.1, struct genomics, joint center for structural genomics, JCSG; HET: LLP PGE; 2.19A {Bacillus cereus atcc 10987} | Back alignment and structure |
|---|
| >2x5d_A Probable aminotransferase; HET: LLP PLP; 2.25A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* | Back alignment and structure |
|---|
| >3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii} | Back alignment and structure |
|---|
| >3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} SCOP: c.67.1.0 | Back alignment and structure |
|---|
| >1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A* | Back alignment and structure |
|---|
| >1c4k_A Protein (ornithine decarboxylase); lyase; HET: PLP GTP; 2.70A {Lactobacillus SP} SCOP: c.23.1.4 c.67.1.5 d.125.1.1 PDB: 1ord_A* | Back alignment and structure |
|---|
| >2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} SCOP: c.67.1.0 | Back alignment and structure |
|---|
| >1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} | Back alignment and structure |
|---|
| >3qm2_A Phosphoserine aminotransferase; structural genomics, center for structural genomics of infec diseases, csgid; 2.25A {Salmonella enterica subsp} PDB: 1bjn_A* 1bjo_A* 3qbo_A* | Back alignment and structure |
|---|
| >2c0r_A PSAT, phosphoserine aminotransferase; pyridoxal-5'-phosphate, pyridine serine biosynthesis, amino-acid biosynthesis, pyridoxal phosphate; HET: PLP; 1.2A {Bacillus circulans} SCOP: c.67.1.4 PDB: 1bt4_A* 1w3u_A* | Back alignment and structure |
|---|
| >3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3op7_A Aminotransferase class I and II; PLP-dependent transferase, structural genomics, joint center structural genomics, JCSG; HET: LLP UNL; 1.70A {Streptococcus suis 89} PDB: 3p6k_A* | Back alignment and structure |
|---|
| >1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* | Back alignment and structure |
|---|
| >1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A* | Back alignment and structure |
|---|
| >3b8x_A WBDK, pyridoxamine 5-phosphate-dependent dehydrase; aspartate aminotransferase, colitose, perosamine, O-antigen, pyridoxal phosphate,; HET: G4M; 1.70A {Escherichia coli} PDB: 2gms_A* 2gmu_A* 2r0t_A* 3gr9_A* | Back alignment and structure |
|---|
| >3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4e77_A Glutamate-1-semialdehyde 2,1-aminomutase; structural genomics, center for structural genomics of infec diseases, csgid, porphyrin biosynthesis; 2.00A {Yersinia pestis} | Back alignment and structure |
|---|
| >3qgu_A LL-diaminopimelate aminotransferase; L-lysine, pyridoxal-5' phosphate, chamydomonas reinhardtii; HET: GOL; 1.55A {Chlamydomonas reinhardtii} | Back alignment and structure |
|---|
| >3e77_A Phosphoserine aminotransferase; SERC, PLP, structural genomi structural genomics consortium, SGC, amino-acid biosynthesi aminotransferase; HET: PLP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* | Back alignment and structure |
|---|
| >3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* | Back alignment and structure |
|---|
| >3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} | Back alignment and structure |
|---|
| >1z7d_A Ornithine aminotransferase; structural genomics consortium, SGC, malaria; 2.10A {Plasmodium yoelii yoelii} SCOP: c.67.1.4 PDB: 3lg0_A 3ntj_A | Back alignment and structure |
|---|
| >4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* | Back alignment and structure |
|---|
| >3k28_A Glutamate-1-semialdehyde 2,1-aminomutase 2; biosynthesis of cofactors, prosthetic groups, and carriers, csgid, cytoplasm, isomerase; HET: MSE PLP; 1.95A {Bacillus anthracis str} SCOP: c.67.1.4 PDB: 3bs8_A* | Back alignment and structure |
|---|
| >2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* | Back alignment and structure |
|---|
| >3asa_A LL-diaminopimelate aminotransferase; PLP dependent aminotransferase; 2.05A {Chlamydia trachomatis} PDB: 3asb_A* | Back alignment and structure |
|---|
| >3l44_A Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha beta class, PLP-dependent transferase-like, bacillus A csgid, porphyrin biosynthesis; HET: LLP; 2.05A {Bacillus anthracis} SCOP: c.67.1.0 | Back alignment and structure |
|---|
| >2epj_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.70A {Aeropyrum pernix} PDB: 2zsl_A* 2zsm_A* | Back alignment and structure |
|---|
| >2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A | Back alignment and structure |
|---|
| >3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} | Back alignment and structure |
|---|
| >3ei9_A LL-diaminopimelate aminotransferase; lysine biosynthesis, pyridoxal 5' phosphat external aldimine, chloroplast, pyridox phosphate; HET: PL6; 1.55A {Arabidopsis thaliana} PDB: 3ei8_A* 3eib_A* 3ei6_A* 2z1z_A* 3ei5_A* 2z20_A* 3ei7_A 3eia_A* | Back alignment and structure |
|---|
| >2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* | Back alignment and structure |
|---|
| >1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A* | Back alignment and structure |
|---|
| >3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} SCOP: c.67.1.4 PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* | Back alignment and structure |
|---|
| >1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* | Back alignment and structure |
|---|
| >3aow_A Putative uncharacterized protein PH0207; protein-PLP-AKG triple complex, schiff-base linkage, kynuren aminotransferase; HET: PLP AKG; 1.56A {Pyrococcus horikoshii} PDB: 3aov_A* 3ath_A* 3av7_A* 1x0m_A 1wst_A* | Back alignment and structure |
|---|
| >1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* | Back alignment and structure |
|---|
| >3fq8_A Glutamate-1-semialdehyde 2,1-aminomutase; drug resistance, microev0lution, integrated approach, chlorophyll biosynthesis; HET: PMP; 2.00A {Synechococcus elongatus pcc 6301} SCOP: c.67.1.4 PDB: 2hp1_A* 2hoz_A* 2hoy_A* 2hp2_A* 3fq7_A* 3usf_A* 2gsa_A* 3gsb_A* 4gsa_A* 3fqa_A* 2cfb_A* | Back alignment and structure |
|---|
| >3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: GLN PMP; 2.26A {Mus musculus} SCOP: c.67.1.0 PDB: 2zjg_A* 3e2f_A* 3e2z_A* | Back alignment and structure |
|---|
| >2r2n_A Kynurenine/alpha-aminoadipate aminotransferase mitochondrial; alpha & beta protein, PLP-dependent transferase, aminotransf mitochondrion; HET: PMP KYN; 1.95A {Homo sapiens} PDB: 2qlr_A* 3dc1_A* 3ue8_A* 2vgz_A* 2xh1_A* | Back alignment and structure |
|---|
| >3m5u_A Phosphoserine aminotransferase; alpha-beta half sandwich, csgid, amino-acid biosynthesis, cytoplasm, pyridoxal phosphate; HET: MES; 2.15A {Campylobacter jejuni} SCOP: c.67.1.0 | Back alignment and structure |
|---|
| >2fyf_A PSAT, phosphoserine aminotransferase; PLP-dependent enzyme, dimer, structural genomics; HET: PLP; 1.50A {Mycobacterium tuberculosis} PDB: 3vom_A* | Back alignment and structure |
|---|
| >3tfu_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; transferase, transferase-transferase inhibitor complex; HET: PL8; 1.94A {Mycobacterium tuberculosis} PDB: 3tft_A* 3bv0_A* 3lv2_A* | Back alignment and structure |
|---|
| >3ly1_A Putative histidinol-phosphate aminotransferase; structural G joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica} | Back alignment and structure |
|---|
| >2cy8_A D-phgat, D-phenylglycine aminotransferase; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; 2.30A {Pseudomonas stutzeri} | Back alignment and structure |
|---|
| >3g7q_A Valine-pyruvate aminotransferase; NP_462565.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} SCOP: c.67.1.1 PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A* | Back alignment and structure |
|---|
| >1w23_A Phosphoserine aminotransferase; pyridoxal-5'-phosphate; HET: PGE PLP EPE; 1.08A {Bacillus alcalophilus} SCOP: c.67.1.4 PDB: 2bhx_A* 2bi1_A* 2bi2_A* 2bi3_A* 2bi5_A* 2bi9_A* 2bia_A* 2bie_A* 2big_A* | Back alignment and structure |
|---|
| >3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, deino radiodurans, pyridoxal phosphate, transfe PSI-2; 1.70A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A | Back alignment and structure |
|---|
| >2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1bw0_A TAT, protein (tyrosine aminotransferase); tyrosine catabolism, pyridoxal-5'-phosphate, PLP; HET: LLP; 2.50A {Trypanosoma cruzi} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A* | Back alignment and structure |
|---|
| >3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* | Back alignment and structure |
|---|
| >3hdo_A Histidinol-phosphate aminotransferase; PSI-II, histidinol-phosphate aminotrans structural genomics, protein structure initiative; 1.61A {Geobacter metallireducens gs-15} | Back alignment and structure |
|---|
| >3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} | Back alignment and structure |
|---|
| >1fg7_A Histidinol phosphate aminotransferase; HISC, histidine biosynthesis, pyridoxal PH montreal-kingston bacterial structural genomics initiative; HET: PMP; 1.50A {Escherichia coli} SCOP: c.67.1.1 PDB: 1fg3_A* 1gew_A* 1gex_A* 1gey_A* 1iji_A* | Back alignment and structure |
|---|
| >3f6t_A Aspartate aminotransferase; YP_194538.1, STRU genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: LLP; 2.15A {Lactobacillus acidophilus ncfm} | Back alignment and structure |
|---|
| >2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* | Back alignment and structure |
|---|
| >3b1d_A Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococcus anginosus} PDB: 3b1c_A* 3b1e_A* | Back alignment and structure |
|---|
| >2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... | Back alignment and structure |
|---|
| >4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >2zy4_A L-aspartate beta-decarboxylase; pyridoxal 5'-phosphate, aminotransferase, lyase; HET: PLP; 2.00A {Alcaligenes faecalis subsp} PDB: 2zy3_A* 2zy5_A* 3fdd_A* 2zy2_A* | Back alignment and structure |
|---|
| >2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134} SCOP: c.67.1.0 | Back alignment and structure |
|---|
| >3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} | Back alignment and structure |
|---|
| >3dod_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, biotin biosynthesis, pyridoxal phosphate, adenosyl-L-methionine; HET: PLP; 1.90A {Bacillus subtilis} SCOP: c.67.1.0 PDB: 3drd_A 3du4_A* | Back alignment and structure |
|---|
| >3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3get_A Histidinol-phosphate aminotransferase; NP_281508.1, structural genomics, joint center for structural genomics; HET: LLP MSE; 2.01A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >4a6r_A Omega transaminase; transferase, PLP-binding enzyme, transaminase fold type I; HET: TA8; 1.35A {Chromobacterium violaceum} PDB: 4a6t_A* 4a6u_A 4a72_A* 4ah3_A* | Back alignment and structure |
|---|
| >1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* | Back alignment and structure |
|---|
| >3oks_A 4-aminobutyrate transaminase; ssgcid, transferase, seattle structural genomics center for infectious disease; HET: LLP; 1.80A {Mycobacterium smegmatis} PDB: 3r4t_A* 3q8n_A | Back alignment and structure |
|---|
| >3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* | Back alignment and structure |
|---|
| >3i5t_A Aminotransferase; pyridoxal 5'-phosphate, PSI-2, NYSGXRC, ST genomics, protein structure initiative; HET: PLP; 2.00A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} | Back alignment and structure |
|---|
| >1ohv_A 4-aminobutyrate aminotransferase; PLP-dependent enzyme, 4- AMIN acid, antiepileptic drug target; HET: PLP; 2.3A {Sus scrofa} SCOP: c.67.1.4 PDB: 1ohw_A* 1ohy_A* | Back alignment and structure |
|---|
| >3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria in CLIP11262, structural genomics, PSI-2; 2.31A {Listeria innocua} SCOP: c.67.1.0 | Back alignment and structure |
|---|
| >3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >3ez1_A Aminotransferase MOCR family; YP_604413.1, struct genomics, joint center for structural genomics, JCSG; 2.60A {Deinococcus geothermalis dsm 11300} | Back alignment and structure |
|---|
| >3ppl_A Aspartate aminotransferase; dimer, PLP-dependent transferase-like fold structural genomics, joint center for structural genomics; HET: MSE PLP UNL; 1.25A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} SCOP: c.67.1.1 PDB: 3tat_A* | Back alignment and structure |
|---|
| >4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* | Back alignment and structure |
|---|
| >4ao9_A Beta-phenylalanine aminotransferase; HET: PLP; 1.50A {Variovorax paradoxus} PDB: 4aoa_A* | Back alignment and structure |
|---|
| >3d6k_A Putative aminotransferase; APC82464, corynebacterium diphthe structural genomics, PSI-2, protein structure initiative; 2.00A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >2e7u_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* | Back alignment and structure |
|---|
| >3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} | Back alignment and structure |
|---|
| >3ihj_A Alanine aminotransferase 2; helix, structural genomics, structural genomics consortium, pyridoxal phosphate; HET: PLP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3p1t_A Putative histidinol-phosphate aminotransferase; PLP-dependent transferase-like, structural genomics, joint C structural genomics, JCSG; HET: TLA; 2.60A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >2yky_A Beta-transaminase; transferase; HET: PLP SFE; 1.69A {Mesorhizobium SP} PDB: 2ykv_A* 2yku_A* 2ykx_A* | Back alignment and structure |
|---|
| >4atq_A 4-aminobutyrate transaminase; transferase; HET: PLP; 2.75A {Arthrobacter aurescens} PDB: 4atp_A* | Back alignment and structure |
|---|
| >3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* | Back alignment and structure |
|---|
| >4e3q_A Pyruvate transaminase; aminotransferase, transferase; HET: PMP; 1.90A {Vibrio fluvialis} PDB: 4e3r_A* 3nui_A | Back alignment and structure |
|---|
| >1uu1_A Histidinol-phosphate aminotransferase; histidine biosynthesis, pyridoxal phosphate, complete proteome; HET: PMP HSA; 2.38A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1uu0_A 1h1c_A* 1uu2_A* 2f8j_A* | Back alignment and structure |
|---|
| >3fkd_A L-threonine-O-3-phosphate decarboxylase; structural genomic, , structural genomics, PSI-2, protein structure initiative; 2.50A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A* | Back alignment and structure |
|---|
| >3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} SCOP: c.67.1.0 | Back alignment and structure |
|---|
| >4h51_A Aspartate aminotransferase; ssgcid, structural genomics, seattle struc genomics center for infectious disease, aspartate aminotran transferase; HET: LLP; 1.85A {Leishmania major} | Back alignment and structure |
|---|
| >3bwn_A AT1G70560, L-tryptophan aminotransferase; auxin synthesis, pyridoxal-5'- phosphate, indole-3-pyruvate; HET: LLP PMP PHE; 2.25A {Arabidopsis thaliana} PDB: 3bwo_A* | Back alignment and structure |
|---|
| >4gqr_A Pancreatic alpha-amylase; glycosyl hydrolase, diabetes, obesity, digestion, glycosidas inhibition, flavonol, drug design; HET: NAG MYC; 1.20A {Homo sapiens} PDB: 1cpu_A* 1bsi_A 1u2y_A* 1u30_A* 1u33_A* 1xcw_A* 1xcx_A* 1xd0_A* 1xd1_A* 2qmk_A* 2qv4_A* 3bai_A* 3baj_A* 3baw_A* 3ij7_A* 1hny_A* 3ij9_A* 3ij8_A* 4gqq_A* 1kgw_A* ... | Back alignment and structure |
|---|
| >3bzy_B ESCU; auto cleavage protein, flagella, intein, T3SS, membrane, membrane protein, protein transport; 1.20A {Escherichia coli} SCOP: d.367.1.1 PDB: 3c00_B 3bzl_C 3bzo_B 3bzv_B 3c03_C 3bzz_B 3bzx_B | Back alignment and structure |
|---|
| >1g94_A Alpha-amylase; beta-alpha-8-barrel, 3 domain structure, hydrolase; HET: DAF GLC; 1.74A {Pseudoalteromonas haloplanktis} SCOP: b.71.1.1 c.1.8.1 PDB: 1g9h_A* 1l0p_A 1aqm_A* 1aqh_A* 1b0i_A 1jd7_A 1jd9_A 1kxh_A* | Back alignment and structure |
|---|
| >3t7y_A YOP proteins translocation protein U; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta; 2.10A {Chlamydia trachomatis} SCOP: d.367.1.0 | Back alignment and structure |
|---|
| >1ud2_A Amylase, alpha-amylase; calcium-free, alkaline, hydrolase; 2.13A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1ud4_A 1ud5_A 1ud6_A 1ud8_A 1ud3_A | Back alignment and structure |
|---|
| >3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A | Back alignment and structure |
|---|
| >2vt1_B Surface presentation of antigens protein SPAS; specificity switch, virulence, transmembrane, inner membrane, FLHB, YSCU, T3SS, plasmid; 2.00A {Shigella flexneri} SCOP: d.367.1.1 | Back alignment and structure |
|---|
| >4aie_A Glucan 1,6-alpha-glucosidase; hydrolase, glycoside hydrolase 13; HET: MES GOL; 2.05A {Lactobacillus acidophilus ncfm} | Back alignment and structure |
|---|
| >1wpc_A Glucan 1,4-alpha-maltohexaosidase; maltohexaose-producing amylase, alpha-amylase, acarbose, HYD; HET: ACI GLC GAL; 1.90A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1wp6_A* 2d3l_A* 2d3n_A* 2die_A 2gjp_A* 2gjr_A 1w9x_A* | Back alignment and structure |
|---|
| >1lwj_A 4-alpha-glucanotransferase; alpha-amylase family, acarbose, (beta/alpha)8 barrel; HET: ACG; 2.50A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1lwh_A* | Back alignment and structure |
|---|
| >1u83_A Phosphosulfolactate synthase; structural genomics, phosphosulfolactate PSI, protein structure initiative, midwest center for struc genomics; 2.20A {Bacillus subtilis} SCOP: c.1.27.1 | Back alignment and structure |
|---|
| >1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >2guy_A Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; HET: NAG BMA; 1.59A {Aspergillus oryzae} SCOP: b.71.1.1 c.1.8.1 PDB: 2gvy_A* 3kwx_A* 6taa_A 7taa_A* 2taa_A | Back alignment and structure |
|---|
| >3c01_E Surface presentation of antigens protein SPAS; auto cleavage protein, flagella, ESCU, YSCU, intein, T3SS, M inner membrane, transmembrane; 2.60A {Salmonella typhimurium} SCOP: d.367.1.1 | Back alignment and structure |
|---|
| >1mxg_A Alpha amylase; hyperthermostable, family 13 glycosyl hydrola (beta/alpha)8-barrel, hydrolase; HET: ACR ETE; 1.60A {Pyrococcus woesei} SCOP: b.71.1.1 c.1.8.1 PDB: 1mwo_A* 1mxd_A* 3qgv_A* | Back alignment and structure |
|---|
| >1wza_A Alpha-amylase A; hydrolase, halophilic, thermophilic; 1.60A {Halothermothrix orenii} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >2wc7_A Alpha amylase, catalytic region; CD/PUL-hydrolyzing enzymes, hydrolase, glycosidase, neopullu; 2.37A {Nostoc punctiforme} PDB: 2wcs_A 2wkg_A | Back alignment and structure |
|---|
| >1ht6_A AMY1, alpha-amylase isozyme 1; barley, beta-alpha-barrel, hydrolase; 1.50A {Hordeum vulgare} SCOP: b.71.1.1 c.1.8.1 PDB: 1p6w_A* 1rpk_A* 3bsg_A 2qpu_A* 1rp8_A* 1rp9_A* 2qps_A 3bsh_A* 1ava_A 1amy_A 1bg9_A* | Back alignment and structure |
|---|
| >2z1k_A (NEO)pullulanase; hydrolase, structural genomics, NPPSFA, national project on structural and functional analyses; HET: GLC; 2.30A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1jae_A Alpha-amylase; glycosidase, carbohydrate metabolism, 4-glucan-4-glucanohydrolase, hydrolase; 1.65A {Tenebrio molitor} SCOP: b.71.1.1 c.1.8.1 PDB: 1clv_A 1tmq_A 1viw_A* | Back alignment and structure |
|---|
| >1ua7_A Alpha-amylase; beta-alpha-barrels, acarbose, greek-KEY motif, hydrolase; HET: ACI GLD GLC G6D BGC; 2.21A {Bacillus subtilis} SCOP: b.71.1.1 c.1.8.1 PDB: 1bag_A* 3dc0_A | Back alignment and structure |
|---|
| >1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* | Back alignment and structure |
|---|
| >2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >2dh2_A 4F2 cell-surface antigen heavy chain; TIM-barrel, glycosidase like, antiparallel beta-sheet, greek terminal domain, extracellular domain; 2.10A {Homo sapiens} PDB: 2dh3_A | Back alignment and structure |
|---|
| >3dhu_A Alpha-amylase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... | Back alignment and structure |
|---|
| >1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* | Back alignment and structure |
|---|
| >3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A | Back alignment and structure |
|---|
| >1m53_A Isomaltulose synthase; klebsiella SP. LX3, sucrose isomerization, isomerase; 2.20A {Klebsiella SP} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >1qwg_A PSL synthase;, (2R)-phospho-3-sulfolactate synthase; beta-alpha-barrel, lyase; 1.60A {Methanocaldococcus jannaschii} SCOP: c.1.27.1 | Back alignment and structure |
|---|
| >1zja_A Trehalulose synthase; sucrose isomerase, alpha-amylase family, (beta/alpha)8 barrel; 1.60A {Pseudomonas mesoacidophila} PDB: 1zjb_A 2pwd_A* 2pwh_A 2pwg_A 2pwe_A* 2pwf_A* 3gbe_A* 3gbd_A* | Back alignment and structure |
|---|
| >1uok_A Oligo-1,6-glucosidase; sugar degradation, hydrolase, TIM-barrel glycosidase; 2.00A {Bacillus cereus} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* | Back alignment and structure |
|---|
| >4aef_A Neopullulanase (alpha-amylase II); hydrolase, thermostability, high temperature; 2.34A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A | Back alignment and structure |
|---|
| >2zic_A Dextran glucosidase; TIM barrel, (beta/alpha)8-barrel, hydrolase; 2.20A {Streptococcus mutans} PDB: 2zid_A* | Back alignment and structure |
|---|
| >3bc9_A AMYB, alpha amylase, catalytic region; acarbose, thermostable, halophilic, N domain, starch binding, hydrolase; HET: G6D GLC ACI BGC ACR; 1.35A {Halothermothrix orenii} PDB: 3bcd_A* 3bcf_A | Back alignment and structure |
|---|
| >2ze0_A Alpha-glucosidase; TIM barrel, glucoside hydrolase, extremophIle, hydrolase; 2.00A {Geobacillus SP} | Back alignment and structure |
|---|
| >3edf_A FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin complex, glycosidase, hydrolase; HET: CE6 ACX; 1.65A {Flavobacterium SP} PDB: 3edj_A* 3edk_A* 3ede_A 3edd_A* 1h3g_A | Back alignment and structure |
|---|
| >3b1s_B Flagellar biosynthetic protein FLHB; type III secretion system, protein transport, MEMB protein; 2.55A {Aquifex aeolicus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 71 | ||||
| d1c7ga_ | 456 | c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbi | 4e-09 | |
| d2v1pa1 | 467 | c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptop | 7e-09 | |
| d2z67a1 | 434 | c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase ( | 4e-05 | |
| d1ax4a_ | 465 | c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanas | 5e-05 |
| >d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} Length = 456 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: PLP-dependent transferase-like superfamily: PLP-dependent transferases family: Beta-eliminating lyases domain: Tyrosine phenol-lyase species: Erwinia herbicola [TaxId: 549]
Score = 48.2 bits (114), Expect = 4e-09
Identities = 10/78 (12%), Positives = 21/78 (26%), Gaps = 12/78 (15%)
Query: 6 QLKARCQEHNIPVHMDGARVFNAA--------SYLGLPLAEV----CASVDTVMFCLSKG 53
+ + I + D R A Y + + ++ + D K
Sbjct: 199 AVHEMASTYGIKIFYDATRCVENAYFIKEQEAGYENVSIKDIVHEMFSYADGCTMSGKKD 258
Query: 54 LGAPVGSILAGPEEFIQK 71
+G L +E +
Sbjct: 259 CLVNIGGFLCMNDEEMFS 276
|
| >d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Length = 467 | Back information, alignment and structure |
|---|
| >d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Length = 434 | Back information, alignment and structure |
|---|
| >d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Length = 465 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 71 | |||
| d1c7ga_ | 456 | Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 5 | 99.48 | |
| d2v1pa1 | 467 | Tryptophan indol-lyase (tryptophanase) {Escherichi | 99.41 | |
| d1js3a_ | 476 | DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823] | 99.35 | |
| d2e7ja1 | 364 | Selenocysteinyl-tRNA synthase (SepSecS) {Archaeogl | 99.31 | |
| d1jf9a_ | 405 | NifS-like protein/selenocysteine lyase {Escherichi | 99.2 | |
| d1ax4a_ | 465 | Tryptophan indol-lyase (tryptophanase) {Proteus vu | 99.19 | |
| d1m32a_ | 361 | 2-aminoethylphosphonate transaminase {Salmonella t | 99.12 | |
| d2z67a1 | 434 | Selenocysteinyl-tRNA synthase (SepSecS) {Methanoco | 99.1 | |
| d1t3ia_ | 408 | Probable cysteine desulfurase SufS {Synechocystis | 99.08 | |
| d1pmma_ | 450 | Glutamate decarboxylase beta, GadB {Escherichia co | 99.04 | |
| d3bc8a1 | 445 | Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mu | 99.02 | |
| d2aeua1 | 366 | Hypothetical protein MJ0158 {Archaeon Methanococcu | 99.01 | |
| d1c4ka2 | 462 | Ornithine decarboxylase major domain {Lactobacillu | 99.0 | |
| d1h0ca_ | 388 | Alanine-glyoxylate aminotransferase {Human (Homo s | 98.86 | |
| d1elua_ | 381 | Cystine C-S lyase C-des {Synechocystis sp. [TaxId: | 98.84 | |
| d1p3wa_ | 391 | Cysteine desulfurase IscS {Escherichia coli [TaxId | 98.82 | |
| d1qz9a_ | 404 | Kynureninase {Pseudomonas fluorescens [TaxId: 294] | 98.78 | |
| d1fc4a_ | 401 | 2-amino-3-ketobutyrate CoA ligase {Escherichia col | 98.74 | |
| d1kl1a_ | 405 | Serine hydroxymethyltransferase {Bacillus stearoth | 98.68 | |
| d2bkwa1 | 382 | Alanine-glyoxylate aminotransferase {Baker's yeast | 98.64 | |
| d2a7va1 | 463 | Serine hydroxymethyltransferase {Human (Homo sapie | 98.54 | |
| d1vjoa_ | 377 | Alanine-glyoxylate aminotransferase {Cyanobacteria | 98.51 | |
| d1rv3a_ | 470 | Serine hydroxymethyltransferase {Rabbit (Oryctolag | 98.5 | |
| d1dfoa_ | 416 | Serine hydroxymethyltransferase {Escherichia coli | 98.46 | |
| d2ch1a1 | 388 | 3-hydroxykynurenine transaminase {Malaria mosquito | 98.45 | |
| d1y4ia1 | 397 | Methionine gamma-lyase, MGL {Citrobacter freundii | 98.4 | |
| d1qgna_ | 398 | Cystathionine gamma-synthase, CGS {Common tobacco | 98.36 | |
| d1gc0a_ | 392 | Methionine gamma-lyase, MGL {Pseudomonas putida [T | 98.34 | |
| d1eg5a_ | 376 | NifS-like protein/selenocysteine lyase {Thermotoga | 98.34 | |
| d1m6sa_ | 343 | Low-specificity threonine aldolase {Thermotoga mar | 98.33 | |
| d1mdoa_ | 376 | Aminotransferase ArnB {Salmonella typhimurium [Tax | 98.25 | |
| d2bwna1 | 396 | 5-aminolevulinate synthase {Rhodobacter capsulatus | 98.21 | |
| d2ctza1 | 421 | O-acetyl-L-homoserine sulfhydrylase {Thermus therm | 98.19 | |
| d1ibja_ | 380 | Cystathionine beta-lyase, CBL {Thale cress (Arabid | 98.16 | |
| d1bs0a_ | 383 | PLP-dependent acyl-CoA synthase (8-amino-7-oxonano | 98.16 | |
| d1cs1a_ | 384 | Cystathionine gamma-synthase, CGS {Escherichia col | 98.14 | |
| d1iuga_ | 348 | Subgroup IV putative aspartate aminotransferase {T | 98.05 | |
| d1o69a_ | 374 | Aminotransferase homolog WlaK (PglE, Cj1121c) {Cam | 97.84 | |
| d1w23a_ | 360 | Phosphoserine aminotransferase, PSAT {Bacillus alc | 97.82 | |
| d1cl1a_ | 391 | Cystathionine beta-lyase, CBL {Escherichia coli [T | 97.79 | |
| d1v72a1 | 345 | Phenylserine aldolase PSALD {Pseudomonas putida [T | 97.73 | |
| d1b9ha_ | 384 | 3-amino-5-hydroxybenzoic acid synthase (AHBA synth | 97.69 | |
| d1n8pa_ | 393 | Cystathionine gamma-lyase (CYS3) {Baker's yeast (S | 97.67 | |
| d1wyua1 | 437 | Glycine dehydrogenase (decarboxylating) subunit 1 | 97.66 | |
| d1v2da_ | 368 | Glutamine aminotransferase {Thermus thermophilus [ | 97.49 | |
| d1pffa_ | 331 | Methionine gamma-lyase, MGL {Trichomonas vaginalis | 97.48 | |
| d1wsta1 | 403 | Multiple substrate aminotransferase, MSAT {Thermoc | 97.48 | |
| d2fnua1 | 371 | Spore coat polysaccharide biosynthesis protein C { | 97.47 | |
| d2gsaa_ | 427 | Glutamate-1-semialdehyde aminomutase (aminotransfe | 97.45 | |
| d1gdea_ | 388 | Aromatic aminoacid aminotransferase, AroAT {Archae | 97.43 | |
| d2c0ra1 | 361 | Phosphoserine aminotransferase, PSAT {Bacillus cir | 97.43 | |
| d1m7ya_ | 431 | 1-aminocyclopropane-1-carboxylate synthase (ACC sy | 97.38 | |
| d1z7da1 | 404 | Ornithine aminotransferase {Plasmodium yoelii yoel | 97.37 | |
| d1e5ea_ | 394 | Methionine gamma-lyase, MGL {Trichomonas vaginalis | 97.37 | |
| d1iaya_ | 428 | 1-aminocyclopropane-1-carboxylate synthase (ACC sy | 97.32 | |
| d1b5pa_ | 382 | Aspartate aminotransferase, AAT {Thermus thermophi | 97.31 | |
| d1sffa_ | 425 | 4-aminobutyrate aminotransferase, GABA-aminotransf | 97.22 | |
| d1j32a_ | 388 | Aspartate aminotransferase, AAT {Phormidium lapide | 97.2 | |
| d1lc5a_ | 355 | L-threonine-O-3-phosphate decarboxylase CobD {Salm | 97.19 | |
| d1o4sa_ | 375 | Aspartate aminotransferase, AAT {Thermotoga mariti | 97.18 | |
| d1w7la_ | 418 | Kynurenine--oxoglutarate transaminase I {Human (Ho | 97.01 | |
| d1vefa1 | 387 | Acetylornithine/acetyl-lysine aminotransferase Arg | 96.87 | |
| d1zoda1 | 431 | Dialkylglycine decarboxylase {Pseudomonas cepacia | 96.82 | |
| d1vp4a_ | 420 | Putative aminotransferase TM1131 {Thermotoga marit | 96.81 | |
| d2r5ea1 | 418 | Kynurenine--oxoglutarate transaminase I {Yellowfev | 96.7 | |
| d2byla1 | 404 | Ornithine aminotransferase {Human (Homo sapiens) [ | 96.57 | |
| d2gb3a1 | 389 | AAT homologue TM1698 {Thermotoga maritima [TaxId: | 96.56 | |
| d1c7na_ | 394 | Cystalysin {Treponema denticola [TaxId: 158]} | 96.5 | |
| d1d2fa_ | 361 | Modulator in mal gene expression, MalY {Escherichi | 96.36 | |
| d1yaaa_ | 412 | Aspartate aminotransferase, AAT {Baker's yeast (Sa | 96.35 | |
| d1bw0a_ | 412 | Tyrosine aminotransferase (TAT) {Trypanosoma cruzi | 96.27 | |
| d1svva_ | 340 | Low-specificity threonine aldolase {Leishmania maj | 96.25 | |
| d1s0aa_ | 429 | Adenosylmethionine-8-amino-7-oxononanoate aminotra | 96.2 | |
| d1xi9a_ | 395 | Putative alanine aminotransferase {Pyrococcus furi | 96.12 | |
| d7aata_ | 401 | Aspartate aminotransferase, AAT {Chicken (Gallus g | 95.89 | |
| d1bjna_ | 360 | Phosphoserine aminotransferase, PSAT {Escherichia | 95.85 | |
| d1wyub1 | 471 | Glycine dehydrogenase subunit 2 (P-protein) {Therm | 95.41 | |
| d2q7wa1 | 396 | Aspartate aminotransferase, AAT {Escherichia coli | 94.98 | |
| d1ajsa_ | 412 | Aspartate aminotransferase, AAT {Pig (Sus scrofa), | 94.68 | |
| d2ay1a_ | 394 | Aromatic aminoacid aminotransferase, AroAT {Paraco | 94.0 | |
| d1ohwa_ | 461 | 4-aminobutyrate aminotransferase, GABA-aminotransf | 91.61 | |
| d1ud2a2 | 390 | Bacterial alpha-amylase {Bacillus sp., ksm-k38 [Ta | 91.26 | |
| d3tata_ | 397 | Aromatic aminoacid aminotransferase, AroAT {Escher | 91.23 | |
| d1jaea2 | 378 | Animal alpha-amylase {Yellow mealworm (Tenebrio mo | 90.45 | |
| d1hx0a2 | 403 | Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 982 | 90.41 | |
| d1gcya2 | 357 | G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase | 90.07 | |
| d2d3na2 | 394 | Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: | 89.96 | |
| d1fg7a_ | 354 | Histidinol-phosphate aminotransferase HisC {Escher | 89.94 | |
| d1mxga2 | 361 | Bacterial alpha-amylase {Archaeon Pyrococcus woese | 89.83 | |
| d1hvxa2 | 393 | Bacterial alpha-amylase {Bacillus stearothermophil | 89.77 | |
| d1g94a2 | 354 | Bacterial alpha-amylase {Pseudoalteromonas halopla | 89.59 | |
| d1qhoa4 | 407 | Cyclodextrin glycosyltransferase {Bacillus stearot | 89.38 | |
| d1u08a_ | 382 | Putative methionine aminotransferase YdbL {Escheri | 89.25 | |
| d3bmva4 | 406 | Cyclodextrin glycosyltransferase {Thermoanaerobact | 89.04 | |
| d1bf2a3 | 475 | Isoamylase, central domain {Pseudomonas amyloderam | 89.0 | |
| d1e43a2 | 393 | Bacterial alpha-amylase {Chimera (Bacillus amyloli | 88.84 | |
| d2f8ja1 | 334 | Histidinol-phosphate aminotransferase HisC {Thermo | 88.84 | |
| d2guya2 | 381 | Fungal alpha-amylases {Aspergillus oryzae, Taka-am | 88.82 | |
| d1ua7a2 | 344 | Bacterial alpha-amylase {Bacillus subtilis [TaxId: | 88.74 | |
| d1eh9a3 | 400 | Glycosyltrehalose trehalohydrolase, central domain | 88.56 | |
| d1m7xa3 | 396 | 1,4-alpha-glucan branching enzyme, central domain | 88.32 | |
| d1qwga_ | 251 | (2r)-phospho-3-sulfolactate synthase ComA {Archaeo | 88.04 | |
| d2bhua3 | 420 | Glycosyltrehalose trehalohydrolase, central domain | 87.55 | |
| d1wzaa2 | 409 | Bacterial alpha-amylase {Halothermothrix orenii [T | 87.53 | |
| d1u83a_ | 249 | (2r)-phospho-3-sulfolactate synthase ComA {Bacillu | 87.19 | |
| d1m53a2 | 478 | Isomaltulose synthase PalI {Klebsiella sp., lx3 [T | 86.97 | |
| d1ht6a2 | 347 | Plant alpha-amylase {Barley (Hordeum vulgare), AMY | 86.96 | |
| d1uoka2 | 479 | Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 13 | 86.75 | |
| d1lwha2 | 391 | 4-alpha-glucanotransferase {Thermotoga maritima [T | 86.49 | |
| d2aaaa2 | 381 | Fungal alpha-amylases {Aspergillus niger, acid amy | 86.39 | |
| d1h3ga3 | 422 | Cyclomaltodextrinase, central domain {Flavobacteri | 85.89 | |
| d1j0ha3 | 382 | Neopullulanase, central domain {Bacillus stearothe | 85.32 | |
| d1ea9c3 | 382 | Maltogenic amylase, central domain {Bacillus sp., | 85.28 | |
| d1gjwa2 | 572 | Maltosyltransferase {Thermotoga maritima [TaxId: 2 | 84.27 | |
| d1wzla3 | 382 | Maltogenic amylase, central domain {Thermoactinomy | 82.56 | |
| g3bzy.1 | 100 | Type III secretion proteins EscU {Escherichia coli | 82.11 | |
| d1g5aa2 | 554 | Amylosucrase {Neisseria polysaccharea [TaxId: 489] | 80.65 |
| >d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: PLP-dependent transferase-like superfamily: PLP-dependent transferases family: Beta-eliminating lyases domain: Tyrosine phenol-lyase species: Erwinia herbicola [TaxId: 549]
Probab=99.48 E-value=1.8e-14 Score=100.94 Aligned_cols=66 Identities=14% Similarity=0.192 Sum_probs=56.7
Q ss_pred CcHHHHHHHHHhcCCcEEEecccchHHhhh--------CCCCHHHH----hcCCcEEEEcCCCCCccceeEEEEeccc
Q psy15462 2 SIDPQLKARCQEHNIPVHMDGARVFNAASY--------LGLPLAEV----CASVDTVMFCLSKGLGAPVGSILAGPEE 67 (71)
Q Consensus 2 ~~l~~i~~~a~~~gi~l~~DgAr~~~~~~~--------~~~~~~~~----~~~~D~v~~s~~K~lg~p~gg~l~g~~~ 67 (71)
+++++|+++|++||+++|+||||+++++++ .+.++.++ ...+|+++||++|.+++|.||+++.+.+
T Consensus 195 ~~l~~i~~~a~~~~~~~~~D~a~~~~~a~~~~~~~~~~~~~~i~~i~~~~~~~ad~~s~s~~K~~~~~~GG~i~~~~~ 272 (456)
T d1c7ga_ 195 ANMRAVHEMASTYGIKIFYDATRCVENAYFIKEQEAGYENVSIKDIVHEMFSYADGCTMSGKKDCLVNIGGFLCMNDE 272 (456)
T ss_dssp HHHHHHHHHHHHHTCCEEEECTTHHHHHHHHHHHSTTCTTSCHHHHHHHHHTTCSEEEEETTTTTCCSSCEEEEESCH
T ss_pred HHHHHHHHHHHHcCCEEEEEcchhhcchhhhcccccccCCCChhhhccccccccccEEEeccccccccceeEEEcCCH
Confidence 578999999999999999999999988764 35666554 5889999999999999999999987654
|
| >d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} | Back information, alignment and structure |
|---|
| >d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} | Back information, alignment and structure |
|---|
| >d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2aeua1 c.67.1.8 (A:9-374) Hypothetical protein MJ0158 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} | Back information, alignment and structure |
|---|
| >d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} | Back information, alignment and structure |
|---|
| >d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kl1a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2bkwa1 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2a7va1 c.67.1.4 (A:26-488) Serine hydroxymethyltransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} | Back information, alignment and structure |
|---|
| >d1rv3a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1dfoa_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]} | Back information, alignment and structure |
|---|
| >d1y4ia1 c.67.1.3 (A:2-398) Methionine gamma-lyase, MGL {Citrobacter freundii [TaxId: 546]} | Back information, alignment and structure |
|---|
| >d1qgna_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1gc0a_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1mdoa_ c.67.1.4 (A:) Aminotransferase ArnB {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d2ctza1 c.67.1.3 (A:1-421) O-acetyl-L-homoserine sulfhydrylase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ibja_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1cs1a_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iuga_ c.67.1.3 (A:) Subgroup IV putative aspartate aminotransferase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1o69a_ c.67.1.4 (A:) Aminotransferase homolog WlaK (PglE, Cj1121c) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1w23a_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]} | Back information, alignment and structure |
|---|
| >d1cl1a_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1b9ha_ c.67.1.4 (A:) 3-amino-5-hydroxybenzoic acid synthase (AHBA synthase) {Amycolatopsis mediterranei [TaxId: 33910]} | Back information, alignment and structure |
|---|
| >d1n8pa_ c.67.1.3 (A:) Cystathionine gamma-lyase (CYS3) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wyua1 c.67.1.7 (A:1-437) Glycine dehydrogenase (decarboxylating) subunit 1 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1pffa_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL2 [TaxId: 5722]} | Back information, alignment and structure |
|---|
| >d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} | Back information, alignment and structure |
|---|
| >d2fnua1 c.67.1.4 (A:2-372) Spore coat polysaccharide biosynthesis protein C {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2gsaa_ c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase (aminotransferase) {Synechococcus sp., strain GR6 [TaxId: 1131]} | Back information, alignment and structure |
|---|
| >d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2c0ra1 c.67.1.4 (A:2-362) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} | Back information, alignment and structure |
|---|
| >d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]} | Back information, alignment and structure |
|---|
| >d1z7da1 c.67.1.4 (A:7-410) Ornithine aminotransferase {Plasmodium yoelii yoelii [TaxId: 73239]} | Back information, alignment and structure |
|---|
| >d1e5ea_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL1 [TaxId: 5722]} | Back information, alignment and structure |
|---|
| >d1iaya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Tomato (Lycopersicon esculentum) [TaxId: 4081]} | Back information, alignment and structure |
|---|
| >d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sffa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} | Back information, alignment and structure |
|---|
| >d1lc5a_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica [TaxId: 28901]} | Back information, alignment and structure |
|---|
| >d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1w7la_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vefa1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1zoda1 c.67.1.4 (A:3-433) Dialkylglycine decarboxylase {Pseudomonas cepacia [TaxId: 292]} | Back information, alignment and structure |
|---|
| >d1vp4a_ c.67.1.1 (A:) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2r5ea1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]} | Back information, alignment and structure |
|---|
| >d2byla1 c.67.1.4 (A:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gb3a1 c.67.1.1 (A:4-392) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} | Back information, alignment and structure |
|---|
| >d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1bw0a_ c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1s0aa_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1bjna_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wyub1 c.67.1.7 (B:2-472) Glycine dehydrogenase subunit 2 (P-protein) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1ohwa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} | Back information, alignment and structure |
|---|
| >d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} | Back information, alignment and structure |
|---|
| >d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} | Back information, alignment and structure |
|---|
| >d1fg7a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} | Back information, alignment and structure |
|---|
| >d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} | Back information, alignment and structure |
|---|
| >d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} | Back information, alignment and structure |
|---|
| >d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]} | Back information, alignment and structure |
|---|
| >d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]} | Back information, alignment and structure |
|---|
| >d2f8ja1 c.67.1.1 (A:1-334) Histidinol-phosphate aminotransferase HisC {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} | Back information, alignment and structure |
|---|
| >d1ua7a2 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qwga_ c.1.27.1 (A:) (2r)-phospho-3-sulfolactate synthase ComA {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1wzaa2 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Halothermothrix orenii [TaxId: 31909]} | Back information, alignment and structure |
|---|
| >d1u83a_ c.1.27.1 (A:) (2r)-phospho-3-sulfolactate synthase ComA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} | Back information, alignment and structure |
|---|
| >d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} | Back information, alignment and structure |
|---|
| >d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1lwha2 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d1h3ga3 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]} | Back information, alignment and structure |
|---|
| >d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ea9c3 c.1.8.1 (C:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} | Back information, alignment and structure |
|---|
| >d1g5aa2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} | Back information, alignment and structure |
|---|